F417995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 174 | 345 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0102722|Ga0495648_0102722_536_1039 |
| Length | 167 |
| Sequence | MAGAGQHIVKVRAATLADIRIVGRWGAELVSLHHGFDPQRFIQAGPGTPAKYASFIESQLVLPDVIVLVAEDEMSLLGYVYAANEGNDYMSLRGPAGVIHDIFVDPARRGQGIGGALLERAIEELRGKGAGLFVLATAYRNEAAQRLFAAVGFRPTMIEMTQSPRGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 4 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 127 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 156 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0 |
| Isolates | 1.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.3 |
| Rhizosphere | 90.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10027792 | 3300001979 | Bacteria | 1878 |
| 2 | JGI24740J21852_10063507 | 3300001979 | Unclassified | 1011 |
| 3 | JGI24739J22299_10008945 | 3300001989 | Bacteria | 3736 |
| 4 | JGI24739J22299_10078742 | 3300001989 | Bacteria | 1015 |
| 5 | JGI24737J22298_10003359 | 3300001990 | Bacteria | 5662 |
| 6 | JGI24737J22298_10029811 | 3300001990 | Bacteria | 1709 |
| 7 | JGI24737J22298_10063207 | 3300001990 | Bacteria | 1111 |
| 8 | JGI24735J21928_10011141 | 3300002067 | Bacteria | 2855 |
| 9 | JGI24735J21928_10014580 | 3300002067 | Bacteria | 2460 |
| 10 | JGI24738J21930_10000961 | 3300002075 | Bacteria | 8268 |
| 11 | JGI24738J21930_10029558 | 3300002075 | Bacteria | 1120 |
| 12 | Ga0065715_10048475 | 3300005293 | Bacteria | 974 |
| 13 | Ga0070658_10000130 | 3300005327 | Bacteria | 66295 |
| 14 | Ga0070658_10009112 | 3300005327 | Bacteria | 7978 |
| 15 | Ga0070658_10026100 | 3300005327 | Bacteria | 4686 |
| 16 | Ga0070658_10078557 | 3300005327 | Bacteria | 2709 |
| 17 | Ga0070658_10084843 | 3300005327 | Bacteria | 2604 |
| 18 | Ga0070676_10298371 | 3300005328 | Bacteria | 1091 |
| 19 | Ga0070676_10363821 | 3300005328 | Bacteria | 997 |
| 20 | Ga0070683_100139123 | 3300005329 | Bacteria | 2300 |
| 21 | Ga0070670_100011521 | 3300005331 | Bacteria | 7563 |
| 22 | Ga0070670_100075022 | 3300005331 | Bacteria | 2906 |
| 23 | Ga0070670_100484893 | 3300005331 | Unclassified | 1098 |
| 24 | Ga0068869_100661743 | 3300005334 | Unclassified | 887 |
| 25 | Ga0070666_10075855 | 3300005335 | Bacteria | 2293 |
| 26 | Ga0070666_10095375 | 3300005335 | Bacteria | 2047 |
| 27 | Ga0070680_100003312 | 3300005336 | Bacteria | 12018 |
| 28 | Ga0070680_100006208 | 3300005336 | Bacteria | 9065 |
| 29 | Ga0070682_100459840 | 3300005337 | Bacteria | 977 |
| 30 | Ga0068868_100502215 | 3300005338 | Bacteria | 1062 |
| 31 | Ga0068868_100522334 | 3300005338 | Bacteria | 1042 |
| 32 | Ga0070660_100000391 | 3300005339 | Bacteria | 29107 |
| 33 | Ga0070660_100066339 | 3300005339 | Bacteria | 2809 |
| 34 | Ga0070660_100123376 | 3300005339 | Bacteria | 2068 |
| 35 | Ga0070660_100141951 | 3300005339 | Bacteria | 1927 |
| 36 | Ga0070660_100298041 | 3300005339 | Unclassified | 1321 |
| 37 | Ga0070660_100580446 | 3300005339 | Bacteria | 936 |
| 38 | Ga0070660_100606891 | 3300005339 | Bacteria | 915 |
| 39 | Ga0070661_100000206 | 3300005344 | Bacteria | 48811 |
| 40 | Ga0070661_100021844 | 3300005344 | Bacteria | 4577 |
| 41 | Ga0070661_100080328 | 3300005344 | Unclassified | 2407 |
| 42 | Ga0070661_100184859 | 3300005344 | Bacteria | 1587 |
| 43 | Ga0070661_101139836 | 3300005344 | Bacteria | 651 |
| 44 | Ga0070675_101356233 | 3300005354 | Bacteria | 656 |
| 45 | Ga0070671_100011023 | 3300005355 | Bacteria | 7255 |
| 46 | Ga0070671_100019594 | 3300005355 | Bacteria | 5509 |
| 47 | Ga0070671_100032201 | 3300005355 | Bacteria | 4336 |
| 48 | Ga0070671_100291720 | 3300005355 | Unclassified | 1388 |
| 49 | Ga0070673_100137322 | 3300005364 | Bacteria | 2059 |
| 50 | Ga0070673_100245815 | 3300005364 | Bacteria | 1557 |
| 51 | Ga0070659_100000884 | 3300005366 | Bacteria | 21912 |
| 52 | Ga0070659_100006353 | 3300005366 | Bacteria | 8535 |
| 53 | Ga0070659_100037352 | 3300005366 | Bacteria | 3786 |
| 54 | Ga0070659_100230680 | 3300005366 | Bacteria | 1530 |
| 55 | Ga0070667_100035369 | 3300005367 | Bacteria | 4184 |
| 56 | Ga0070713_100040965 | 3300005436 | Bacteria | 3770 |
| 57 | Ga0070710_10225491 | 3300005437 | Unclassified | 1194 |
| 58 | Ga0070710_10259795 | 3300005437 | Unclassified | 1119 |
| 59 | Ga0070663_100006000 | 3300005455 | Bacteria | 7269 |
| 60 | Ga0070663_100304143 | 3300005455 | Bacteria | 1277 |
| 61 | Ga0070678_100021464 | 3300005456 | Bacteria | 4258 |
| 62 | Ga0070662_100000107 | 3300005457 | Bacteria | 46051 |
| 63 | Ga0070681_10016414 | 3300005458 | Bacteria | 7392 |
| 64 | Ga0070681_10019474 | 3300005458 | Bacteria | 6793 |
| 65 | Ga0070681_10262640 | 3300005458 | Unclassified | 1638 |
| 66 | Ga0068867_100135132 | 3300005459 | Bacteria | 1921 |
| 67 | Ga0070685_10534775 | 3300005466 | Unclassified | 834 |
| 68 | Ga0070679_100334502 | 3300005530 | Bacteria | 1463 |
| 69 | Ga0070679_100700010 | 3300005530 | Bacteria | 956 |
| 70 | Ga0070684_100097050 | 3300005535 | Bacteria | 2628 |
| 71 | Ga0068853_100000172 | 3300005539 | Bacteria | 45090 |
| 72 | Ga0068853_100008708 | 3300005539 | Bacteria | 8162 |
| 73 | Ga0068853_100036316 | 3300005539 | Bacteria | 4189 |
| 74 | Ga0070672_100813831 | 3300005543 | Unclassified | 822 |
| 75 | Ga0070696_100318155 | 3300005546 | Bacteria | 1197 |
| 76 | Ga0070693_100000967 | 3300005547 | Bacteria | 12766 |
| 77 | Ga0070693_100169012 | 3300005547 | Unclassified | 1399 |
| 78 | Ga0070665_100005356 | 3300005548 | Bacteria | 13251 |
| 79 | Ga0068855_100003916 | 3300005563 | Bacteria | 18174 |
| 80 | Ga0068855_100010468 | 3300005563 | Bacteria | 11192 |
| 81 | Ga0068855_100440460 | 3300005563 | Unclassified | 1423 |
| 82 | Ga0070664_100000032 | 3300005564 | Bacteria | 88298 |
| 83 | Ga0070664_100077460 | 3300005564 | Bacteria | 2858 |
| 84 | Ga0070664_100101206 | 3300005564 | Bacteria | 2506 |
| 85 | Ga0068857_100017295 | 3300005577 | Bacteria | 6318 |
| 86 | Ga0068857_100334979 | 3300005577 | Unclassified | 1399 |
| 87 | Ga0068854_100033369 | 3300005578 | Bacteria | 3589 |
| 88 | Ga0068854_100074756 | 3300005578 | Bacteria | 2486 |
