F418189

General Info

Members Datasets Scaffolds Average Seq Length
350 232 700 123

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10651077|Ga0081455_106510772
Length 134
Sequence MRPSSSPSEDPRYAAGMAVRREVLGDEHVDRAQARTTEFTADFQDYITRCAWGEVWTRPGIDRRMRSAITLAVLMTLRAEEELAMHVRAALRNGLTPDEIGEVLLQGAIYAGVPAANTAFAVAQRALAEADAGG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
223 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
230 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
231 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
232 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0.57
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 6.86
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10651077 3300005937 Bacteria 678
2 JGI25151J46595_10000149 3300003187 Bacteria 91894
3 JGI25160J50197_1010664 3300003354 Bacteria 3307
4 JGI25404J52841_10020181 3300003659 Bacteria 1444
5 Ga0070683_100043015 3300005329 Bacteria 4161
6 Ga0070668_100562267 3300005347 Bacteria 994
7 Ga0070668_100752477 3300005347 Bacteria 863
8 Ga0070668_101179554 3300005347 Bacteria 693
9 Ga0070669_100911447 3300005353 Bacteria 751
10 Ga0070675_100169031 3300005354 Bacteria 1884
11 Ga0070714_100993489 3300005435 Bacteria 816
12 Ga0070714_101702489 3300005435 Bacteria 616
13 Ga0070714_102093255 3300005435 Bacteria 551
14 Ga0070713_100013388 3300005436 Bacteria 6055
15 Ga0070713_101272628 3300005436 Bacteria 712
16 Ga0070710_10028371 3300005437 Bacteria 2993
17 Ga0070710_10300300 3300005437 Bacteria 1048
18 Ga0070711_100005089 3300005439 Bacteria 7825
19 Ga0070705_100018816 3300005440 Bacteria 3626
20 Ga0070694_100481189 3300005444 Bacteria 985
21 Ga0070708_100438597 3300005445 Bacteria 1232
22 Ga0070663_100463913 3300005455 Bacteria 1046
23 Ga0068867_100296995 3300005459 Bacteria 1330
24 Ga0070685_11436393 3300005466 Bacteria 530
25 Ga0070706_100373238 3300005467 Bacteria 1329
26 Ga0070707_100593565 3300005468 Bacteria 1070
27 Ga0070698_100662787 3300005471 Bacteria 985
28 Ga0070698_100782593 3300005471 Bacteria 898
29 Ga0070699_100531245 3300005518 Bacteria 1070
30 Ga0070684_100025073 3300005535 Bacteria 5008
31 Ga0070684_101360049 3300005535 Bacteria 669
32 Ga0070704_100030234 3300005549 Bacteria 3627
33 Ga0068855_100011074 3300005563 Bacteria 10884
34 Ga0068856_100174675 3300005614 Bacteria 2161
35 Ga0068856_101315226 3300005614 Bacteria 738
36 Ga0070702_100368740 3300005615 Bacteria 1017
37 Ga0068864_100146611 3300005618 Bacteria 2134
38 Ga0068866_10045562 3300005718 Bacteria 2200
39 Ga0068858_100180044 3300005842 Bacteria 1995
40 Ga0068860_100624920 3300005843 Bacteria 1084
41 Ga0068862_100443366 3300005844 Bacteria 1222
42 Ga0081455_10025666 3300005937 Bacteria 5434
43 Ga0081455_10569918 3300005937 Bacteria 744
44 Ga0081540_1000011 3300005983 Bacteria 191880
45 Ga0081540_1003069 3300005983 Bacteria 13380
46 Ga0081539_10068505 3300005985 Bacteria 1914
47 Ga0070717_10007171 3300006028 Bacteria 8260
48 Ga0070717_10100944 3300006028 Bacteria 2450
49 Ga0075365_10174673 3300006038 Bacteria 1500
50 Ga0075363_100577307 3300006048 Bacteria 672
51 Ga0075364_10050461 3300006051 Bacteria 2715
52 Ga0070715_10294929 3300006163 Unclassified 865
53 Ga0070716_100917828 3300006173 Bacteria 687
54 Ga0070716_101285909 3300006173 Bacteria 591
55 Ga0070712_100009809 3300006175 Bacteria 6033