| 89 | Ga0068856_100000364 | 3300005614 | Bacteria | 49715 |
| 90 | Ga0068856_100031931 | 3300005614 | Bacteria | 5152 |
| 91 | Ga0068856_100177115 | 3300005614 | Unclassified | 2145 |
| 92 | Ga0068856_100379959 | 3300005614 | Bacteria | 1432 |
| 93 | Ga0068856_101008761 | 3300005614 | Bacteria | 851 |
| 94 | Ga0070702_100094262 | 3300005615 | Bacteria | 1822 |
| 95 | Ga0068852_100000780 | 3300005616 | Bacteria | 20902 |
| 96 | Ga0068852_100004552 | 3300005616 | Bacteria | 9816 |
| 97 | Ga0068852_100084731 | 3300005616 | Bacteria | 2822 |
| 98 | Ga0068852_100133607 | 3300005616 | Bacteria | 2288 |
| 99 | Ga0068859_100066278 | 3300005617 | Bacteria | 3646 |
| 100 | Ga0068859_100450870 | 3300005617 | Bacteria | 1383 |
| 101 | Ga0068864_100005507 | 3300005618 | Bacteria | 10375 |
| 102 | Ga0068864_100084452 | 3300005618 | Bacteria | 2790 |
| 103 | Ga0068864_100461269 | 3300005618 | Bacteria | 1216 |
| 104 | Ga0068866_10056465 | 3300005718 | Bacteria | 2019 |
| 105 | Ga0068851_10029741 | 3300005834 | Unclassified | 2706 |
| 106 | Ga0068851_10120173 | 3300005834 | Bacteria | 1411 |
| 107 | Ga0068858_101877231 | 3300005842 | Bacteria | 592 |
| 108 | Ga0068860_100341982 | 3300005843 | Unclassified | 1471 |
| 109 | Ga0070717_10028934 | 3300006028 | Bacteria | 4441 |
| 110 | Ga0070716_100045514 | 3300006173 | Bacteria | 2464 |
| 111 | Ga0070712_100010413 | 3300006175 | Bacteria | 5866 |
| 112 | Ga0068871_101104328 | 3300006358 | Bacteria | 742 |
| 113 | Ga0068865_100026291 | 3300006881 | Bacteria | 3836 |
| 114 | Ga0097620_100066278 | 3300006931 | Bacteria | 3646 |
| 115 | Ga0097620_100450868 | 3300006931 | Bacteria | 1383 |
| 116 | Ga0105245_10017352 | 3300009098 | Bacteria | 6280 |
| 117 | Ga0105248_10000238 | 3300009177 | Bacteria | 63658 |
| 118 | Ga0105248_10001772 | 3300009177 | Bacteria | 24028 |
| 119 | Ga0105237_10106391 | 3300009545 | Bacteria | 2797 |
| 120 | Ga0105238_10201680 | 3300009551 | Bacteria | 1965 |
| 121 | Ga0105246_10298670 | 3300011119 | Unclassified | 1299 |
| 122 | Ga0157373_10246642 | 3300013100 | Unclassified | 1263 |
| 123 | Ga0157373_10248890 | 3300013100 | Bacteria | 1257 |
| 124 | Ga0157371_10005248 | 3300013102 | Bacteria | 10999 |
| 125 | Ga0157371_10040705 | 3300013102 | Bacteria | 3317 |
| 126 | Ga0157370_10043581 | 3300013104 | Bacteria | 4316 |
| 127 | Ga0157370_10254855 | 3300013104 | Unclassified | 1623 |
| 128 | Ga0157369_10140761 | 3300013105 | Bacteria | 2553 |
| 129 | Ga0157369_10230596 | 3300013105 | Bacteria | 1936 |
| 130 | Ga0157369_10275254 | 3300013105 | Unclassified | 1754 |
| 131 | Ga0157374_10053682 | 3300013296 | Bacteria | 3758 |
| 132 | Ga0157375_10164964 | 3300013308 | Bacteria | 2359 |
| 133 | Ga0163163_10000371 | 3300014325 | Bacteria | 43097 |
| 134 | Ga0157379_10033120 | 3300014968 | Bacteria | 4608 |
| 135 | Ga0157376_10116741 | 3300014969 | Bacteria | 2359 |
| 136 | Ga0207656_10079141 | 3300025321 | Unclassified | 1474 |
| 137 | Ga0207682_10173728 | 3300025893 | Bacteria | 981 |
| 138 | Ga0207680_10022556 | 3300025903 | Bacteria | 3426 |
| 139 | Ga0207647_10008620 | 3300025904 | Bacteria | 7294 |
| 140 | Ga0207647_10011134 | 3300025904 | Bacteria | 6319 |
| 141 | Ga0207699_10023448 | 3300025906 | Bacteria | 3359 |
| 142 | Ga0207645_10012436 | 3300025907 | Bacteria | 5773 |
| 143 | Ga0207705_10000200 | 3300025909 | Bacteria | 60434 |
| 144 | Ga0207705_10004140 | 3300025909 | Bacteria | 10999 |
| 145 | Ga0207705_10016629 | 3300025909 | Bacteria | 5269 |
| 146 | Ga0207705_10028159 | 3300025909 | Bacteria | 4006 |
| 147 | Ga0207705_10065289 | 3300025909 | Unclassified | 2631 |
| 148 | Ga0207654_10042700 | 3300025911 | Bacteria | 2567 |
| 149 | Ga0207707_10039243 | 3300025912 | Bacteria | 4140 |
| 150 | Ga0207707_10079952 | 3300025912 | Bacteria | 2854 |
| 151 | Ga0207707_10117667 | 3300025912 | Bacteria | 2323 |
| 152 | Ga0207695_10379500 | 3300025913 | Bacteria | 1299 |
| 153 | Ga0207671_10020093 | 3300025914 | Bacteria | 5093 |
| 154 | Ga0207671_10263526 | 3300025914 | Bacteria | 1357 |
| 155 | Ga0207693_10020143 | 3300025915 | Bacteria | 5306 |
| 156 | Ga0207660_10012224 | 3300025917 | Bacteria | 5609 |
| 157 | Ga0207657_10000468 | 3300025919 | Bacteria | 42779 |
| 158 | Ga0207657_10003153 | 3300025919 | Bacteria | 17635 |
| 159 | Ga0207657_10004240 | 3300025919 | Bacteria | 15196 |
| 160 | Ga0207657_10039319 | 3300025919 | Bacteria | 4205 |
| 161 | Ga0207657_10172464 | 3300025919 | Bacteria | 1752 |
| 162 | Ga0207649_10000362 | 3300025920 | Bacteria | 34070 |
| 163 | Ga0207649_10005750 | 3300025920 | Bacteria | 6714 |
| 164 | Ga0207649_10183649 | 3300025920 | Unclassified | 1465 |
| 165 | Ga0207649_10198092 | 3300025920 | Bacteria | 1417 |
| 166 | Ga0207652_10029444 | 3300025921 | Bacteria | 4591 |
| 167 | Ga0207652_10616343 | 3300025921 | Bacteria | 972 |
| 168 | Ga0207681_10129483 | 3300025923 | Bacteria | 1864 |
| 169 | Ga0207694_10006948 | 3300025924 | Bacteria | 8594 |
| 170 | Ga0207694_10190028 | 3300025924 | Unclassified | 1668 |
| 171 | Ga0207694_10835551 | 3300025924 | Bacteria | 778 |
| 172 | Ga0207650_10057695 | 3300025925 | Bacteria | 2888 |
| 173 | Ga0207650_10072909 | 3300025925 | Bacteria | 2585 |
| 174 | Ga0207650_10457099 | 3300025925 | Bacteria | 1063 |
| 175 | Ga0207659_10962529 | 3300025926 | Unclassified | 734 |
| 176 | Ga0207700_10028162 | 3300025928 | Bacteria | 3946 |
| 177 | Ga0207644_10002090 | 3300025931 | Bacteria | 12933 |
| 178 | Ga0207644_10024790 | 3300025931 | Bacteria | 4120 |
| 179 | Ga0207644_10122048 | 3300025931 | Bacteria | 1984 |
| 180 | Ga0207644_10350589 | 3300025931 | Bacteria | 1198 |
| 181 | Ga0207690_10000062 | 3300025932 | Bacteria | 96511 |
| 182 | Ga0207690_10026604 | 3300025932 | Bacteria | 3644 |
| 183 | Ga0207690_10186400 | 3300025932 | Bacteria | 1566 |
| 184 | Ga0207690_10214537 | 3300025932 | Bacteria | 1469 |
| 185 | Ga0207706_10000211 | 3300025933 | Bacteria | 63984 |
| 186 | Ga0207706_10004449 | 3300025933 | Bacteria | 13166 |
| 187 | Ga0207706_10923991 | 3300025933 | Bacteria | 736 |
| 188 | Ga0207669_10029516 | 3300025937 | Bacteria | 3034 |
| 189 | Ga0207704_10019876 | 3300025938 | Bacteria | 3539 |
| 190 | Ga0207665_10046965 | 3300025939 | Bacteria | 2894 |
| 191 | Ga0207691_10015370 | 3300025940 | Bacteria | 7283 |
| 192 | Ga0207711_10001518 | 3300025941 | Bacteria | 21567 |
| 193 | Ga0207711_10001908 | 3300025941 | Bacteria | 18939 |
| 194 | Ga0207689_10624588 | 3300025942 | Bacteria | 907 |
| 195 | Ga0207689_10629227 | 3300025942 | Unclassified | 904 |
| 196 | Ga0207661_10115424 | 3300025944 | Bacteria | 2278 |
| 197 | Ga0207661_10598356 | 3300025944 | Bacteria | 1012 |
| 198 | Ga0207679_10000506 | 3300025945 | Bacteria | 26758 |
| 199 | Ga0207679_10048390 | 3300025945 | Bacteria | 3095 |
| 200 | Ga0207679_10275622 | 3300025945 | Bacteria | 1440 |
| 201 | Ga0207679_10624806 | 3300025945 | Unclassified | 973 |
| 202 | Ga0207667_10006933 | 3300025949 | Bacteria | 13694 |
| 203 | Ga0207667_10033992 | 3300025949 | Bacteria | 5477 |
| 204 | Ga0207667_10182339 | 3300025949 | Bacteria | 2156 |
| 205 | Ga0207667_10850036 | 3300025949 | Unclassified | 907 |
| 206 | Ga0207651_10186576 | 3300025960 | Bacteria | 1650 |
| 207 | Ga0207640_10072020 | 3300025981 | Bacteria | 2330 |
| 208 | Ga0207640_10519984 | 3300025981 | Bacteria | 994 |
| 209 | Ga0207658_10041302 | 3300025986 | Bacteria | 3339 |
| 210 | Ga0207658_10165988 | 3300025986 | Bacteria | 1814 |
| 211 | Ga0207677_11642708 | 3300026023 | Unclassified | 595 |
| 212 | Ga0207639_10000532 | 3300026041 | Bacteria | 26198 |
| 213 | Ga0207639_10000990 | 3300026041 | Bacteria | 19349 |
| 214 | Ga0207639_10135184 | 3300026041 | Bacteria | 2046 |
| 215 | Ga0207639_10186040 | 3300026041 | Bacteria | 1771 |
| 216 | Ga0207678_10004245 | 3300026067 | Bacteria | 12855 |
| 217 | Ga0207678_10021992 | 3300026067 | Bacteria | 5590 |
| 218 | Ga0207678_10236364 | 3300026067 | Unclassified | 1565 |
| 219 | Ga0207702_10001280 | 3300026078 | Bacteria | 25252 |
| 220 | Ga0207702_10372990 | 3300026078 | Bacteria | 1370 |
| 221 | Ga0207702_10528115 | 3300026078 | Unclassified | 1152 |
| 222 | Ga0207648_10000889 | 3300026089 | Bacteria | 33700 |
| 223 | Ga0207676_10061178 | 3300026095 | Bacteria | 2981 |
| 224 | Ga0207676_10183631 | 3300026095 | Bacteria | 1834 |
| 225 | Ga0207676_10304439 | 3300026095 | Bacteria | 1456 |
| 226 | Ga0207674_10010822 | 3300026116 | Bacteria | 10285 |
| 227 | Ga0207674_10121138 | 3300026116 | Bacteria | 2584 |
| 228 | Ga0207674_10550282 | 3300026116 | Bacteria | 1115 |
| 229 | Ga0207675_100932222 | 3300026118 | Bacteria | 885 |
| 230 | Ga0207683_10034550 | 3300026121 | Bacteria | 4394 |
| 231 | Ga0207698_10000775 | 3300026142 | Bacteria | 18575 |
| 232 | Ga0207698_10010944 | 3300026142 | Bacteria | 5860 |
| 233 | Ga0207698_10110890 | 3300026142 | Bacteria | 2299 |
| 234 | Ga0268266_10039465 | 3300028379 | Bacteria | 4022 |
| 235 | Ga0268265_10070203 | 3300028380 | Bacteria | 2723 |
| 236 | Ga0268264_10339277 | 3300028381 | Unclassified | 1427 |
| 237 | Ga0307409_100523977 | 3300031995 | Unclassified | 1158 |
| 238 | Ga0373959_0118990 | 3300034820 | Bacteria | 644 |
| 239 | Ga0373952_0099335 | 3300035092 | Unclassified | 766 |
| 240 | Ga0373954_0115725 | 3300035118 | Bacteria | 1299 |
| 241 | Ga0373956_0290876 | 3300035119 | Bacteria | 778 |
| 242 | Ga0373955_0017213 | 3300035172 | Bacteria | 3572 |
| 243 | Ga0373961_0061271 | 3300035241 | Unclassified | 1142 |
| 244 | Ga0373935_0045407 | 3300035692 | Bacteria | 2773 |
| 245 | Ga0373933_0181243 | 3300035724 | Bacteria | 1343 |
| 246 | Ga0373937_0135269 | 3300036401 | Bacteria | 2304 |
| 247 | Ga0395899_0012482 | 3300037312 | Bacteria | 6508 |
| 248 | Ga0395899_0049824 | 3300037312 | Unclassified | 3112 |
| 249 | Ga0395899_0096601 | 3300037312 | Bacteria | 2136 |
| 250 | Ga0395900_0008516 | 3300037418 | Bacteria | 10545 |
| 251 | Ga0395900_0039261 | 3300037418 | Unclassified | 4877 |
| 252 | Ga0395900_0056637 | 3300037418 | Bacteria | 4034 |
| 253 | Ga0395900_0079083 | 3300037418 | Bacteria | 3378 |
| 254 | Ga0395900_0193526 | 3300037418 | Bacteria | 2061 |
| 255 | Ga0395900_0398293 | 3300037418 | Bacteria | 1341 |
| 256 | Ga0395900_0791709 | 3300037418 | Bacteria | 876 |
| 257 | Ga0395900_1205330 | 3300037418 | Unclassified | 672 |
| 258 | Ga0395900_1261512 | 3300037418 | Bacteria | 653 |
| 259 | Ga0395898_0061307 | 3300037466 | Unclassified | 3654 |
| 260 | Ga0395898_0093511 | 3300037466 | Bacteria | 2889 |
| 261 | Ga0395898_0208314 | 3300037466 | Bacteria | 1865 |
| 262 | Ga0395898_0492095 | 3300037466 | Unclassified | 1167 |
| 263 | Ga0395905_0004708 | 3300037471 | Bacteria | 14097 |
| 264 | Ga0395905_0199193 | 3300037471 | Bacteria | 1878 |
| 265 | Ga0395905_0215012 | 3300037471 | Unclassified | 1800 |
| 266 | Ga0395905_0240008 | 3300037471 | Bacteria | 1693 |
| 267 | Ga0395905_0290663 | 3300037471 | Unclassified | 1521 |
| 268 | Ga0395905_0369210 | 3300037471 | Bacteria | 1328 |
| 269 | Ga0395905_0398246 | 3300037471 | Bacteria | 1271 |
| 270 | Ga0395905_0544752 | 3300037471 | Bacteria | 1061 |
| 271 | Ga0395905_0589770 | 3300037471 | Unclassified | 1013 |
| 272 | Ga0395905_0781607 | 3300037471 | Unclassified | 857 |
| 273 | Ga0395901_0030623 | 3300038443 | Bacteria | 5544 |
| 274 | Ga0395901_0131249 | 3300038443 | Unclassified | 2632 |
| 275 | Ga0395901_0161600 | 3300038443 | Bacteria | 2352 |
| 276 | Ga0395901_0252880 | 3300038443 | Bacteria | 1835 |
| 277 | Ga0395901_0273228 | 3300038443 | Bacteria | 1757 |
| 278 | Ga0395901_0361894 | 3300038443 | Unclassified | 1496 |
| 279 | Ga0466965_0651707 | 3300044683 | Unclassified | 601 |
| 280 | Ga0466961_0016718 | 3300044693 | Bacteria | 4718 |
| 281 | Ga0466963_0005175 | 3300044694 | Bacteria | 7615 |
| 282 | Ga0466963_0011096 | 3300044694 | Bacteria | 5479 |
| 283 | Ga0466963_0013204 | 3300044694 | Bacteria | 5069 |
| 284 | Ga0466963_0017121 | 3300044694 | Bacteria | 4514 |
| 285 | Ga0466963_0057595 | 3300044694 | Unclassified | 2588 |
| 286 | Ga0466963_0697584 | 3300044694 | Bacteria | 716 |
| 287 | Ga0466964_0027307 | 3300044706 | Unclassified | 2241 |
| 288 | Ga0466964_0192046 | 3300044706 | Bacteria | 975 |