56 Ga0075367_10206243 3300006178 Bacteria 1228
57 Ga0075433_10074891 3300006852 Bacteria 2979
58 Ga0075433_10595474 3300006852 Bacteria 971
59 Ga0075434_100071351 3300006871 Bacteria 3465
60 Ga0105240_10135089 3300009093 Bacteria 2954
61 Ga0111539_10125500 3300009094 Bacteria 3007
62 Ga0111539_10724796 3300009094 Bacteria 1158
63 Ga0114129_11082715 3300009147 Bacteria 1004
64 Ga0114129_11092744 3300009147 Bacteria 999
65 Ga0114129_12550577 3300009147 Bacteria 611
66 Ga0105243_10236966 3300009148 Bacteria 1622
67 Ga0105243_10357535 3300009148 Bacteria 1343
68 Ga0105242_10811033 3300009176 Bacteria 927
69 Ga0105033_103335 3300009986 Bacteria 1349
70 Ga0105239_10136450 3300010375 Bacteria 2731
71 Ga0105239_10285544 3300010375 Bacteria 1858
72 Ga0105246_10440225 3300011119 Bacteria 1093
73 Ga0157371_10331171 3300013102 Bacteria 1106
74 Ga0157371_10576735 3300013102 Bacteria 835
75 Ga0157370_10026504 3300013104 Bacteria 5722
76 Ga0157369_11592729 3300013105 Bacteria 664
77 Ga0157378_10306992 3300013297 Bacteria 1538
78 Ga0157372_10619284 3300013307 Bacteria 1261
79 Ga0157372_11747593 3300013307 Bacteria 715
80 Ga0157380_11118199 3300014326 Bacteria 828
81 Ga0182007_10108465 3300015262 Unclassified 923
82 Ga0182005_1059675 3300015265 Bacteria 1042
83 Ga0206351_10419047 3300020077 Bacteria 542
84 Ga0206353_10677561 3300020082 Bacteria 848
85 Ga0213876_10075872 3300021384 Bacteria 1775
86 Ga0213875_10046059 3300021388 Bacteria 2047
87 Ga0213875_10057150 3300021388 Bacteria 1827
88 Ga0209130_1001015 3300025284 Bacteria 21726
89 Ga0209025_1000270 3300025294 Bacteria 120921
90 Ga0209758_1007187 3300025297 Bacteria 7676
91 Ga0207426_1000487 3300025302 Bacteria 59943
92 Ga0207656_10124448 3300025321 Bacteria 1203
93 Ga0207653_10036079 3300025885 Bacteria 1610
94 Ga0207692_10085571 3300025898 Bacteria 1696
95 Ga0207692_10937153 3300025898 Bacteria 570
96 Ga0207685_10004827 3300025905 Bacteria 3482
97 Ga0207699_10162588 3300025906 Bacteria 1487
98 Ga0207699_10410295 3300025906 Bacteria 966
99 Ga0207643_10028073 3300025908 Bacteria 3123
100 Ga0207705_10199658 3300025909 Bacteria 1515
101 Ga0207684_10234354 3300025910 Bacteria 1584
102 Ga0207695_10818186 3300025913 Bacteria 812
103 Ga0207693_10033383 3300025915 Bacteria 4061
104 Ga0207693_10284264 3300025915 Bacteria 1296
105 Ga0207663_10134630 3300025916 Bacteria 1713
106 Ga0207646_10208947 3300025922 Bacteria 1763
107 Ga0207659_10057101 3300025926 Bacteria 2797
108 Ga0207700_10018831 3300025928 Bacteria 4651
109 Ga0207700_10751353 3300025928 Bacteria 871
110 Ga0207664_10118669 3300025929 Bacteria 2210
111 Ga0207664_11438684 3300025929 Bacteria 610
112 Ga0207644_10168271 3300025931 Bacteria 1709
113 Ga0207706_10537971 3300025933 Bacteria 1007
114 Ga0207670_10325665 3300025936 Bacteria 1210
115 Ga0207669_10735377 3300025937 Bacteria 814
116 Ga0207669_10745723 3300025937 Bacteria 808
117 Ga0207669_11653955 3300025937 Bacteria 547
118 Ga0207665_10668894 3300025939 Bacteria 815
119 Ga0207661_10062002 3300025944 Bacteria 3024
120 Ga0207661_10274778 3300025944 Bacteria 1504
121 Ga0207679_10021787 3300025945 Bacteria 4352
122 Ga0207667_10169968 3300025949 Bacteria 2241
123 Ga0207712_10296633 3300025961 Bacteria 1325
124 Ga0207668_10064989 3300025972 Bacteria 2581
125 Ga0207668_10409248 3300025972 Bacteria 1149