| 289 | Ga0466971_0026775 | 3300044719 | Bacteria | 2579 |
| 290 | Ga0466971_0238399 | 3300044719 | Bacteria | 865 |
| 291 | Ga0466970_0061713 | 3300044765 | Bacteria | 2009 |
| 292 | Ga0466957_0001433 | 3300044842 | Bacteria | 12457 |
| 293 | Ga0466957_0003522 | 3300044842 | Bacteria | 8615 |
| 294 | Ga0466957_0065666 | 3300044842 | Unclassified | 2235 |
| 295 | Ga0466959_0061640 | 3300045049 | Bacteria | 2727 |
| 296 | Ga0466959_0403896 | 3300045049 | Unclassified | 928 |
| 297 | Ga0466958_0019234 | 3300045836 | Bacteria | 3974 |
| 298 | Ga0466958_0207650 | 3300045836 | Bacteria | 1247 |
| 299 | Ga0466958_0228204 | 3300045836 | Unclassified | 1189 |
| 300 | Ga0466967_0003642 | 3300045976 | Bacteria | 10129 |
| 301 | Ga0466967_0013752 | 3300045976 | Bacteria | 6270 |
| 302 | Ga0466967_0048533 | 3300045976 | Bacteria | 3707 |
| 303 | Ga0466967_0059622 | 3300045976 | Bacteria | 3379 |
| 304 | Ga0466967_0123824 | 3300045976 | Unclassified | 2392 |
| 305 | Ga0466967_0256471 | 3300045976 | Bacteria | 1672 |
| 306 | Ga0466967_0512548 | 3300045976 | Bacteria | 1178 |
| 307 | Ga0466967_0683575 | 3300045976 | Bacteria | 1016 |
| 308 | Ga0466967_0975734 | 3300045976 | Bacteria | 843 |
| 309 | Ga0495648_0102722 | 3300046524 | Bacteria | 1574 |
| 310 | Ga0495621_0054560 | 3300046539 | Bacteria | 1437 |
| 311 | Ga0495669_0020437 | 3300046684 | Bacteria | 2866 |
| 312 | Ga0495602_0103778 | 3300048088 | Bacteria | 2326 |
| 313 | Ga0496100_0111428 | 3300048903 | Bacteria | 1902 |
| 314 | Ga0496101_0311027 | 3300048904 | Bacteria | 1235 |
| 315 | Ga0496102_0180636 | 3300048905 | Bacteria | 1988 |
| 316 | Ga0496103_0169322 | 3300048906 | Bacteria | 1402 |
| 317 | Ga0496104_0026150 | 3300048907 | Bacteria | 5385 |
| 318 | Ga0496105_0132343 | 3300048908 | Unclassified | 2056 |
| 319 | Ga0496106_0125869 | 3300048909 | Bacteria | 2006 |
| 320 | Ga0496106_0745765 | 3300048909 | Bacteria | 779 |
| 321 | Ga0496107_0102720 | 3300048910 | Bacteria | 2096 |
| 322 | Ga0496108_0339468 | 3300048911 | Bacteria | 1310 |
| 323 | Ga0496109_0052852 | 3300048912 | Bacteria | 3704 |
| 324 | Ga0496109_0265042 | 3300048912 | Bacteria | 1618 |
| 325 | Ga0496110_0008265 | 3300048913 | Bacteria | 8368 |
| 326 | Ga0496110_0031776 | 3300048913 | Bacteria | 4557 |
| 327 | Ga0496111_0035600 | 3300048914 | Bacteria | 3559 |
| 328 | Ga0496111_0051086 | 3300048914 | Bacteria | 2984 |
| 329 | Ga0496112_0045434 | 3300048915 | Bacteria | 4305 |
| 330 | Ga0496112_0090688 | 3300048915 | Bacteria | 3025 |
| 331 | Ga0496112_1187651 | 3300048915 | Unclassified | 680 |
| 332 | Ga0496113_0015623 | 3300048916 | Bacteria | 5226 |
| 333 | Ga0496113_0541950 | 3300048916 | Unclassified | 933 |
| 334 | Ga0496116_0308784 | 3300048919 | Unclassified | 748 |
| 335 | Ga0496122_0099045 | 3300048925 | Bacteria | 1956 |
| 336 | Ga0496123_0004066 | 3300048926 | Bacteria | 15753 |
| 337 | Ga0496123_0023495 | 3300048926 | Bacteria | 4717 |
| 338 | Ga0496124_0003359 | 3300048927 | Bacteria | 19669 |
| 339 | Ga0496124_0008319 | 3300048927 | Bacteria | 10859 |
| 340 | Ga0496125_0284459 | 3300048928 | Bacteria | 1022 |
| 341 | Ga0496126_0937682 | 3300048929 | Bacteria | 654 |
| 342 | Ga0501067_0302971 | 3300049583 | Unclassified | 890 |
| 343 | Ga0466962_0029172 | 3300061719 | Bacteria | 2641 |
| 344 | Ga0466962_0037133 | 3300061719 | Bacteria | 2332 |
| 345 | Ga0466962_0249486 | 3300061719 | Bacteria | 872 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10026100 | Ga0070658_100261004 | 155 |
| 2 | 3300005331 | Ga0070670_100484893 | Ga0070670_1004848932 | 155 |
| 3 | 3300005339 | Ga0070660_100606891 | Ga0070660_1006068912 | 155 |
| 4 | 3300005344 | Ga0070661_100184859 | Ga0070661_1001848592 | 155 |
| 5 | 3300025909 | Ga0207705_10028159 | Ga0207705_100281595 | 155 |
| 6 | 3300025925 | Ga0207650_10457099 | Ga0207650_104570992 | 155 |
| 7 | 3300044683 | Ga0466965_0651707 | Ga0466965_0651707_26_511 | 158 |
| 8 | 3300044693 | Ga0466961_0016718 | Ga0466961_0016718_693_1178 | 158 |
| 9 | 3300044719 | Ga0466971_0238399 | Ga0466971_0238399_26_511 | 158 |
| 10 | 3300045049 | Ga0466959_0403896 | Ga0466959_0403896_253_738 | 158 |
| 11 | 3300001979 | JGI24740J21852_10027792 | JGI24740J21852_100277924 | 160 |
| 12 | 3300001979 | JGI24740J21852_10063507 | JGI24740J21852_100635072 | 160 |
| 13 | 3300001989 | JGI24739J22299_10008945 | JGI24739J22299_100089452 | 160 |
| 14 | 3300001989 | JGI24739J22299_10078742 | JGI24739J22299_100787422 | 160 |
| 15 | 3300001990 | JGI24737J22298_10003359 | JGI24737J22298_100033592 | 160 |
| 16 | 3300001990 | JGI24737J22298_10029811 | JGI24737J22298_100298112 | 160 |
| 17 | 3300001990 | JGI24737J22298_10063207 | JGI24737J22298_100632072 | 160 |
| 18 | 3300002067 | JGI24735J21928_10011141 | JGI24735J21928_100111412 | 160 |
| 19 | 3300002067 | JGI24735J21928_10014580 | JGI24735J21928_100145804 | 160 |
| 20 | 3300002075 | JGI24738J21930_10000961 | JGI24738J21930_100009619 | 160 |
| 21 | 3300002075 | JGI24738J21930_10029558 | JGI24738J21930_100295581 | 160 |
| 22 | 3300005293 | Ga0065715_10048475 | Ga0065715_100484752 | 160 |
| 23 | 3300005327 | Ga0070658_10000130 | Ga0070658_1000013046 | 160 |
| 24 | 3300005327 | Ga0070658_10009112 | Ga0070658_100091123 | 160 |
| 25 | 3300005327 | Ga0070658_10078557 | Ga0070658_100785574 | 160 |
| 26 | 3300005327 | Ga0070658_10084843 | Ga0070658_100848433 | 160 |
| 27 | 3300005328 | Ga0070676_10298371 | Ga0070676_102983712 | 160 |
| 28 | 3300005328 | Ga0070676_10363821 | Ga0070676_103638212 | 160 |
| 29 | 3300005329 | Ga0070683_100139123 | Ga0070683_1001391232 | 160 |
| 30 | 3300005331 | Ga0070670_100011521 | Ga0070670_1000115213 | 160 |
| 31 | 3300005331 | Ga0070670_100075022 | Ga0070670_1000750223 | 160 |
| 32 | 3300005334 | Ga0068869_100661743 | Ga0068869_1006617431 | 160 |
| 33 | 3300005335 | Ga0070666_10075855 | Ga0070666_100758552 | 160 |
| 34 | 3300005335 | Ga0070666_10095375 | Ga0070666_100953753 | 160 |
| 35 | 3300005336 | Ga0070680_100003312 | Ga0070680_1000033127 | 160 |
| 36 | 3300005336 | Ga0070680_100006208 | Ga0070680_10000620811 | 160 |