126 Ga0207677_11171611 3300026023 Bacteria 703
127 Ga0207702_10218791 3300026078 Bacteria 1774
128 Ga0207702_11997956 3300026078 Bacteria 570
129 Ga0207683_10024243 3300026121 Bacteria 5223
130 Ga0268265_11531170 3300028380 Bacteria 671
131 Ga0268265_12204303 3300028380 Bacteria 558
132 Ga0265319_1019081 3300028563 Bacteria 2569
133 Ga0265318_10005477 3300028577 Bacteria 5961
134 Ga0265320_10009825 3300031240 Bacteria 5737
135 Ga0307409_100284535 3300031995 Bacteria 1530
136 Ga0307409_100942285 3300031995 Bacteria 879
137 Ga0307416_100098351 3300032002 Bacteria 2538
138 Ga0307416_100360858 3300032002 Bacteria 1475
139 Ga0307416_100840051 3300032002 Bacteria 1016
140 Ga0307415_100382415 3300032126 Bacteria 1196
141 Ga0373954_0064119 3300035118 Bacteria 1737
142 Ga0373956_0448153 3300035119 Bacteria 616
143 Ga0373957_0063942 3300035120 Bacteria 1430
144 Ga0373961_0233306 3300035241 Bacteria 660
145 Ga0373962_0053650 3300035242 Bacteria 1167
146 Ga0373924_0049937 3300035410 Bacteria 1732
147 Ga0373935_0995401 3300035692 Bacteria 623
148 Ga0373933_0283672 3300035724 Bacteria 1070
149 Ga0373947_0887279 3300035725 Bacteria 609
150 Ga0373937_0020226 3300036401 Bacteria 5966
151 Ga0395900_0893981 3300037418 Bacteria 812
152 Ga0395900_1375243 3300037418 Bacteria 619
153 Ga0395898_1085674 3300037466 Bacteria 734
154 Ga0395905_0000242 3300037471 Bacteria 82835
155 Ga0436364_0038827 3300037853 Bacteria 731
156 Ga0436364_0183805 3300037853 Bacteria 1003
157 Ga0436364_0236581 3300037853 Bacteria 2717
158 Ga0436364_0956653 3300037853 Bacteria 6981
159 Ga0436365_0143471 3300039437 Bacteria 1002
160 Ga0436365_0648414 3300039437 Bacteria 21379
161 Ga0436365_1742534 3300039437 Bacteria 2221
162 Ga0436363_0748082 3300039450 Bacteria 939
163 Ga0436362_0694523 3300039453 Bacteria 1318
164 Ga0439445_0256180 3300042004 Bacteria 523
165 Ga0439435_0062716 3300042436 Bacteria 1086
166 Ga0466969_0096463 3300044656 Bacteria 1396
167 Ga0466965_0856583 3300044683 Bacteria 528
168 Ga0466966_0093984 3300044684 Bacteria 1859
169 Ga0466963_0066155 3300044694 Bacteria 2424
170 Ga0466963_0452406 3300044694 Bacteria 906
171 Ga0466963_0803544 3300044694 Bacteria 663
172 Ga0466963_0826728 3300044694 Bacteria 653
173 Ga0466964_0046664 3300044706 Bacteria 1766
174 Ga0466964_0270710 3300044706 Bacteria 845
175 Ga0466964_0732387 3300044706 Unclassified 554
176 Ga0466964_0911131 3300044706 Bacteria 503
177 Ga0466968_0048599 3300044735 Bacteria 1806
178 Ga0466970_0476602 3300044765 Bacteria 717
179 Ga0466957_0209815 3300044842 Bacteria 1282
180 Ga0466959_0023857 3300045049 Bacteria 4528
181 Ga0466959_0120552 3300045049 Bacteria 1865
182 Ga0451576_0894137 3300045051 Bacteria 932
183 Ga0466958_0207004 3300045836 Bacteria 1249
184 Ga0466958_0774301 3300045836 Bacteria 625
185 Ga0466967_0021807 3300045976 Bacteria 5212
186 Ga0466967_0093694 3300045976 Bacteria 2733
187 Ga0466967_0096916 3300045976 Bacteria 2691
188 Ga0466967_0249949 3300045976 Bacteria 1693
189 Ga0466967_0293134 3300045976 Bacteria 1563
190 Ga0466967_1246630 3300045976 Bacteria 741
191 Ga0466967_1478274 3300045976 Bacteria 677
192 Ga0466967_1492529 3300045976 Bacteria 673
193 Ga0466967_1855070 3300045976 Unclassified 600
194 Ga0495592_0121463 3300046454 Bacteria 1837
195 Ga0495592_0146709 3300046454 Bacteria 1635
196 Ga0495592_0480877 3300046454 Bacteria 773