| 37 | 3300005337 | Ga0070682_100459840 | Ga0070682_1004598402 | 160 |
| 38 | 3300005338 | Ga0068868_100502215 | Ga0068868_1005022152 | 160 |
| 39 | 3300005338 | Ga0068868_100522334 | Ga0068868_1005223342 | 160 |
| 40 | 3300005339 | Ga0070660_100000391 | Ga0070660_10000039124 | 160 |
| 41 | 3300005339 | Ga0070660_100066339 | Ga0070660_1000663394 | 160 |
| 42 | 3300005339 | Ga0070660_100123376 | Ga0070660_1001233761 | 160 |
| 43 | 3300005339 | Ga0070660_100141951 | Ga0070660_1001419512 | 160 |
| 44 | 3300005339 | Ga0070660_100298041 | Ga0070660_1002980412 | 160 |
| 45 | 3300005339 | Ga0070660_100580446 | Ga0070660_1005804462 | 160 |
| 46 | 3300005344 | Ga0070661_100000206 | Ga0070661_10000020614 | 160 |
| 47 | 3300005344 | Ga0070661_100021844 | Ga0070661_1000218444 | 160 |
| 48 | 3300005344 | Ga0070661_100080328 | Ga0070661_1000803283 | 160 |
| 49 | 3300005344 | Ga0070661_101139836 | Ga0070661_1011398361 | 160 |
| 50 | 3300005354 | Ga0070675_101356233 | Ga0070675_1013562331 | 160 |
| 51 | 3300005355 | Ga0070671_100011023 | Ga0070671_1000110237 | 160 |
| 52 | 3300005355 | Ga0070671_100019594 | Ga0070671_1000195947 | 160 |
| 53 | 3300005355 | Ga0070671_100032201 | Ga0070671_1000322014 | 160 |
| 54 | 3300005355 | Ga0070671_100291720 | Ga0070671_1002917202 | 160 |
| 55 | 3300005364 | Ga0070673_100137322 | Ga0070673_1001373223 | 160 |
| 56 | 3300005364 | Ga0070673_100245815 | Ga0070673_1002458152 | 160 |
| 57 | 3300005366 | Ga0070659_100000884 | Ga0070659_10000088424 | 160 |
| 58 | 3300005366 | Ga0070659_100006353 | Ga0070659_1000063537 | 160 |
| 59 | 3300005366 | Ga0070659_100037352 | Ga0070659_1000373524 | 160 |
| 60 | 3300005366 | Ga0070659_100230680 | Ga0070659_1002306802 | 160 |
| 61 | 3300005367 | Ga0070667_100035369 | Ga0070667_1000353693 | 160 |
| 62 | 3300005436 | Ga0070713_100040965 | Ga0070713_1000409652 | 160 |
| 63 | 3300005437 | Ga0070710_10225491 | Ga0070710_102254912 | 160 |
| 64 | 3300005437 | Ga0070710_10259795 | Ga0070710_102597952 | 160 |
| 65 | 3300005455 | Ga0070663_100006000 | Ga0070663_1000060002 | 160 |
| 66 | 3300005455 | Ga0070663_100304143 | Ga0070663_1003041432 | 160 |
| 67 | 3300005456 | Ga0070678_100021464 | Ga0070678_1000214644 | 160 |
| 68 | 3300005457 | Ga0070662_100000107 | Ga0070662_10000010750 | 160 |
| 69 | 3300005458 | Ga0070681_10016414 | Ga0070681_100164148 | 160 |
| 70 | 3300005458 | Ga0070681_10019474 | Ga0070681_100194747 | 160 |
| 71 | 3300005458 | Ga0070681_10262640 | Ga0070681_102626403 | 160 |
| 72 | 3300005459 | Ga0068867_100135132 | Ga0068867_1001351322 | 160 |
| 73 | 3300005466 | Ga0070685_10534775 | Ga0070685_105347751 | 160 |
| 74 | 3300005530 | Ga0070679_100334502 | Ga0070679_1003345022 | 160 |
| 75 | 3300005530 | Ga0070679_100700010 | Ga0070679_1007000101 | 160 |
| 76 | 3300005535 | Ga0070684_100097050 | Ga0070684_1000970503 | 160 |
| 77 | 3300005539 | Ga0068853_100000172 | Ga0068853_1000001728 | 160 |
| 78 | 3300005539 | Ga0068853_100008708 | Ga0068853_10000870810 | 160 |
| 79 | 3300005539 | Ga0068853_100036316 | Ga0068853_1000363165 | 160 |
| 80 | 3300005543 | Ga0070672_100813831 | Ga0070672_1008138311 | 160 |
| 81 | 3300005546 | Ga0070696_100318155 | Ga0070696_1003181552 | 160 |
| 82 | 3300005547 | Ga0070693_100000967 | Ga0070693_10000096717 | 160 |
| 83 | 3300005547 | Ga0070693_100169012 | Ga0070693_1001690122 | 160 |
| 84 | 3300005548 | Ga0070665_100005356 | Ga0070665_1000053566 | 160 |
| 85 | 3300005563 | Ga0068855_100003916 | Ga0068855_1000039164 | 160 |
| 86 | 3300005563 | Ga0068855_100010468 | Ga0068855_1000104684 | 160 |
| 87 | 3300005563 | Ga0068855_100440460 | Ga0068855_1004404602 | 160 |
| 88 | 3300005564 | Ga0070664_100000032 | Ga0070664_10000003224 | 160 |
| 89 | 3300005564 | Ga0070664_100077460 | Ga0070664_1000774602 | 160 |
| 90 | 3300005564 | Ga0070664_100101206 | Ga0070664_1001012062 | 160 |
| 91 | 3300005577 | Ga0068857_100017295 | Ga0068857_1000172952 | 160 |
| 92 | 3300005577 | Ga0068857_100334979 | Ga0068857_1003349792 | 160 |
| 93 | 3300005578 | Ga0068854_100033369 | Ga0068854_1000333695 | 160 |
| 94 | 3300005578 | Ga0068854_100074756 | Ga0068854_1000747562 | 160 |
| 95 | 3300005614 | Ga0068856_100000364 | Ga0068856_10000036413 | 160 |
| 96 | 3300005614 | Ga0068856_100031931 | Ga0068856_1000319315 | 160 |
| 97 | 3300005614 | Ga0068856_100177115 | Ga0068856_1001771152 | 160 |
| 98 | 3300005614 | Ga0068856_100379959 | Ga0068856_1003799592 | 160 |
| 99 | 3300005614 | Ga0068856_101008761 | Ga0068856_1010087612 | 160 |
| 100 | 3300005615 | Ga0070702_100094262 | Ga0070702_1000942622 | 160 |
| 101 | 3300005616 | Ga0068852_100000780 | Ga0068852_10000078013 | 160 |
| 102 | 3300005616 | Ga0068852_100004552 | Ga0068852_1000045524 | 160 |
| 103 | 3300005616 | Ga0068852_100084731 | Ga0068852_1000847312 | 160 |
| 104 | 3300005616 | Ga0068852_100133607 | Ga0068852_1001336074 | 160 |
| 105 | 3300005617 | Ga0068859_100066278 | Ga0068859_1000662784 | 160 |
| 106 | 3300005617 | Ga0068859_100450870 | Ga0068859_1004508703 | 160 |
| 107 | 3300005618 | Ga0068864_100005507 | Ga0068864_1000055073 | 160 |
| 108 | 3300005618 | Ga0068864_100084452 | Ga0068864_1000844524 | 160 |
| 109 | 3300005618 | Ga0068864_100461269 | Ga0068864_1004612692 | 160 |
| 110 | 3300005718 | Ga0068866_10056465 | Ga0068866_100564652 | 160 |
| 111 | 3300005834 | Ga0068851_10029741 | Ga0068851_100297413 | 160 |
| 112 | 3300005834 | Ga0068851_10120173 | Ga0068851_101201733 | 160 |
| 113 | 3300005842 | Ga0068858_101877231 | Ga0068858_1018772311 | 160 |
| 114 | 3300005843 | Ga0068860_100341982 | Ga0068860_1003419822 | 160 |
| 115 | 3300006028 | Ga0070717_10028934 | Ga0070717_100289347 | 160 |
| 116 | 3300006173 | Ga0070716_100045514 | Ga0070716_1000455142 | 160 |
| 117 | 3300006175 | Ga0070712_100010413 | Ga0070712_1000104134 | 160 |
| 118 | 3300006358 | Ga0068871_101104328 | Ga0068871_1011043281 | 160 |
| 119 | 3300006881 | Ga0068865_100026291 | Ga0068865_1000262913 | 160 |
| 120 | 3300006931 | Ga0097620_100066278 | Ga0097620_1000662784 | 160 |
| 121 | 3300006931 | Ga0097620_100450868 | Ga0097620_1004508682 | 160 |