197 Ga0495651_0006292 3300046462 Bacteria 9082
198 Ga0495651_0424435 3300046462 Bacteria 864
199 Ga0495653_0068394 3300046463 Bacteria 2664
200 Ga0495653_0756965 3300046463 Bacteria 586
201 Ga0495662_0106986 3300046476 Bacteria 1370
202 Ga0495608_0088339 3300046511 Bacteria 2006
203 Ga0495608_0364028 3300046511 Bacteria 888
204 Ga0495608_0889763 3300046511 Bacteria 522
205 Ga0495618_0328406 3300046514 Bacteria 946
206 Ga0495618_0816318 3300046514 Bacteria 542
207 Ga0495628_0072527 3300046516 Bacteria 2683
208 Ga0495628_0091969 3300046516 Bacteria 2347
209 Ga0495630_1138300 3300046517 Bacteria 591
210 Ga0495630_1288381 3300046517 Bacteria 551
211 Ga0495644_0071706 3300046523 Bacteria 1302
212 Ga0495652_0029286 3300046529 Bacteria 4839
213 Ga0495652_0094293 3300046529 Bacteria 2441
214 Ga0495652_0998234 3300046529 Unclassified 548
215 Ga0495640_0156348 3300046533 Bacteria 1463
216 Ga0495640_0245648 3300046533 Bacteria 1122
217 Ga0495587_0034745 3300046536 Bacteria 3039
218 Ga0495609_0176588 3300046538 Bacteria 900
219 Ga0495645_0062683 3300046543 Bacteria 2693
220 Ga0495622_0412757 3300046557 Bacteria 581
221 Ga0495667_0003880 3300046559 Bacteria 10032
222 Ga0495667_0812675 3300046559 Bacteria 576
223 Ga0495656_0144364 3300046615 Bacteria 1144
224 Ga0495635_0080220 3300046663 Bacteria 2233
225 Ga0495635_0143247 3300046663 Bacteria 1627
226 Ga0495661_0287252 3300046665 Bacteria 827
227 Ga0495661_0477262 3300046665 Bacteria 597
228 Ga0495657_0032741 3300046675 Bacteria 3625
229 Ga0495657_0151839 3300046675 Bacteria 1438
230 Ga0495657_0198486 3300046675 Bacteria 1224
231 Ga0495657_0814244 3300046675 Bacteria 533
232 Ga0495599_0149835 3300046678 Bacteria 1445
233 Ga0495623_0092609 3300046679 Bacteria 1852
234 Ga0495646_0082462 3300046680 Bacteria 1871
235 Ga0495646_0283669 3300046680 Bacteria 879
236 Ga0495613_0428302 3300046689 Bacteria 899
237 Ga0495670_0334570 3300046691 Bacteria 814
238 Ga0495600_0368898 3300046809 Bacteria 897
239 Ga0495600_0605289 3300046809 Bacteria 665
240 Ga0495581_0064453 3300047315 Bacteria 2117
241 Ga0495604_0049234 3300047317 Bacteria 3276
242 Ga0495604_0240394 3300047317 Bacteria 1238
243 Ga0495674_0060513 3300047319 Bacteria 3304
244 Ga0495674_0124776 3300047319 Bacteria 2173
245 Ga0495674_0270222 3300047319 Bacteria 1395
246 Ga0495674_0308564 3300047319 Bacteria 1291
247 Ga0495680_0020960 3300047322 Bacteria 5479
248 Ga0495680_0293495 3300047322 Bacteria 1143
249 Ga0495680_0386307 3300047322 Bacteria 969
250 Ga0495680_1086081 3300047322 Bacteria 506
251 Ga0495677_0082960 3300047445 Bacteria 1203
252 Ga0495684_0025661 3300047471 Bacteria 4528
253 Ga0495684_0042634 3300047471 Bacteria 3475
254 Ga0495684_0762710 3300047471 Bacteria 635
255 Ga0495602_0142657 3300048088 Bacteria 1894
256 Ga0495602_0181584 3300048088 Bacteria 1622
257 Ga0495602_0344158 3300048088 Bacteria 1078
258 Ga0495602_0575137 3300048088 Bacteria 778
259 Ga0496100_0056471 3300048903 Bacteria 2568
260 Ga0496100_0803627 3300048903 Bacteria 737
261 Ga0496101_0319485 3300048904 Bacteria 1218
262 Ga0496102_0117481 3300048905 Bacteria 2482
263 Ga0496102_0700270 3300048905 Bacteria 936
264 Ga0496104_0074312 3300048907 Bacteria 3236
265 Ga0496104_0107655 3300048907 Bacteria 2671
266 Ga0496105_0326250 3300048908 Bacteria 1229
267 Ga0496105_0374076 3300048908 Bacteria 1135
268 Ga0496106_0026972 3300048909 Bacteria 4277
269 Ga0496106_1247924 3300048909 Bacteria 578
270 Ga0496107_0030219 3300048910 Bacteria 3861
271 Ga0496108_0345548 3300048911 Bacteria 1298
272 Ga0496109_0179695 3300048912 Bacteria 1987
273 Ga0496109_1814476 3300048912 Bacteria 543
274 Ga0496110_0184259 3300048913 Bacteria 1896
275 Ga0496110_1049800 3300048913 Bacteria 723
276 Ga0496111_0760593 3300048914 Bacteria 702
277 Ga0496112_0001876 3300048915 Bacteria 16564
278 Ga0496112_0905053 3300048915 Bacteria 804
279 Ga0496113_0498190 3300048916 Bacteria 978
280 Ga0496113_1019222 3300048916 Bacteria 651
281 Ga0496114_0395357 3300048917 Bacteria 1224
282 Ga0496115_0060277 3300048918 Bacteria 3057
283 Ga0501031_0057013 3300049568 Bacteria 2545
284 Ga0501032_0170758 3300049569 Bacteria 1426
285 Ga0501033_0005573 3300049570 Bacteria 9959
286 Ga0501034_0857837 3300049571 Bacteria 798
287 Ga0501036_0017626 3300049572 Bacteria 5974
288 Ga0501037_0061329 3300049573 Bacteria 2742
289 Ga0501038_0216651 3300049574 Bacteria 1529
290 Ga0501039_0264832 3300049575 Bacteria 1351
291 Ga0501039_0319057 3300049575 Bacteria 1221
292 Ga0501042_0018457 3300049578 Bacteria 4828
293 Ga0501043_0039807 3300049579 Bacteria 3694
294 Ga0501046_0034092 3300049580 Bacteria 4110
295 Ga0501047_0552382 3300049581 Bacteria 976
296 Ga0501047_0881568 3300049581 Bacteria 708
297 Ga0501048_0024893 3300049582 Bacteria 4366
298 Ga0501069_0052889 3300049585 Bacteria 2262
299 Ga0501069_0122355 3300049585 Bacteria 1487
300 Ga0501070_0340902 3300049586 Bacteria 1217
301 Ga0501070_0774907 3300049586 Bacteria 754
302 Ga0501070_1053956 3300049586 Bacteria 629
303 Ga0501071_0892246 3300049587 Bacteria 686
304 Ga0501072_0013422 3300049588 Bacteria 6270
305 Ga0501072_0318071 3300049588 Bacteria 1237
306 Ga0501073_0046067 3300049589 Bacteria 3069
307 Ga0501074_0293733 3300049590 Bacteria 1155
308 Ga0501074_0557501 3300049590 Bacteria 811
309 Ga0501075_0164494 3300049591 Bacteria 1692
310 Ga0501077_0019003 3300049593 Bacteria 4344
311 Ga0501079_0045535 3300049741 Bacteria 3385
312 Ga0501080_0037116 3300049742 Bacteria 4549
313 Ga0501081_0012294 3300049743 Bacteria 5620
314 Ga0501035_0119300 3300049822 Bacteria 2307
315 Ga0501044_0402135 3300049823 Bacteria 1282
316 Ga0501044_0648767 3300049823 Bacteria 945
317 Ga0501045_0005836 3300049824 Bacteria 8527
318 nmdc:mga03n38_431748_c1 3300050490 Bacteria 730
319 nmdc:mga00v17_31302_c1 3300050491 Bacteria 3137
320 nmdc:mga0yw44_241747_c1 3300050492 Bacteria 1200
321 nmdc:mga0yw44_623863_c1 3300050492 Bacteria 733
322 nmdc:mga06z11_217196_c1 3300050494 Bacteria 1116
323 nmdc:mga08y16_1506701_c1 3300050511 Bacteria 633
324 nmdc:mga08y16_33259_c1 3300050511 Bacteria 5416
325 nmdc:mga0n895_54184_c1 3300050512 Bacteria 3944
326 nmdc:mga0n895_832991_c1 3300050512 Bacteria 911
327 nmdc:mga08x19_463233_c1 3300050514 Bacteria 893
328 nmdc:mga0a205_545298_c1 3300050515 Bacteria 1015
329 nmdc:mga0a205_82562_c1 3300050515 Bacteria 3104
330 Ga0495601_0111841 3300053077 Bacteria 1769
331 Ga0495601_0274051 3300053077 Bacteria 1100
332 Ga0495601_0345511 3300053077 Bacteria 968
333 Ga0495612_0082597 3300053078 Bacteria 1351
334 Ga0495612_0443954 3300053078 Bacteria 592
335 Ga0495595_0112986 3300053084 Bacteria 1318
336 Ga0495595_0326070 3300053084 Bacteria 773
337 Ga0495619_0085058 3300053085 Bacteria 2135