| 122 | 3300009098 | Ga0105245_10017352 | Ga0105245_100173525 | 160 |
| 123 | 3300009177 | Ga0105248_10000238 | Ga0105248_1000023813 | 160 |
| 124 | 3300009177 | Ga0105248_10001772 | Ga0105248_100017727 | 160 |
| 125 | 3300009545 | Ga0105237_10106391 | Ga0105237_101063912 | 160 |
| 126 | 3300009551 | Ga0105238_10201680 | Ga0105238_102016802 | 160 |
| 127 | 3300011119 | Ga0105246_10298670 | Ga0105246_102986702 | 160 |
| 128 | 3300013100 | Ga0157373_10246642 | Ga0157373_102466422 | 160 |
| 129 | 3300013100 | Ga0157373_10248890 | Ga0157373_102488902 | 160 |
| 130 | 3300013102 | Ga0157371_10005248 | Ga0157371_100052484 | 160 |
| 131 | 3300013102 | Ga0157371_10040705 | Ga0157371_100407052 | 160 |
| 132 | 3300013104 | Ga0157370_10043581 | Ga0157370_1004358112 | 160 |
| 133 | 3300013104 | Ga0157370_10254855 | Ga0157370_102548552 | 160 |
| 134 | 3300013105 | Ga0157369_10140761 | Ga0157369_101407613 | 160 |
| 135 | 3300013105 | Ga0157369_10230596 | Ga0157369_102305961 | 160 |
| 136 | 3300013105 | Ga0157369_10275254 | Ga0157369_102752542 | 160 |
| 137 | 3300013296 | Ga0157374_10053682 | Ga0157374_100536824 | 160 |
| 138 | 3300013308 | Ga0157375_10164964 | Ga0157375_101649644 | 160 |
| 139 | 3300014325 | Ga0163163_10000371 | Ga0163163_1000037147 | 160 |
| 140 | 3300014968 | Ga0157379_10033120 | Ga0157379_100331204 | 160 |
| 141 | 3300014969 | Ga0157376_10116741 | Ga0157376_101167414 | 160 |
| 142 | 3300025321 | Ga0207656_10079141 | Ga0207656_100791413 | 160 |
| 143 | 3300025893 | Ga0207682_10173728 | Ga0207682_101737282 | 160 |
| 144 | 3300025903 | Ga0207680_10022556 | Ga0207680_100225564 | 160 |
| 145 | 3300025904 | Ga0207647_10008620 | Ga0207647_100086202 | 160 |
| 146 | 3300025904 | Ga0207647_10011134 | Ga0207647_100111345 | 160 |
| 147 | 3300025906 | Ga0207699_10023448 | Ga0207699_100234483 | 160 |
| 148 | 3300025907 | Ga0207645_10012436 | Ga0207645_100124362 | 160 |
| 149 | 3300025909 | Ga0207705_10000200 | Ga0207705_1000020049 | 160 |
| 150 | 3300025909 | Ga0207705_10004140 | Ga0207705_100041408 | 160 |
| 151 | 3300025909 | Ga0207705_10016629 | Ga0207705_100166296 | 160 |
| 152 | 3300025909 | Ga0207705_10065289 | Ga0207705_100652894 | 160 |
| 153 | 3300025911 | Ga0207654_10042700 | Ga0207654_100427002 | 160 |
| 154 | 3300025912 | Ga0207707_10039243 | Ga0207707_100392433 | 160 |
| 155 | 3300025912 | Ga0207707_10079952 | Ga0207707_100799522 | 160 |
| 156 | 3300025912 | Ga0207707_10117667 | Ga0207707_101176673 | 160 |
| 157 | 3300025913 | Ga0207695_10379500 | Ga0207695_103795001 | 160 |
| 158 | 3300025914 | Ga0207671_10020093 | Ga0207671_100200935 | 160 |
| 159 | 3300025914 | Ga0207671_10263526 | Ga0207671_102635262 | 160 |
| 160 | 3300025915 | Ga0207693_10020143 | Ga0207693_100201437 | 160 |
| 161 | 3300025917 | Ga0207660_10012224 | Ga0207660_100122243 | 160 |
| 162 | 3300025919 | Ga0207657_10000468 | Ga0207657_1000046831 | 160 |
| 163 | 3300025919 | Ga0207657_10003153 | Ga0207657_100031534 | 160 |
| 164 | 3300025919 | Ga0207657_10004240 | Ga0207657_1000424013 | 160 |
| 165 | 3300025919 | Ga0207657_10039319 | Ga0207657_100393197 | 160 |
| 166 | 3300025919 | Ga0207657_10172464 | Ga0207657_101724643 | 160 |
| 167 | 3300025920 | Ga0207649_10000362 | Ga0207649_100003625 | 160 |
| 168 | 3300025920 | Ga0207649_10005750 | Ga0207649_100057506 | 160 |
| 169 | 3300025920 | Ga0207649_10183649 | Ga0207649_101836492 | 160 |
| 170 | 3300025920 | Ga0207649_10198092 | Ga0207649_101980922 | 160 |
| 171 | 3300025921 | Ga0207652_10029444 | Ga0207652_100294445 | 160 |
| 172 | 3300025921 | Ga0207652_10616343 | Ga0207652_106163432 | 160 |
| 173 | 3300025923 | Ga0207681_10129483 | Ga0207681_101294833 | 160 |
| 174 | 3300025924 | Ga0207694_10006948 | Ga0207694_100069489 | 160 |
| 175 | 3300025924 | Ga0207694_10190028 | Ga0207694_101900282 | 160 |
| 176 | 3300025924 | Ga0207694_10835551 | Ga0207694_108355511 | 160 |
| 177 | 3300025925 | Ga0207650_10057695 | Ga0207650_100576955 | 160 |
| 178 | 3300025925 | Ga0207650_10072909 | Ga0207650_100729092 | 160 |
| 179 | 3300025926 | Ga0207659_10962529 | Ga0207659_109625291 | 160 |
| 180 | 3300025928 | Ga0207700_10028162 | Ga0207700_100281625 | 160 |
| 181 | 3300025931 | Ga0207644_10002090 | Ga0207644_100020902 | 160 |
| 182 | 3300025931 | Ga0207644_10024790 | Ga0207644_100247903 | 160 |
| 183 | 3300025931 | Ga0207644_10122048 | Ga0207644_101220481 | 160 |
| 184 | 3300025931 | Ga0207644_10350589 | Ga0207644_103505891 | 160 |
| 185 | 3300025932 | Ga0207690_10000062 | Ga0207690_1000006245 | 160 |
| 186 | 3300025932 | Ga0207690_10026604 | Ga0207690_100266042 | 160 |
| 187 | 3300025932 | Ga0207690_10186400 | Ga0207690_101864002 | 160 |
| 188 | 3300025932 | Ga0207690_10214537 | Ga0207690_102145372 | 160 |
| 189 | 3300025933 | Ga0207706_10000211 | Ga0207706_1000021113 | 160 |
| 190 | 3300025933 | Ga0207706_10004449 | Ga0207706_1000444911 | 160 |
| 191 | 3300025933 | Ga0207706_10923991 | Ga0207706_109239911 | 160 |
| 192 | 3300025937 | Ga0207669_10029516 | Ga0207669_100295162 | 160 |
| 193 | 3300025938 | Ga0207704_10019876 | Ga0207704_100198765 | 160 |
| 194 | 3300025939 | Ga0207665_10046965 | Ga0207665_100469654 | 160 |
| 195 | 3300025940 | Ga0207691_10015370 | Ga0207691_100153708 | 160 |
| 196 | 3300025941 | Ga0207711_10001518 | Ga0207711_1000151818 | 160 |
| 197 | 3300025941 | Ga0207711_10001908 | Ga0207711_100019083 | 160 |
| 198 | 3300025942 | Ga0207689_10624588 | Ga0207689_106245881 | 160 |
| 199 | 3300025942 | Ga0207689_10629227 | Ga0207689_106292272 | 160 |
| 200 | 3300025944 | Ga0207661_10115424 | Ga0207661_101154242 | 160 |
| 201 | 3300025944 | Ga0207661_10598356 | Ga0207661_105983562 | 160 |
| 202 | 3300025945 | Ga0207679_10000506 | Ga0207679_100005068 | 160 |
| 203 | 3300025945 | Ga0207679_10048390 | Ga0207679_100483902 | 160 |
| 204 | 3300025945 | Ga0207679_10275622 | Ga0207679_102756222 | 160 |
| 205 | 3300025945 | Ga0207679_10624806 | Ga0207679_106248061 | 160 |
| 206 | 3300025949 | Ga0207667_10006933 | Ga0207667_100069334 | 160 |
| 207 | 3300025949 | Ga0207667_10033992 | Ga0207667_100339924 | 160 |
| 208 | 3300025949 | Ga0207667_10182339 | Ga0207667_101823392 | 160 |
| 209 | 3300025949 | Ga0207667_10850036 | Ga0207667_108500362 | 160 |
| 210 | 3300025960 | Ga0207651_10186576 | Ga0207651_101865762 | 160 |
| 211 | 3300025981 | Ga0207640_10072020 | Ga0207640_100720204 | 160 |
| 212 | 3300025981 | Ga0207640_10519984 | Ga0207640_105199842 | 160 |
| 213 | 3300025986 | Ga0207658_10041302 | Ga0207658_100413024 | 160 |
| 214 | 3300025986 | Ga0207658_10165988 | Ga0207658_101659883 | 160 |
| 215 | 3300026023 | Ga0207677_11642708 | Ga0207677_116427081 | 160 |
| 216 | 3300026041 | Ga0207639_10000532 | Ga0207639_100005327 | 160 |
| 217 | 3300026041 | Ga0207639_10000990 | Ga0207639_1000099016 | 160 |
| 218 | 3300026041 | Ga0207639_10135184 | Ga0207639_101351841 | 160 |
| 219 | 3300026041 | Ga0207639_10186040 | Ga0207639_101860401 | 160 |
| 220 | 3300026067 | Ga0207678_10004245 | Ga0207678_100042455 | 160 |
| 221 | 3300026067 | Ga0207678_10021992 | Ga0207678_100219928 | 160 |
| 222 | 3300026067 | Ga0207678_10236364 | Ga0207678_102363642 | 160 |
| 223 | 3300026078 | Ga0207702_10001280 | Ga0207702_1000128025 | 160 |
| 224 | 3300026078 | Ga0207702_10372990 | Ga0207702_103729902 | 160 |
| 225 | 3300026078 | Ga0207702_10528115 | Ga0207702_105281152 | 160 |
| 226 | 3300026089 | Ga0207648_10000889 | Ga0207648_1000088918 | 160 |
| 227 | 3300026095 | Ga0207676_10061178 | Ga0207676_100611782 | 160 |
| 228 | 3300026095 | Ga0207676_10183631 | Ga0207676_101836312 | 160 |
| 229 | 3300026095 | Ga0207676_10304439 | Ga0207676_103044392 | 160 |
| 230 | 3300026116 | Ga0207674_10010822 | Ga0207674_1001082210 | 160 |
| 231 | 3300026116 | Ga0207674_10121138 | Ga0207674_101211382 | 160 |
| 232 | 3300026116 | Ga0207674_10550282 | Ga0207674_105502822 | 160 |
| 233 | 3300026118 | Ga0207675_100932222 | Ga0207675_1009322222 | 160 |
| 234 | 3300026121 | Ga0207683_10034550 | Ga0207683_100345502 | 160 |
| 235 | 3300026142 | Ga0207698_10000775 | Ga0207698_1000077514 | 160 |
| 236 | 3300026142 | Ga0207698_10010944 | Ga0207698_100109444 | 160 |
| 237 | 3300026142 | Ga0207698_10110890 | Ga0207698_101108904 | 160 |
| 238 | 3300028379 | Ga0268266_10039465 | Ga0268266_100394652 | 160 |
| 239 | 3300028380 | Ga0268265_10070203 | Ga0268265_100702035 | 160 |
| 240 | 3300028381 | Ga0268264_10339277 | Ga0268264_103392772 | 160 |
| 241 | 3300031995 | Ga0307409_100523977 | Ga0307409_1005239771 | 160 |
| 242 | 3300034820 | Ga0373959_0118990 | Ga0373959_0118990_102_584 | 160 |
| 243 | 3300035092 | Ga0373952_0099335 | Ga0373952_0099335_103_585 | 160 |
| 244 | 3300035118 | Ga0373954_0115725 | Ga0373954_0115725_95_580 | 160 |
| 245 | 3300035119 | Ga0373956_0290876 | Ga0373956_0290876_24_509 | 160 |
| 246 | 3300035172 | Ga0373955_0017213 | Ga0373955_0017213_222_707 | 160 |
| 247 | 3300035241 | Ga0373961_0061271 | Ga0373961_0061271_594_1076 | 160 |
| 248 | 3300035692 | Ga0373935_0045407 | Ga0373935_0045407_280_783 | 160 |
| 249 | 3300035724 | Ga0373933_0181243 | Ga0373933_0181243_60_545 | 160 |
| 250 | 3300036401 | Ga0373937_0135269 | Ga0373937_0135269_1069_1554 | 160 |
| 251 | 3300037312 | Ga0395899_0012482 | Ga0395899_0012482_5685_6173 | 160 |
| 252 | 3300037312 | Ga0395899_0049824 | Ga0395899_0049824_196_684 | 160 |
| 253 | 3300037312 | Ga0395899_0096601 | Ga0395899_0096601_1301_1831 | 160 |
| 254 | 3300037418 | Ga0395900_0008516 | Ga0395900_0008516_66_566 | 160 |
| 255 | 3300037418 | Ga0395900_0039261 | Ga0395900_0039261_2847_3377 | 160 |
| 256 | 3300037418 | Ga0395900_0056637 | Ga0395900_0056637_2293_2784 | 160 |
| 257 | 3300037418 | Ga0395900_0079083 | Ga0395900_0079083_1081_1629 | 160 |
| 258 | 3300037418 | Ga0395900_0193526 | Ga0395900_0193526_160_648 | 160 |
| 259 | 3300037418 | Ga0395900_0398293 | Ga0395900_0398293_386_871 | 160 |
| 260 | 3300037418 | Ga0395900_0791709 | Ga0395900_0791709_197_685 | 160 |
| 261 | 3300037418 | Ga0395900_1205330 | Ga0395900_1205330_78_566 | 160 |
| 262 | 3300037418 | Ga0395900_1261512 | Ga0395900_1261512_141_626 | 160 |
| 263 | 3300037466 | Ga0395898_0061307 | Ga0395898_0061307_2726_3256 | 160 |
| 264 | 3300037466 | Ga0395898_0093511 | Ga0395898_0093511_183_674 | 160 |
| 265 | 3300037466 | Ga0395898_0208314 | Ga0395898_0208314_149_640 | 160 |
| 266 | 3300037466 | Ga0395898_0492095 | Ga0395898_0492095_263_751 | 160 |
| 267 | 3300037471 | Ga0395905_0004708 | Ga0395905_0004708_724_1224 | 160 |
| 268 | 3300037471 | Ga0395905_0199193 | Ga0395905_0199193_1160_1660 | 160 |
| 269 | 3300037471 | Ga0395905_0215012 | Ga0395905_0215012_87_575 | 160 |
| 270 | 3300037471 | Ga0395905_0240008 | Ga0395905_0240008_36_584 | 160 |
| 271 | 3300037471 | Ga0395905_0290663 | Ga0395905_0290663_749_1264 | 160 |
| 272 | 3300037471 | Ga0395905_0369210 | Ga0395905_0369210_90_599 | 160 |
| 273 | 3300037471 | Ga0395905_0398246 | Ga0395905_0398246_401_886 | 160 |
| 274 | 3300037471 | Ga0395905_0544752 | Ga0395905_0544752_347_832 | 160 |
| 275 | 3300037471 | Ga0395905_0589770 | Ga0395905_0589770_109_594 | 160 |
| 276 | 3300037471 | Ga0395905_0781607 | Ga0395905_0781607_160_648 | 160 |
| 277 | 3300038443 | Ga0395901_0030623 | Ga0395901_0030623_3943_4434 | 160 |
| 278 | 3300038443 | Ga0395901_0131249 | Ga0395901_0131249_1074_1604 | 160 |
| 279 | 3300038443 | Ga0395901_0161600 | Ga0395901_0161600_1093_1584 | 160 |
| 280 | 3300038443 | Ga0395901_0252880 | Ga0395901_0252880_117_665 | 160 |
| 281 | 3300038443 | Ga0395901_0273228 | Ga0395901_0273228_221_709 | 160 |
| 282 | 3300038443 | Ga0395901_0361894 | Ga0395901_0361894_498_980 | 160 |
| 283 | 3300044694 | Ga0466963_0005175 | Ga0466963_0005175_147_635 | 160 |
| 284 | 3300044694 | Ga0466963_0011096 | Ga0466963_0011096_2562_3047 | 160 |
| 285 | 3300044694 | Ga0466963_0013204 | Ga0466963_0013204_3581_4069 | 160 |
| 286 | 3300044694 | Ga0466963_0017121 | Ga0466963_0017121_2539_3021 | 160 |
| 287 | 3300044694 | Ga0466963_0057595 | Ga0466963_0057595_1740_2249 | 160 |
| 288 | 3300044694 | Ga0466963_0697584 | Ga0466963_0697584_71_562 | 160 |
| 289 | 3300044706 | Ga0466964_0027307 | Ga0466964_0027307_1414_1902 | 160 |
| 290 | 3300044706 | Ga0466964_0192046 | Ga0466964_0192046_456_938 | 160 |