338 Ga0495619_0156740 3300053085 Bacteria 1571
339 Ga0500660_243183 3300053100 Bacteria 563
340 Ga0500585_208014 3300053144 Bacteria 647
341 Ga0500588_0066546 3300053146 Bacteria 1170
342 Ga0500622_0004660 3300053156 Bacteria 8483
343 Ga0501082_0057019 3300060353 Bacteria 3365
344 Ga0501082_1072505 3300060353 Bacteria 704
345 Ga0466962_0045377 3300061719 Bacteria 2101
346 Ga0530510_0571078 3300061734 Bacteria 859
347 2808973821 2808606384 Bacteria 8474373
348 2809008737 2808606390 Bacteria 8476311
349 2809015757 2808606391 Bacteria 8308166
350 2837652048 2837651117 Bacteria 3772164
351 Ga0081455_10651077
352 JGI25151J46595_10000149
353 JGI25160J50197_1010664
354 JGI25404J52841_10020181
355 Ga0070683_100043015
356 Ga0070668_100562267
357 Ga0070668_100752477
358 Ga0070668_101179554
359 Ga0070669_100911447
360 Ga0070675_100169031
361 Ga0070714_100993489
362 Ga0070714_101702489
363 Ga0070714_102093255
364 Ga0070713_100013388
365 Ga0070713_101272628
366 Ga0070710_10028371
367 Ga0070710_10300300
368 Ga0070711_100005089
369 Ga0070705_100018816
370 Ga0070694_100481189
371 Ga0070708_100438597
372 Ga0070663_100463913
373 Ga0068867_100296995
374 Ga0070685_11436393
375 Ga0070706_100373238
376 Ga0070707_100593565
377 Ga0070698_100662787
378 Ga0070698_100782593
379 Ga0070699_100531245
380 Ga0070684_100025073
381 Ga0070684_101360049
382 Ga0070704_100030234
383 Ga0068855_100011074
384 Ga0068856_100174675
385 Ga0068856_101315226
386 Ga0070702_100368740
387 Ga0068864_100146611
388 Ga0068866_10045562
389 Ga0068858_100180044
390 Ga0068860_100624920
391 Ga0068862_100443366
392 Ga0081455_10025666
393 Ga0081455_10569918
394 Ga0081540_1000011
395 Ga0081540_1003069
396 Ga0081539_10068505
397 Ga0070717_10007171
398 Ga0070717_10100944
399 Ga0075365_10174673
400 Ga0075363_100577307
401 Ga0075364_10050461
402 Ga0070715_10294929
403 Ga0070716_100917828
404 Ga0070716_101285909
405 Ga0070712_100009809
406 Ga0075367_10206243
407 Ga0075433_10074891
408 Ga0075433_10595474
409 Ga0075434_100071351
410 Ga0105240_10135089
411 Ga0111539_10125500
412 Ga0111539_10724796
413 Ga0114129_11082715
414 Ga0114129_11092744
415 Ga0114129_12550577
416 Ga0105243_10236966
417 Ga0105243_10357535
418 Ga0105242_10811033
419 Ga0105033_103335
420 Ga0105239_10136450
421 Ga0105239_10285544
422 Ga0105246_10440225
423 Ga0157371_10331171
424 Ga0157371_10576735
425 Ga0157370_10026504
426 Ga0157369_11592729
427 Ga0157378_10306992
428 Ga0157372_10619284
429 Ga0157372_11747593
430 Ga0157380_11118199
431 Ga0182007_10108465
432 Ga0182005_1059675
433 Ga0206351_10419047
434 Ga0206353_10677561
435 Ga0213876_10075872
436 Ga0213875_10046059
437 Ga0213875_10057150
438 Ga0209130_1001015
439 Ga0209025_1000270
440 Ga0209758_1007187
441 Ga0207426_1000487
442 Ga0207656_10124448
443 Ga0207653_10036079
444 Ga0207692_10085571
445 Ga0207692_10937153
446 Ga0207685_10004827
447 Ga0207699_10162588
448 Ga0207699_10410295
449 Ga0207643_10028073
450 Ga0207705_10199658
451 Ga0207684_10234354
452 Ga0207695_10818186
453 Ga0207693_10033383
454 Ga0207693_10284264
455 Ga0207663_10134630
456 Ga0207646_10208947
457 Ga0207659_10057101
458 Ga0207700_10018831
459 Ga0207700_10751353
460 Ga0207664_10118669
461 Ga0207664_11438684
462 Ga0207644_10168271
463 Ga0207706_10537971
464 Ga0207670_10325665
465 Ga0207669_10735377
466 Ga0207669_10745723
467 Ga0207669_11653955
468 Ga0207665_10668894
469 Ga0207661_10062002
470 Ga0207661_10274778
471 Ga0207679_10021787
472 Ga0207667_10169968
473 Ga0207712_10296633
474 Ga0207668_10064989
475 Ga0207668_10409248
476 Ga0207677_11171611
477 Ga0207702_10218791
478 Ga0207702_11997956
479 Ga0207683_10024243
480 Ga0268265_11531170
481 Ga0268265_12204303
482 Ga0265319_1019081
483 Ga0265318_10005477
484 Ga0265320_10009825
485 Ga0307409_100284535
486 Ga0307409_100942285
487 Ga0307416_100098351
488 Ga0307416_100360858
489 Ga0307416_100840051
490 Ga0307415_100382415
491 Ga0373954_0064119
492 Ga0373956_0448153
493 Ga0373957_0063942
494 Ga0373961_0233306
495 Ga0373962_0053650
496 Ga0373924_0049937
497 Ga0373935_0995401
498 Ga0373933_0283672
499 Ga0373947_0887279
500 Ga0373937_0020226
501 Ga0395900_0893981
502 Ga0395900_1375243
503 Ga0395898_1085674
504 Ga0395905_0000242
505 Ga0436364_0038827
506 Ga0436364_0183805
507 Ga0436364_0236581
508 Ga0436364_0956653
509 Ga0436365_0143471
510 Ga0436365_0648414
511 Ga0436365_1742534
512 Ga0436363_0748082
513 Ga0436362_0694523
514 Ga0439445_0256180
515 Ga0439435_0062716
516 Ga0466969_0096463
517 Ga0466965_0856583
518 Ga0466966_0093984
519 Ga0466963_0066155
520 Ga0466963_0452406
521 Ga0466963_0803544
522 Ga0466963_0826728
523 Ga0466964_0046664
524 Ga0466964_0270710
525 Ga0466964_0732387
526 Ga0466964_0911131
527 Ga0466968_0048599
528 Ga0466970_0476602
529 Ga0466957_0209815
530 Ga0466959_0023857
531 Ga0466959_0120552
532 Ga0451576_0894137
533 Ga0466958_0207004
534 Ga0466958_0774301
535 Ga0466967_0021807
536 Ga0466967_0093694
537 Ga0466967_0096916
538 Ga0466967_0249949
539 Ga0466967_0293134
540 Ga0466967_1246630
541 Ga0466967_1478274
542 Ga0466967_1492529
543 Ga0466967_1855070
544 Ga0495592_0121463
545 Ga0495592_0146709
546 Ga0495592_0480877
547 Ga0495651_0006292
548 Ga0495651_0424435
549 Ga0495653_0068394
550 Ga0495653_0756965
551 Ga0495662_0106986
552 Ga0495608_0088339
553 Ga0495608_0364028
554 Ga0495608_0889763
555 Ga0495618_0328406
556 Ga0495618_0816318
557 Ga0495628_0072527
558 Ga0495628_0091969
559 Ga0495630_1138300
560 Ga0495630_1288381
561 Ga0495644_0071706
562 Ga0495652_0029286
563 Ga0495652_0094293
564 Ga0495652_0998234
565 Ga0495640_0156348
566 Ga0495640_0245648
567 Ga0495587_0034745
568 Ga0495609_0176588
569 Ga0495645_0062683
570 Ga0495622_0412757
571 Ga0495667_0003880
572 Ga0495667_0812675
573 Ga0495656_0144364
574 Ga0495635_0080220
575 Ga0495635_0143247
576 Ga0495661_0287252
577 Ga0495661_0477262
578 Ga0495657_0032741
579 Ga0495657_0151839
580 Ga0495657_0198486
581 Ga0495657_0814244
582 Ga0495599_0149835
583 Ga0495623_0092609
584 Ga0495646_0082462
585 Ga0495646_0283669
586 Ga0495613_0428302
587 Ga0495670_0334570
588 Ga0495600_0368898
589 Ga0495600_0605289
590 Ga0495581_0064453
591 Ga0495604_0049234
592 Ga0495604_0240394
593 Ga0495674_0060513
594 Ga0495674_0124776
595 Ga0495674_0270222
596 Ga0495674_0308564
597 Ga0495680_0020960
598 Ga0495680_0293495
599 Ga0495680_0386307
600 Ga0495680_1086081
601 Ga0495677_0082960
602 Ga0495684_0025661
603 Ga0495684_0042634
604 Ga0495684_0762710
605 Ga0495602_0142657
606 Ga0495602_0181584
607 Ga0495602_0344158
608 Ga0495602_0575137
609 Ga0496100_0056471
610 Ga0496100_0803627
611 Ga0496101_0319485
612 Ga0496102_0117481
613 Ga0496102_0700270
614 Ga0496104_0074312
615 Ga0496104_0107655
616 Ga0496105_0326250
617 Ga0496105_0374076
618 Ga0496106_0026972
619 Ga0496106_1247924
620 Ga0496107_0030219
621 Ga0496108_0345548
622 Ga0496109_0179695
623 Ga0496109_1814476
624 Ga0496110_0184259
625 Ga0496110_1049800
626 Ga0496111_0760593
627 Ga0496112_0001876
628 Ga0496112_0905053
629 Ga0496113_0498190
630 Ga0496113_1019222
631 Ga0496114_0395357
632 Ga0496115_0060277
633 Ga0501031_0057013
634 Ga0501032_0170758
635 Ga0501033_0005573
636 Ga0501034_0857837
637 Ga0501036_0017626
638 Ga0501037_0061329
639 Ga0501038_0216651
640 Ga0501039_0264832
641 Ga0501039_0319057
642 Ga0501042_0018457
643 Ga0501043_0039807
644 Ga0501046_0034092
645 Ga0501047_0552382
646 Ga0501047_0881568
647 Ga0501048_0024893
648 Ga0501069_0052889
649 Ga0501069_0122355
650 Ga0501070_0340902
651 Ga0501070_0774907
652 Ga0501070_1053956
653 Ga0501071_0892246
654 Ga0501072_0013422
655 Ga0501072_0318071
656 Ga0501073_0046067
657 Ga0501074_0293733
658 Ga0501074_0557501
659 Ga0501075_0164494
660 Ga0501077_0019003
661 Ga0501079_0045535
662 Ga0501080_0037116
663 Ga0501081_0012294
664 Ga0501035_0119300
665 Ga0501044_0402135
666 Ga0501044_0648767
667 Ga0501045_0005836
668 nmdc:mga03n38_431748_c1
669 nmdc:mga00v17_31302_c1
670 nmdc:mga0yw44_241747_c1
671 nmdc:mga0yw44_623863_c1
672 nmdc:mga06z11_217196_c1
673 nmdc:mga08y16_1506701_c1
674 nmdc:mga08y16_33259_c1
675 nmdc:mga0n895_54184_c1
676 nmdc:mga0n895_832991_c1
677 nmdc:mga08x19_463233_c1
678 nmdc:mga0a205_545298_c1
679 nmdc:mga0a205_82562_c1
680 Ga0495601_0111841
681 Ga0495601_0274051
682 Ga0495601_0345511
683 Ga0495612_0082597
684 Ga0495612_0443954
685 Ga0495595_0112986
686 Ga0495595_0326070
687 Ga0495619_0085058
688 Ga0495619_0156740
689 Ga0500660_243183
690 Ga0500585_208014
691 Ga0500588_0066546
692 Ga0500622_0004660
693 Ga0501082_0057019
694 Ga0501082_1072505
695 Ga0466962_0045377
696 Ga0530510_0571078
697 2808973821
698 2809008737
699 2809015757
700 2837652048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

41

125

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8924 5 120
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8826 5 122
3d7i-assembly1.cif.gz_B crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution 0.87 34 118
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8581 5 120
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8553 5 122
ID Description Score Start End Superfamily
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8606 6 120 1.20.1290.10
af_I6Y4S7_2_118_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8588 2 124 1.20.1290.10
af_I6Y4S7_2_118_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8454 2 124 1.20.1290.10
af_Q5A3J2_12_323_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8397 4 96 1.20.1290.10
2af7D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8345 5 124 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7W6TJT7-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9981 5 125 GO:0047575
GO:0051920
AF-A0A3S2ZAK5-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9974 3 124 GO:0047575
GO:0051920
AF-A0A0P7XUY6-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9944 11 124 GO:0047575
GO:0051920
AF-A0A435TRY2-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9915 5 126 GO:0047575
GO:0051920
AF-A0A437MFF2-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9905 6 119 GO:0047575
GO:0051920

Map