| 291 | 3300044719 | Ga0466971_0026775 | Ga0466971_0026775_775_1260 | 160 |
| 292 | 3300044765 | Ga0466970_0061713 | Ga0466970_0061713_1105_1596 | 160 |
| 293 | 3300044842 | Ga0466957_0001433 | Ga0466957_0001433_829_1314 | 160 |
| 294 | 3300044842 | Ga0466957_0003522 | Ga0466957_0003522_1827_2411 | 160 |
| 295 | 3300044842 | Ga0466957_0065666 | Ga0466957_0065666_365_847 | 160 |
| 296 | 3300045049 | Ga0466959_0061640 | Ga0466959_0061640_1919_2410 | 160 |
| 297 | 3300045836 | Ga0466958_0019234 | Ga0466958_0019234_2521_3006 | 160 |
| 298 | 3300045836 | Ga0466958_0207650 | Ga0466958_0207650_217_708 | 160 |
| 299 | 3300045836 | Ga0466958_0228204 | Ga0466958_0228204_143_625 | 160 |
| 300 | 3300045976 | Ga0466967_0003642 | Ga0466967_0003642_4367_4852 | 160 |
| 301 | 3300045976 | Ga0466967_0013752 | Ga0466967_0013752_1380_1868 | 160 |
| 302 | 3300045976 | Ga0466967_0048533 | Ga0466967_0048533_751_1236 | 160 |
| 303 | 3300045976 | Ga0466967_0059622 | Ga0466967_0059622_1846_2355 | 160 |
| 304 | 3300045976 | Ga0466967_0123824 | Ga0466967_0123824_488_970 | 160 |
| 305 | 3300045976 | Ga0466967_0256471 | Ga0466967_0256471_451_933 | 160 |
| 306 | 3300045976 | Ga0466967_0512548 | Ga0466967_0512548_382_873 | 160 |
| 307 | 3300045976 | Ga0466967_0683575 | Ga0466967_0683575_455_943 | 160 |
| 308 | 3300045976 | Ga0466967_0975734 | Ga0466967_0975734_245_733 | 160 |
| 309 | 3300046524 | Ga0495648_0102722 | Ga0495648_0102722_536_1039 | 160 |
| 310 | 3300046539 | Ga0495621_0054560 | Ga0495621_0054560_661_1152 | 160 |
| 311 | 3300046684 | Ga0495669_0020437 | Ga0495669_0020437_545_1030 | 160 |
| 312 | 3300048088 | Ga0495602_0103778 | Ga0495602_0103778_771_1256 | 160 |
| 313 | 3300048903 | Ga0496100_0111428 | Ga0496100_0111428_105_590 | 160 |
| 314 | 3300048904 | Ga0496101_0311027 | Ga0496101_0311027_696_1178 | 160 |
| 315 | 3300048905 | Ga0496102_0180636 | Ga0496102_0180636_566_1066 | 160 |
| 316 | 3300048906 | Ga0496103_0169322 | Ga0496103_0169322_490_990 | 160 |
| 317 | 3300048907 | Ga0496104_0026150 | Ga0496104_0026150_364_849 | 160 |
| 318 | 3300048908 | Ga0496105_0132343 | Ga0496105_0132343_379_864 | 160 |
| 319 | 3300048909 | Ga0496106_0125869 | Ga0496106_0125869_1487_1969 | 160 |
| 320 | 3300048909 | Ga0496106_0745765 | Ga0496106_0745765_22_504 | 160 |
| 321 | 3300048910 | Ga0496107_0102720 | Ga0496107_0102720_1240_1722 | 160 |
| 322 | 3300048911 | Ga0496108_0339468 | Ga0496108_0339468_517_1002 | 160 |
| 323 | 3300048912 | Ga0496109_0052852 | Ga0496109_0052852_853_1335 | 160 |
| 324 | 3300048912 | Ga0496109_0265042 | Ga0496109_0265042_778_1263 | 160 |
| 325 | 3300048913 | Ga0496110_0008265 | Ga0496110_0008265_2104_2586 | 160 |
| 326 | 3300048913 | Ga0496110_0031776 | Ga0496110_0031776_2284_2769 | 160 |
| 327 | 3300048914 | Ga0496111_0035600 | Ga0496111_0035600_364_849 | 160 |
| 328 | 3300048914 | Ga0496111_0051086 | Ga0496111_0051086_259_741 | 160 |
| 329 | 3300048915 | Ga0496112_0045434 | Ga0496112_0045434_2711_3196 | 160 |
| 330 | 3300048915 | Ga0496112_0090688 | Ga0496112_0090688_2014_2496 | 160 |
| 331 | 3300048915 | Ga0496112_1187651 | Ga0496112_1187651_25_510 | 160 |
| 332 | 3300048916 | Ga0496113_0015623 | Ga0496113_0015623_265_747 | 160 |
| 333 | 3300048916 | Ga0496113_0541950 | Ga0496113_0541950_363_848 | 160 |
| 334 | 3300048919 | Ga0496116_0308784 | Ga0496116_0308784_93_590 | 160 |
| 335 | 3300048925 | Ga0496122_0099045 | Ga0496122_0099045_1387_1884 | 160 |
| 336 | 3300048926 | Ga0496123_0004066 | Ga0496123_0004066_11952_12449 | 160 |
| 337 | 3300048926 | Ga0496123_0023495 | Ga0496123_0023495_1769_2266 | 160 |
| 338 | 3300048927 | Ga0496124_0003359 | Ga0496124_0003359_9874_10371 | 160 |
| 339 | 3300048927 | Ga0496124_0008319 | Ga0496124_0008319_4618_5115 | 160 |
| 340 | 3300048928 | Ga0496125_0284459 | Ga0496125_0284459_510_1007 | 160 |
| 341 | 3300048929 | Ga0496126_0937682 | Ga0496126_0937682_127_624 | 160 |
| 342 | 3300049583 | Ga0501067_0302971 | Ga0501067_0302971_40_522 | 160 |
| 343 | 3300061719 | Ga0466962_0029172 | Ga0466962_0029172_1130_1615 | 160 |
| 344 | 3300061719 | Ga0466962_0037133 | Ga0466962_0037133_51_542 | 160 |
| 345 | 3300061719 | Ga0466962_0249486 | Ga0466962_0249486_302_790 | 160 |
| 346 | iso_pu_bacteria | 2599185359 | 2600226699 | 160 |
| 347 | iso_pu_bacteria | 2818991466 | 2819712328 | 160 |
| 348 | iso_pu_bacteria | 2928526807 | 2928526841 | 160 |
| 349 | iso_pu_bacteria | 2928968154 | 2928969608 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fyn-assembly1.cif.gz_A-2 | crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 | 0.8612 | 7 | 160 |
| 8a9n-assembly1.cif.gz_B | structure of dpa polyamine acetyltransferase in complex with 1,3-dap | 0.8506 | 5 | 152 |
| 8a9o-assembly1.cif.gz_B | structure of the polyamine acetyltransferase dpa | 0.8501 | 5 | 152 |
| 3pp9-assembly1.cif.gz_A-2 | 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a | 0.8497 | 56 | 160 |
| 3pp9-assembly2.cif.gz_B | 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a | 0.8467 | 54 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6QIS1_205_278_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9262 | 111 | 160 | 3.40.630.30 |
| af_A0A0R0LDP2_1_100_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8904 | 94 | 160 | 3.40.630.30 |
| af_Q4DGZ6_132_293_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8776 | 69 | 160 | 3.40.630.30 |
| af_P16691_3_141_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8633 | 4 | 152 | 3.40.630.30 |
| af_Q5AMM9_17_172_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8605 | 69 | 160 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5QWP4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9539 | 3 | 95 |
GO:0016740
|
| AF-A0A4Q5R6W4-F1-model_v4 | GNAT family N-acetyltransferase | 0.9515 | 19 | 109 |
GO:0016747
|
| AF-A0A538SFI9-F1-model_v4 | GNAT family N-acetyltransferase | 0.951 | 3 | 127 |
GO:0016747
|
| AF-A0A538SFI9-F1-model_v4 | GNAT family N-acetyltransferase | 0.9364 | 3 | 127 |
GO:0016747
|
| AF-S3HSK1-F1-model_v4 | Acetyltransferase | 0.932 | 3 | 160 |
GO:0016747
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar