F417995

General Info

Members Datasets Scaffolds Average Seq Length
349 174 345 164

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0102722|Ga0495648_0102722_536_1039
Length 167
Sequence MAGAGQHIVKVRAATLADIRIVGRWGAELVSLHHGFDPQRFIQAGPGTPAKYASFIESQLVLPDVIVLVAEDEMSLLGYVYAANEGNDYMSLRGPAGVIHDIFVDPARRGQGIGGALLERAIEELRGKGAGLFVLATAYRNEAAQRLFAAVGFRPTMIEMTQSPRGT

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
4 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.3
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10027792 3300001979 Bacteria 1878
2 JGI24740J21852_10063507 3300001979 Unclassified 1011
3 JGI24739J22299_10008945 3300001989 Bacteria 3736
4 JGI24739J22299_10078742 3300001989 Bacteria 1015
5 JGI24737J22298_10003359 3300001990 Bacteria 5662
6 JGI24737J22298_10029811 3300001990 Bacteria 1709
7 JGI24737J22298_10063207 3300001990 Bacteria 1111
8 JGI24735J21928_10011141 3300002067 Bacteria 2855
9 JGI24735J21928_10014580 3300002067 Bacteria 2460
10 JGI24738J21930_10000961 3300002075 Bacteria 8268
11 JGI24738J21930_10029558 3300002075 Bacteria 1120
12 Ga0065715_10048475 3300005293 Bacteria 974
13 Ga0070658_10000130 3300005327 Bacteria 66295
14 Ga0070658_10009112 3300005327 Bacteria 7978
15 Ga0070658_10026100 3300005327 Bacteria 4686
16 Ga0070658_10078557 3300005327 Bacteria 2709
17 Ga0070658_10084843 3300005327 Bacteria 2604
18 Ga0070676_10298371 3300005328 Bacteria 1091
19 Ga0070676_10363821 3300005328 Bacteria 997
20 Ga0070683_100139123 3300005329 Bacteria 2300
21 Ga0070670_100011521 3300005331 Bacteria 7563
22 Ga0070670_100075022 3300005331 Bacteria 2906
23 Ga0070670_100484893 3300005331 Unclassified 1098
24 Ga0068869_100661743 3300005334 Unclassified 887
25 Ga0070666_10075855 3300005335 Bacteria 2293
26 Ga0070666_10095375 3300005335 Bacteria 2047
27 Ga0070680_100003312 3300005336 Bacteria 12018
28 Ga0070680_100006208 3300005336 Bacteria 9065
29 Ga0070682_100459840 3300005337 Bacteria 977
30 Ga0068868_100502215 3300005338 Bacteria 1062
31 Ga0068868_100522334 3300005338 Bacteria 1042
32 Ga0070660_100000391 3300005339 Bacteria 29107
33 Ga0070660_100066339 3300005339 Bacteria 2809
34 Ga0070660_100123376 3300005339 Bacteria 2068
35 Ga0070660_100141951 3300005339 Bacteria 1927
36 Ga0070660_100298041 3300005339 Unclassified 1321
37 Ga0070660_100580446 3300005339 Bacteria 936
38 Ga0070660_100606891 3300005339 Bacteria 915
39 Ga0070661_100000206 3300005344 Bacteria 48811
40 Ga0070661_100021844 3300005344 Bacteria 4577
41 Ga0070661_100080328 3300005344 Unclassified 2407
42 Ga0070661_100184859 3300005344 Bacteria 1587
43 Ga0070661_101139836 3300005344 Bacteria 651
44 Ga0070675_101356233 3300005354 Bacteria 656
45 Ga0070671_100011023 3300005355 Bacteria 7255
46 Ga0070671_100019594 3300005355 Bacteria 5509
47 Ga0070671_100032201 3300005355 Bacteria 4336
48 Ga0070671_100291720 3300005355 Unclassified 1388
49 Ga0070673_100137322 3300005364 Bacteria 2059
50 Ga0070673_100245815 3300005364 Bacteria 1557
51 Ga0070659_100000884 3300005366 Bacteria 21912
52 Ga0070659_100006353 3300005366 Bacteria 8535
53 Ga0070659_100037352 3300005366 Bacteria 3786
54 Ga0070659_100230680 3300005366 Bacteria 1530
55 Ga0070667_100035369 3300005367 Bacteria 4184
56 Ga0070713_100040965 3300005436 Bacteria 3770
57 Ga0070710_10225491 3300005437 Unclassified 1194
58 Ga0070710_10259795 3300005437 Unclassified 1119
59 Ga0070663_100006000 3300005455 Bacteria 7269
60 Ga0070663_100304143 3300005455 Bacteria 1277
61 Ga0070678_100021464 3300005456 Bacteria 4258
62 Ga0070662_100000107 3300005457 Bacteria 46051
63 Ga0070681_10016414 3300005458 Bacteria 7392
64 Ga0070681_10019474 3300005458 Bacteria 6793
65 Ga0070681_10262640 3300005458 Unclassified 1638
66 Ga0068867_100135132 3300005459 Bacteria 1921
67 Ga0070685_10534775 3300005466 Unclassified 834
68 Ga0070679_100334502 3300005530 Bacteria 1463
69 Ga0070679_100700010 3300005530 Bacteria 956
70 Ga0070684_100097050 3300005535 Bacteria 2628
71 Ga0068853_100000172 3300005539 Bacteria 45090
72 Ga0068853_100008708 3300005539 Bacteria 8162
73 Ga0068853_100036316 3300005539 Bacteria 4189
74 Ga0070672_100813831 3300005543 Unclassified 822
75 Ga0070696_100318155 3300005546 Bacteria 1197
76 Ga0070693_100000967 3300005547 Bacteria 12766
77 Ga0070693_100169012 3300005547 Unclassified 1399
78 Ga0070665_100005356 3300005548 Bacteria 13251
79 Ga0068855_100003916 3300005563 Bacteria 18174
80 Ga0068855_100010468 3300005563 Bacteria 11192
81 Ga0068855_100440460 3300005563 Unclassified 1423
82 Ga0070664_100000032 3300005564 Bacteria 88298
83 Ga0070664_100077460 3300005564 Bacteria 2858
84 Ga0070664_100101206 3300005564 Bacteria 2506
85 Ga0068857_100017295 3300005577 Bacteria 6318
86 Ga0068857_100334979 3300005577 Unclassified 1399
87 Ga0068854_100033369 3300005578 Bacteria 3589
88 Ga0068854_100074756 3300005578 Bacteria 2486
89 Ga0068856_100000364 3300005614 Bacteria 49715
90 Ga0068856_100031931 3300005614 Bacteria 5152
91 Ga0068856_100177115 3300005614 Unclassified 2145
92 Ga0068856_100379959 3300005614 Bacteria 1432
93 Ga0068856_101008761 3300005614 Bacteria 851
94 Ga0070702_100094262 3300005615 Bacteria 1822
95 Ga0068852_100000780 3300005616 Bacteria 20902
96 Ga0068852_100004552 3300005616 Bacteria 9816
97 Ga0068852_100084731 3300005616 Bacteria 2822
98 Ga0068852_100133607 3300005616 Bacteria 2288
99 Ga0068859_100066278 3300005617 Bacteria 3646
100 Ga0068859_100450870 3300005617 Bacteria 1383
101 Ga0068864_100005507 3300005618 Bacteria 10375
102 Ga0068864_100084452 3300005618 Bacteria 2790
103 Ga0068864_100461269 3300005618 Bacteria 1216
104 Ga0068866_10056465 3300005718 Bacteria 2019
105 Ga0068851_10029741 3300005834 Unclassified 2706
106 Ga0068851_10120173 3300005834 Bacteria 1411
107 Ga0068858_101877231 3300005842 Bacteria 592
108 Ga0068860_100341982 3300005843 Unclassified 1471
109 Ga0070717_10028934 3300006028 Bacteria 4441
110 Ga0070716_100045514 3300006173 Bacteria 2464
111 Ga0070712_100010413 3300006175 Bacteria 5866
112 Ga0068871_101104328 3300006358 Bacteria 742
113 Ga0068865_100026291 3300006881 Bacteria 3836
114 Ga0097620_100066278 3300006931 Bacteria 3646
115 Ga0097620_100450868 3300006931 Bacteria 1383
116 Ga0105245_10017352 3300009098 Bacteria 6280
117 Ga0105248_10000238 3300009177 Bacteria 63658
118 Ga0105248_10001772 3300009177 Bacteria 24028
119 Ga0105237_10106391 3300009545 Bacteria 2797
120 Ga0105238_10201680 3300009551 Bacteria 1965
121 Ga0105246_10298670 3300011119 Unclassified 1299
122 Ga0157373_10246642 3300013100 Unclassified 1263
123 Ga0157373_10248890 3300013100 Bacteria 1257
124 Ga0157371_10005248 3300013102 Bacteria 10999
125 Ga0157371_10040705 3300013102 Bacteria 3317
126 Ga0157370_10043581 3300013104 Bacteria 4316
127 Ga0157370_10254855 3300013104 Unclassified 1623
128 Ga0157369_10140761 3300013105 Bacteria 2553
129 Ga0157369_10230596 3300013105 Bacteria 1936
130 Ga0157369_10275254 3300013105 Unclassified 1754
131 Ga0157374_10053682 3300013296 Bacteria 3758
132 Ga0157375_10164964 3300013308 Bacteria 2359
133 Ga0163163_10000371 3300014325 Bacteria 43097
134 Ga0157379_10033120 3300014968 Bacteria 4608
135 Ga0157376_10116741 3300014969 Bacteria 2359
136 Ga0207656_10079141 3300025321 Unclassified 1474
137 Ga0207682_10173728 3300025893 Bacteria 981
138 Ga0207680_10022556 3300025903 Bacteria 3426
139 Ga0207647_10008620 3300025904 Bacteria 7294
140 Ga0207647_10011134 3300025904 Bacteria 6319
141 Ga0207699_10023448 3300025906 Bacteria 3359
142 Ga0207645_10012436 3300025907 Bacteria 5773
143 Ga0207705_10000200 3300025909 Bacteria 60434
144 Ga0207705_10004140 3300025909 Bacteria 10999
145 Ga0207705_10016629 3300025909 Bacteria 5269
146 Ga0207705_10028159 3300025909 Bacteria 4006
147 Ga0207705_10065289 3300025909 Unclassified 2631
148 Ga0207654_10042700 3300025911 Bacteria 2567
149 Ga0207707_10039243 3300025912 Bacteria 4140
150 Ga0207707_10079952 3300025912 Bacteria 2854
151 Ga0207707_10117667 3300025912 Bacteria 2323
152 Ga0207695_10379500 3300025913 Bacteria 1299
153 Ga0207671_10020093 3300025914 Bacteria 5093
154 Ga0207671_10263526 3300025914 Bacteria 1357
155 Ga0207693_10020143 3300025915 Bacteria 5306
156 Ga0207660_10012224 3300025917 Bacteria 5609
157 Ga0207657_10000468 3300025919 Bacteria 42779
158 Ga0207657_10003153 3300025919 Bacteria 17635
159 Ga0207657_10004240 3300025919 Bacteria 15196
160 Ga0207657_10039319 3300025919 Bacteria 4205
161 Ga0207657_10172464 3300025919 Bacteria 1752
162 Ga0207649_10000362 3300025920 Bacteria 34070
163 Ga0207649_10005750 3300025920 Bacteria 6714
164 Ga0207649_10183649 3300025920 Unclassified 1465
165 Ga0207649_10198092 3300025920 Bacteria 1417
166 Ga0207652_10029444 3300025921 Bacteria 4591
167 Ga0207652_10616343 3300025921 Bacteria 972
168 Ga0207681_10129483 3300025923 Bacteria 1864
169 Ga0207694_10006948 3300025924 Bacteria 8594
170 Ga0207694_10190028 3300025924 Unclassified 1668
171 Ga0207694_10835551 3300025924 Bacteria 778
172 Ga0207650_10057695 3300025925 Bacteria 2888
173 Ga0207650_10072909 3300025925 Bacteria 2585
174 Ga0207650_10457099 3300025925 Bacteria 1063
175 Ga0207659_10962529 3300025926 Unclassified 734
176 Ga0207700_10028162 3300025928 Bacteria 3946
177 Ga0207644_10002090 3300025931 Bacteria 12933
178 Ga0207644_10024790 3300025931 Bacteria 4120
179 Ga0207644_10122048 3300025931 Bacteria 1984
180 Ga0207644_10350589 3300025931 Bacteria 1198
181 Ga0207690_10000062 3300025932 Bacteria 96511
182 Ga0207690_10026604 3300025932 Bacteria 3644
183 Ga0207690_10186400 3300025932 Bacteria 1566
184 Ga0207690_10214537 3300025932 Bacteria 1469
185 Ga0207706_10000211 3300025933 Bacteria 63984
186 Ga0207706_10004449 3300025933 Bacteria 13166
187 Ga0207706_10923991 3300025933 Bacteria 736
188 Ga0207669_10029516 3300025937 Bacteria 3034
189 Ga0207704_10019876 3300025938 Bacteria 3539
190 Ga0207665_10046965 3300025939 Bacteria 2894
191 Ga0207691_10015370 3300025940 Bacteria 7283
192 Ga0207711_10001518 3300025941 Bacteria 21567
193 Ga0207711_10001908 3300025941 Bacteria 18939
194 Ga0207689_10624588 3300025942 Bacteria 907
195 Ga0207689_10629227 3300025942 Unclassified 904
196 Ga0207661_10115424 3300025944 Bacteria 2278
197 Ga0207661_10598356 3300025944 Bacteria 1012
198 Ga0207679_10000506 3300025945 Bacteria 26758
199 Ga0207679_10048390 3300025945 Bacteria 3095
200 Ga0207679_10275622 3300025945 Bacteria 1440
201 Ga0207679_10624806 3300025945 Unclassified 973
202 Ga0207667_10006933 3300025949 Bacteria 13694
203 Ga0207667_10033992 3300025949 Bacteria 5477
204 Ga0207667_10182339 3300025949 Bacteria 2156
205 Ga0207667_10850036 3300025949 Unclassified 907
206 Ga0207651_10186576 3300025960 Bacteria 1650
207 Ga0207640_10072020 3300025981 Bacteria 2330
208 Ga0207640_10519984 3300025981 Bacteria 994
209 Ga0207658_10041302 3300025986 Bacteria 3339
210 Ga0207658_10165988 3300025986 Bacteria 1814
211 Ga0207677_11642708 3300026023 Unclassified 595
212 Ga0207639_10000532 3300026041 Bacteria 26198
213 Ga0207639_10000990 3300026041 Bacteria 19349
214 Ga0207639_10135184 3300026041 Bacteria 2046
215 Ga0207639_10186040 3300026041 Bacteria 1771
216 Ga0207678_10004245 3300026067 Bacteria 12855
217 Ga0207678_10021992 3300026067 Bacteria 5590
218 Ga0207678_10236364 3300026067 Unclassified 1565
219 Ga0207702_10001280 3300026078 Bacteria 25252
220 Ga0207702_10372990 3300026078 Bacteria 1370
221 Ga0207702_10528115 3300026078 Unclassified 1152
222 Ga0207648_10000889 3300026089 Bacteria 33700
223 Ga0207676_10061178 3300026095 Bacteria 2981
224 Ga0207676_10183631 3300026095 Bacteria 1834
225 Ga0207676_10304439 3300026095 Bacteria 1456
226 Ga0207674_10010822 3300026116 Bacteria 10285
227 Ga0207674_10121138 3300026116 Bacteria 2584
228 Ga0207674_10550282 3300026116 Bacteria 1115
229 Ga0207675_100932222 3300026118 Bacteria 885
230 Ga0207683_10034550 3300026121 Bacteria 4394
231 Ga0207698_10000775 3300026142 Bacteria 18575
232 Ga0207698_10010944 3300026142 Bacteria 5860
233 Ga0207698_10110890 3300026142 Bacteria 2299
234 Ga0268266_10039465 3300028379 Bacteria 4022
235 Ga0268265_10070203 3300028380 Bacteria 2723
236 Ga0268264_10339277 3300028381 Unclassified 1427
237 Ga0307409_100523977 3300031995 Unclassified 1158
238 Ga0373959_0118990 3300034820 Bacteria 644
239 Ga0373952_0099335 3300035092 Unclassified 766
240 Ga0373954_0115725 3300035118 Bacteria 1299
241 Ga0373956_0290876 3300035119 Bacteria 778
242 Ga0373955_0017213 3300035172 Bacteria 3572
243 Ga0373961_0061271 3300035241 Unclassified 1142
244 Ga0373935_0045407 3300035692 Bacteria 2773
245 Ga0373933_0181243 3300035724 Bacteria 1343
246 Ga0373937_0135269 3300036401 Bacteria 2304
247 Ga0395899_0012482 3300037312 Bacteria 6508
248 Ga0395899_0049824 3300037312 Unclassified 3112
249 Ga0395899_0096601 3300037312 Bacteria 2136
250 Ga0395900_0008516 3300037418 Bacteria 10545
251 Ga0395900_0039261 3300037418 Unclassified 4877
252 Ga0395900_0056637 3300037418 Bacteria 4034
253 Ga0395900_0079083 3300037418 Bacteria 3378
254 Ga0395900_0193526 3300037418 Bacteria 2061
255 Ga0395900_0398293 3300037418 Bacteria 1341
256 Ga0395900_0791709 3300037418 Bacteria 876
257 Ga0395900_1205330 3300037418 Unclassified 672
258 Ga0395900_1261512 3300037418 Bacteria 653
259 Ga0395898_0061307 3300037466 Unclassified 3654
260 Ga0395898_0093511 3300037466 Bacteria 2889
261 Ga0395898_0208314 3300037466 Bacteria 1865
262 Ga0395898_0492095 3300037466 Unclassified 1167
263 Ga0395905_0004708 3300037471 Bacteria 14097
264 Ga0395905_0199193 3300037471 Bacteria 1878
265 Ga0395905_0215012 3300037471 Unclassified 1800
266 Ga0395905_0240008 3300037471 Bacteria 1693
267 Ga0395905_0290663 3300037471 Unclassified 1521
268 Ga0395905_0369210 3300037471 Bacteria 1328
269 Ga0395905_0398246 3300037471 Bacteria 1271
270 Ga0395905_0544752 3300037471 Bacteria 1061
271 Ga0395905_0589770 3300037471 Unclassified 1013
272 Ga0395905_0781607 3300037471 Unclassified 857
273 Ga0395901_0030623 3300038443 Bacteria 5544
274 Ga0395901_0131249 3300038443 Unclassified 2632
275 Ga0395901_0161600 3300038443 Bacteria 2352
276 Ga0395901_0252880 3300038443 Bacteria 1835
277 Ga0395901_0273228 3300038443 Bacteria 1757
278 Ga0395901_0361894 3300038443 Unclassified 1496
279 Ga0466965_0651707 3300044683 Unclassified 601
280 Ga0466961_0016718 3300044693 Bacteria 4718
281 Ga0466963_0005175 3300044694 Bacteria 7615
282 Ga0466963_0011096 3300044694 Bacteria 5479
283 Ga0466963_0013204 3300044694 Bacteria 5069
284 Ga0466963_0017121 3300044694 Bacteria 4514
285 Ga0466963_0057595 3300044694 Unclassified 2588
286 Ga0466963_0697584 3300044694 Bacteria 716
287 Ga0466964_0027307 3300044706 Unclassified 2241
288 Ga0466964_0192046 3300044706 Bacteria 975
289 Ga0466971_0026775 3300044719 Bacteria 2579
290 Ga0466971_0238399 3300044719 Bacteria 865
291 Ga0466970_0061713 3300044765 Bacteria 2009
292 Ga0466957_0001433 3300044842 Bacteria 12457
293 Ga0466957_0003522 3300044842 Bacteria 8615
294 Ga0466957_0065666 3300044842 Unclassified 2235
295 Ga0466959_0061640 3300045049 Bacteria 2727
296 Ga0466959_0403896 3300045049 Unclassified 928
297 Ga0466958_0019234 3300045836 Bacteria 3974
298 Ga0466958_0207650 3300045836 Bacteria 1247
299 Ga0466958_0228204 3300045836 Unclassified 1189
300 Ga0466967_0003642 3300045976 Bacteria 10129
301 Ga0466967_0013752 3300045976 Bacteria 6270
302 Ga0466967_0048533 3300045976 Bacteria 3707
303 Ga0466967_0059622 3300045976 Bacteria 3379
304 Ga0466967_0123824 3300045976 Unclassified 2392
305 Ga0466967_0256471 3300045976 Bacteria 1672
306 Ga0466967_0512548 3300045976 Bacteria 1178
307 Ga0466967_0683575 3300045976 Bacteria 1016
308 Ga0466967_0975734 3300045976 Bacteria 843
309 Ga0495648_0102722 3300046524 Bacteria 1574
310 Ga0495621_0054560 3300046539 Bacteria 1437
311 Ga0495669_0020437 3300046684 Bacteria 2866
312 Ga0495602_0103778 3300048088 Bacteria 2326
313 Ga0496100_0111428 3300048903 Bacteria 1902
314 Ga0496101_0311027 3300048904 Bacteria 1235
315 Ga0496102_0180636 3300048905 Bacteria 1988
316 Ga0496103_0169322 3300048906 Bacteria 1402
317 Ga0496104_0026150 3300048907 Bacteria 5385
318 Ga0496105_0132343 3300048908 Unclassified 2056
319 Ga0496106_0125869 3300048909 Bacteria 2006
320 Ga0496106_0745765 3300048909 Bacteria 779
321 Ga0496107_0102720 3300048910 Bacteria 2096
322 Ga0496108_0339468 3300048911 Bacteria 1310
323 Ga0496109_0052852 3300048912 Bacteria 3704
324 Ga0496109_0265042 3300048912 Bacteria 1618
325 Ga0496110_0008265 3300048913 Bacteria 8368
326 Ga0496110_0031776 3300048913 Bacteria 4557
327 Ga0496111_0035600 3300048914 Bacteria 3559
328 Ga0496111_0051086 3300048914 Bacteria 2984
329 Ga0496112_0045434 3300048915 Bacteria 4305
330 Ga0496112_0090688 3300048915 Bacteria 3025
331 Ga0496112_1187651 3300048915 Unclassified 680
332 Ga0496113_0015623 3300048916 Bacteria 5226
333 Ga0496113_0541950 3300048916 Unclassified 933
334 Ga0496116_0308784 3300048919 Unclassified 748
335 Ga0496122_0099045 3300048925 Bacteria 1956
336 Ga0496123_0004066 3300048926 Bacteria 15753
337 Ga0496123_0023495 3300048926 Bacteria 4717
338 Ga0496124_0003359 3300048927 Bacteria 19669
339 Ga0496124_0008319 3300048927 Bacteria 10859
340 Ga0496125_0284459 3300048928 Bacteria 1022
341 Ga0496126_0937682 3300048929 Bacteria 654
342 Ga0501067_0302971 3300049583 Unclassified 890
343 Ga0466962_0029172 3300061719 Bacteria 2641
344 Ga0466962_0037133 3300061719 Bacteria 2332
345 Ga0466962_0249486 3300061719 Bacteria 872

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10026100 Ga0070658_100261004 155
2 3300005331 Ga0070670_100484893 Ga0070670_1004848932 155
3 3300005339 Ga0070660_100606891 Ga0070660_1006068912 155
4 3300005344 Ga0070661_100184859 Ga0070661_1001848592 155
5 3300025909 Ga0207705_10028159 Ga0207705_100281595 155
6 3300025925 Ga0207650_10457099 Ga0207650_104570992 155
7 3300044683 Ga0466965_0651707 Ga0466965_0651707_26_511 158
8 3300044693 Ga0466961_0016718 Ga0466961_0016718_693_1178 158
9 3300044719 Ga0466971_0238399 Ga0466971_0238399_26_511 158
10 3300045049 Ga0466959_0403896 Ga0466959_0403896_253_738 158
11 3300001979 JGI24740J21852_10027792 JGI24740J21852_100277924 160
12 3300001979 JGI24740J21852_10063507 JGI24740J21852_100635072 160
13 3300001989 JGI24739J22299_10008945 JGI24739J22299_100089452 160
14 3300001989 JGI24739J22299_10078742 JGI24739J22299_100787422 160
15 3300001990 JGI24737J22298_10003359 JGI24737J22298_100033592 160
16 3300001990 JGI24737J22298_10029811 JGI24737J22298_100298112 160
17 3300001990 JGI24737J22298_10063207 JGI24737J22298_100632072 160
18 3300002067 JGI24735J21928_10011141 JGI24735J21928_100111412 160
19 3300002067 JGI24735J21928_10014580 JGI24735J21928_100145804 160
20 3300002075 JGI24738J21930_10000961 JGI24738J21930_100009619 160
21 3300002075 JGI24738J21930_10029558 JGI24738J21930_100295581 160
22 3300005293 Ga0065715_10048475 Ga0065715_100484752 160
23 3300005327 Ga0070658_10000130 Ga0070658_1000013046 160
24 3300005327 Ga0070658_10009112 Ga0070658_100091123 160
25 3300005327 Ga0070658_10078557 Ga0070658_100785574 160
26 3300005327 Ga0070658_10084843 Ga0070658_100848433 160
27 3300005328 Ga0070676_10298371 Ga0070676_102983712 160
28 3300005328 Ga0070676_10363821 Ga0070676_103638212 160
29 3300005329 Ga0070683_100139123 Ga0070683_1001391232 160
30 3300005331 Ga0070670_100011521 Ga0070670_1000115213 160
31 3300005331 Ga0070670_100075022 Ga0070670_1000750223 160
32 3300005334 Ga0068869_100661743 Ga0068869_1006617431 160
33 3300005335 Ga0070666_10075855 Ga0070666_100758552 160
34 3300005335 Ga0070666_10095375 Ga0070666_100953753 160
35 3300005336 Ga0070680_100003312 Ga0070680_1000033127 160
36 3300005336 Ga0070680_100006208 Ga0070680_10000620811 160
37 3300005337 Ga0070682_100459840 Ga0070682_1004598402 160
38 3300005338 Ga0068868_100502215 Ga0068868_1005022152 160
39 3300005338 Ga0068868_100522334 Ga0068868_1005223342 160
40 3300005339 Ga0070660_100000391 Ga0070660_10000039124 160
41 3300005339 Ga0070660_100066339 Ga0070660_1000663394 160
42 3300005339 Ga0070660_100123376 Ga0070660_1001233761 160
43 3300005339 Ga0070660_100141951 Ga0070660_1001419512 160
44 3300005339 Ga0070660_100298041 Ga0070660_1002980412 160
45 3300005339 Ga0070660_100580446 Ga0070660_1005804462 160
46 3300005344 Ga0070661_100000206 Ga0070661_10000020614 160
47 3300005344 Ga0070661_100021844 Ga0070661_1000218444 160
48 3300005344 Ga0070661_100080328 Ga0070661_1000803283 160
49 3300005344 Ga0070661_101139836 Ga0070661_1011398361 160
50 3300005354 Ga0070675_101356233 Ga0070675_1013562331 160
51 3300005355 Ga0070671_100011023 Ga0070671_1000110237 160
52 3300005355 Ga0070671_100019594 Ga0070671_1000195947 160
53 3300005355 Ga0070671_100032201 Ga0070671_1000322014 160
54 3300005355 Ga0070671_100291720 Ga0070671_1002917202 160
55 3300005364 Ga0070673_100137322 Ga0070673_1001373223 160
56 3300005364 Ga0070673_100245815 Ga0070673_1002458152 160
57 3300005366 Ga0070659_100000884 Ga0070659_10000088424 160
58 3300005366 Ga0070659_100006353 Ga0070659_1000063537 160
59 3300005366 Ga0070659_100037352 Ga0070659_1000373524 160
60 3300005366 Ga0070659_100230680 Ga0070659_1002306802 160
61 3300005367 Ga0070667_100035369 Ga0070667_1000353693 160
62 3300005436 Ga0070713_100040965 Ga0070713_1000409652 160
63 3300005437 Ga0070710_10225491 Ga0070710_102254912 160
64 3300005437 Ga0070710_10259795 Ga0070710_102597952 160
65 3300005455 Ga0070663_100006000 Ga0070663_1000060002 160
66 3300005455 Ga0070663_100304143 Ga0070663_1003041432 160
67 3300005456 Ga0070678_100021464 Ga0070678_1000214644 160
68 3300005457 Ga0070662_100000107 Ga0070662_10000010750 160
69 3300005458 Ga0070681_10016414 Ga0070681_100164148 160
70 3300005458 Ga0070681_10019474 Ga0070681_100194747 160
71 3300005458 Ga0070681_10262640 Ga0070681_102626403 160
72 3300005459 Ga0068867_100135132 Ga0068867_1001351322 160
73 3300005466 Ga0070685_10534775 Ga0070685_105347751 160
74 3300005530 Ga0070679_100334502 Ga0070679_1003345022 160
75 3300005530 Ga0070679_100700010 Ga0070679_1007000101 160
76 3300005535 Ga0070684_100097050 Ga0070684_1000970503 160
77 3300005539 Ga0068853_100000172 Ga0068853_1000001728 160
78 3300005539 Ga0068853_100008708 Ga0068853_10000870810 160
79 3300005539 Ga0068853_100036316 Ga0068853_1000363165 160
80 3300005543 Ga0070672_100813831 Ga0070672_1008138311 160
81 3300005546 Ga0070696_100318155 Ga0070696_1003181552 160
82 3300005547 Ga0070693_100000967 Ga0070693_10000096717 160
83 3300005547 Ga0070693_100169012 Ga0070693_1001690122 160
84 3300005548 Ga0070665_100005356 Ga0070665_1000053566 160
85 3300005563 Ga0068855_100003916 Ga0068855_1000039164 160
86 3300005563 Ga0068855_100010468 Ga0068855_1000104684 160
87 3300005563 Ga0068855_100440460 Ga0068855_1004404602 160
88 3300005564 Ga0070664_100000032 Ga0070664_10000003224 160
89 3300005564 Ga0070664_100077460 Ga0070664_1000774602 160
90 3300005564 Ga0070664_100101206 Ga0070664_1001012062 160
91 3300005577 Ga0068857_100017295 Ga0068857_1000172952 160
92 3300005577 Ga0068857_100334979 Ga0068857_1003349792 160
93 3300005578 Ga0068854_100033369 Ga0068854_1000333695 160
94 3300005578 Ga0068854_100074756 Ga0068854_1000747562 160
95 3300005614 Ga0068856_100000364 Ga0068856_10000036413 160
96 3300005614 Ga0068856_100031931 Ga0068856_1000319315 160
97 3300005614 Ga0068856_100177115 Ga0068856_1001771152 160
98 3300005614 Ga0068856_100379959 Ga0068856_1003799592 160
99 3300005614 Ga0068856_101008761 Ga0068856_1010087612 160
100 3300005615 Ga0070702_100094262 Ga0070702_1000942622 160
101 3300005616 Ga0068852_100000780 Ga0068852_10000078013 160
102 3300005616 Ga0068852_100004552 Ga0068852_1000045524 160
103 3300005616 Ga0068852_100084731 Ga0068852_1000847312 160
104 3300005616 Ga0068852_100133607 Ga0068852_1001336074 160
105 3300005617 Ga0068859_100066278 Ga0068859_1000662784 160
106 3300005617 Ga0068859_100450870 Ga0068859_1004508703 160
107 3300005618 Ga0068864_100005507 Ga0068864_1000055073 160
108 3300005618 Ga0068864_100084452 Ga0068864_1000844524 160
109 3300005618 Ga0068864_100461269 Ga0068864_1004612692 160
110 3300005718 Ga0068866_10056465 Ga0068866_100564652 160
111 3300005834 Ga0068851_10029741 Ga0068851_100297413 160
112 3300005834 Ga0068851_10120173 Ga0068851_101201733 160
113 3300005842 Ga0068858_101877231 Ga0068858_1018772311 160
114 3300005843 Ga0068860_100341982 Ga0068860_1003419822 160
115 3300006028 Ga0070717_10028934 Ga0070717_100289347 160
116 3300006173 Ga0070716_100045514 Ga0070716_1000455142 160
117 3300006175 Ga0070712_100010413 Ga0070712_1000104134 160
118 3300006358 Ga0068871_101104328 Ga0068871_1011043281 160
119 3300006881 Ga0068865_100026291 Ga0068865_1000262913 160
120 3300006931 Ga0097620_100066278 Ga0097620_1000662784 160
121 3300006931 Ga0097620_100450868 Ga0097620_1004508682 160
122 3300009098 Ga0105245_10017352 Ga0105245_100173525 160
123 3300009177 Ga0105248_10000238 Ga0105248_1000023813 160
124 3300009177 Ga0105248_10001772 Ga0105248_100017727 160
125 3300009545 Ga0105237_10106391 Ga0105237_101063912 160
126 3300009551 Ga0105238_10201680 Ga0105238_102016802 160
127 3300011119 Ga0105246_10298670 Ga0105246_102986702 160
128 3300013100 Ga0157373_10246642 Ga0157373_102466422 160
129 3300013100 Ga0157373_10248890 Ga0157373_102488902 160
130 3300013102 Ga0157371_10005248 Ga0157371_100052484 160
131 3300013102 Ga0157371_10040705 Ga0157371_100407052 160
132 3300013104 Ga0157370_10043581 Ga0157370_1004358112 160
133 3300013104 Ga0157370_10254855 Ga0157370_102548552 160
134 3300013105 Ga0157369_10140761 Ga0157369_101407613 160
135 3300013105 Ga0157369_10230596 Ga0157369_102305961 160
136 3300013105 Ga0157369_10275254 Ga0157369_102752542 160
137 3300013296 Ga0157374_10053682 Ga0157374_100536824 160
138 3300013308 Ga0157375_10164964 Ga0157375_101649644 160
139 3300014325 Ga0163163_10000371 Ga0163163_1000037147 160
140 3300014968 Ga0157379_10033120 Ga0157379_100331204 160
141 3300014969 Ga0157376_10116741 Ga0157376_101167414 160
142 3300025321 Ga0207656_10079141 Ga0207656_100791413 160
143 3300025893 Ga0207682_10173728 Ga0207682_101737282 160
144 3300025903 Ga0207680_10022556 Ga0207680_100225564 160
145 3300025904 Ga0207647_10008620 Ga0207647_100086202 160
146 3300025904 Ga0207647_10011134 Ga0207647_100111345 160
147 3300025906 Ga0207699_10023448 Ga0207699_100234483 160
148 3300025907 Ga0207645_10012436 Ga0207645_100124362 160
149 3300025909 Ga0207705_10000200 Ga0207705_1000020049 160
150 3300025909 Ga0207705_10004140 Ga0207705_100041408 160
151 3300025909 Ga0207705_10016629 Ga0207705_100166296 160
152 3300025909 Ga0207705_10065289 Ga0207705_100652894 160
153 3300025911 Ga0207654_10042700 Ga0207654_100427002 160
154 3300025912 Ga0207707_10039243 Ga0207707_100392433 160
155 3300025912 Ga0207707_10079952 Ga0207707_100799522 160
156 3300025912 Ga0207707_10117667 Ga0207707_101176673 160
157 3300025913 Ga0207695_10379500 Ga0207695_103795001 160
158 3300025914 Ga0207671_10020093 Ga0207671_100200935 160
159 3300025914 Ga0207671_10263526 Ga0207671_102635262 160
160 3300025915 Ga0207693_10020143 Ga0207693_100201437 160
161 3300025917 Ga0207660_10012224 Ga0207660_100122243 160
162 3300025919 Ga0207657_10000468 Ga0207657_1000046831 160
163 3300025919 Ga0207657_10003153 Ga0207657_100031534 160
164 3300025919 Ga0207657_10004240 Ga0207657_1000424013 160
165 3300025919 Ga0207657_10039319 Ga0207657_100393197 160
166 3300025919 Ga0207657_10172464 Ga0207657_101724643 160
167 3300025920 Ga0207649_10000362 Ga0207649_100003625 160
168 3300025920 Ga0207649_10005750 Ga0207649_100057506 160
169 3300025920 Ga0207649_10183649 Ga0207649_101836492 160
170 3300025920 Ga0207649_10198092 Ga0207649_101980922 160
171 3300025921 Ga0207652_10029444 Ga0207652_100294445 160
172 3300025921 Ga0207652_10616343 Ga0207652_106163432 160
173 3300025923 Ga0207681_10129483 Ga0207681_101294833 160
174 3300025924 Ga0207694_10006948 Ga0207694_100069489 160
175 3300025924 Ga0207694_10190028 Ga0207694_101900282 160
176 3300025924 Ga0207694_10835551 Ga0207694_108355511 160
177 3300025925 Ga0207650_10057695 Ga0207650_100576955 160
178 3300025925 Ga0207650_10072909 Ga0207650_100729092 160
179 3300025926 Ga0207659_10962529 Ga0207659_109625291 160
180 3300025928 Ga0207700_10028162 Ga0207700_100281625 160
181 3300025931 Ga0207644_10002090 Ga0207644_100020902 160
182 3300025931 Ga0207644_10024790 Ga0207644_100247903 160
183 3300025931 Ga0207644_10122048 Ga0207644_101220481 160
184 3300025931 Ga0207644_10350589 Ga0207644_103505891 160
185 3300025932 Ga0207690_10000062 Ga0207690_1000006245 160
186 3300025932 Ga0207690_10026604 Ga0207690_100266042 160
187 3300025932 Ga0207690_10186400 Ga0207690_101864002 160
188 3300025932 Ga0207690_10214537 Ga0207690_102145372 160
189 3300025933 Ga0207706_10000211 Ga0207706_1000021113 160
190 3300025933 Ga0207706_10004449 Ga0207706_1000444911 160
191 3300025933 Ga0207706_10923991 Ga0207706_109239911 160
192 3300025937 Ga0207669_10029516 Ga0207669_100295162 160
193 3300025938 Ga0207704_10019876 Ga0207704_100198765 160
194 3300025939 Ga0207665_10046965 Ga0207665_100469654 160
195 3300025940 Ga0207691_10015370 Ga0207691_100153708 160
196 3300025941 Ga0207711_10001518 Ga0207711_1000151818 160
197 3300025941 Ga0207711_10001908 Ga0207711_100019083 160
198 3300025942 Ga0207689_10624588 Ga0207689_106245881 160
199 3300025942 Ga0207689_10629227 Ga0207689_106292272 160
200 3300025944 Ga0207661_10115424 Ga0207661_101154242 160
201 3300025944 Ga0207661_10598356 Ga0207661_105983562 160
202 3300025945 Ga0207679_10000506 Ga0207679_100005068 160
203 3300025945 Ga0207679_10048390 Ga0207679_100483902 160
204 3300025945 Ga0207679_10275622 Ga0207679_102756222 160
205 3300025945 Ga0207679_10624806 Ga0207679_106248061 160
206 3300025949 Ga0207667_10006933 Ga0207667_100069334 160
207 3300025949 Ga0207667_10033992 Ga0207667_100339924 160
208 3300025949 Ga0207667_10182339 Ga0207667_101823392 160
209 3300025949 Ga0207667_10850036 Ga0207667_108500362 160
210 3300025960 Ga0207651_10186576 Ga0207651_101865762 160
211 3300025981 Ga0207640_10072020 Ga0207640_100720204 160
212 3300025981 Ga0207640_10519984 Ga0207640_105199842 160
213 3300025986 Ga0207658_10041302 Ga0207658_100413024 160
214 3300025986 Ga0207658_10165988 Ga0207658_101659883 160
215 3300026023 Ga0207677_11642708 Ga0207677_116427081 160
216 3300026041 Ga0207639_10000532 Ga0207639_100005327 160
217 3300026041 Ga0207639_10000990 Ga0207639_1000099016 160
218 3300026041 Ga0207639_10135184 Ga0207639_101351841 160
219 3300026041 Ga0207639_10186040 Ga0207639_101860401 160
220 3300026067 Ga0207678_10004245 Ga0207678_100042455 160
221 3300026067 Ga0207678_10021992 Ga0207678_100219928 160
222 3300026067 Ga0207678_10236364 Ga0207678_102363642 160
223 3300026078 Ga0207702_10001280 Ga0207702_1000128025 160
224 3300026078 Ga0207702_10372990 Ga0207702_103729902 160
225 3300026078 Ga0207702_10528115 Ga0207702_105281152 160
226 3300026089 Ga0207648_10000889 Ga0207648_1000088918 160
227 3300026095 Ga0207676_10061178 Ga0207676_100611782 160
228 3300026095 Ga0207676_10183631 Ga0207676_101836312 160
229 3300026095 Ga0207676_10304439 Ga0207676_103044392 160
230 3300026116 Ga0207674_10010822 Ga0207674_1001082210 160
231 3300026116 Ga0207674_10121138 Ga0207674_101211382 160
232 3300026116 Ga0207674_10550282 Ga0207674_105502822 160
233 3300026118 Ga0207675_100932222 Ga0207675_1009322222 160
234 3300026121 Ga0207683_10034550 Ga0207683_100345502 160
235 3300026142 Ga0207698_10000775 Ga0207698_1000077514 160
236 3300026142 Ga0207698_10010944 Ga0207698_100109444 160
237 3300026142 Ga0207698_10110890 Ga0207698_101108904 160
238 3300028379 Ga0268266_10039465 Ga0268266_100394652 160
239 3300028380 Ga0268265_10070203 Ga0268265_100702035 160
240 3300028381 Ga0268264_10339277 Ga0268264_103392772 160
241 3300031995 Ga0307409_100523977 Ga0307409_1005239771 160
242 3300034820 Ga0373959_0118990 Ga0373959_0118990_102_584 160
243 3300035092 Ga0373952_0099335 Ga0373952_0099335_103_585 160
244 3300035118 Ga0373954_0115725 Ga0373954_0115725_95_580 160
245 3300035119 Ga0373956_0290876 Ga0373956_0290876_24_509 160
246 3300035172 Ga0373955_0017213 Ga0373955_0017213_222_707 160
247 3300035241 Ga0373961_0061271 Ga0373961_0061271_594_1076 160
248 3300035692 Ga0373935_0045407 Ga0373935_0045407_280_783 160
249 3300035724 Ga0373933_0181243 Ga0373933_0181243_60_545 160
250 3300036401 Ga0373937_0135269 Ga0373937_0135269_1069_1554 160
251 3300037312 Ga0395899_0012482 Ga0395899_0012482_5685_6173 160
252 3300037312 Ga0395899_0049824 Ga0395899_0049824_196_684 160
253 3300037312 Ga0395899_0096601 Ga0395899_0096601_1301_1831 160
254 3300037418 Ga0395900_0008516 Ga0395900_0008516_66_566 160
255 3300037418 Ga0395900_0039261 Ga0395900_0039261_2847_3377 160
256 3300037418 Ga0395900_0056637 Ga0395900_0056637_2293_2784 160
257 3300037418 Ga0395900_0079083 Ga0395900_0079083_1081_1629 160
258 3300037418 Ga0395900_0193526 Ga0395900_0193526_160_648 160
259 3300037418 Ga0395900_0398293 Ga0395900_0398293_386_871 160
260 3300037418 Ga0395900_0791709 Ga0395900_0791709_197_685 160
261 3300037418 Ga0395900_1205330 Ga0395900_1205330_78_566 160
262 3300037418 Ga0395900_1261512 Ga0395900_1261512_141_626 160
263 3300037466 Ga0395898_0061307 Ga0395898_0061307_2726_3256 160
264 3300037466 Ga0395898_0093511 Ga0395898_0093511_183_674 160
265 3300037466 Ga0395898_0208314 Ga0395898_0208314_149_640 160
266 3300037466 Ga0395898_0492095 Ga0395898_0492095_263_751 160
267 3300037471 Ga0395905_0004708 Ga0395905_0004708_724_1224 160
268 3300037471 Ga0395905_0199193 Ga0395905_0199193_1160_1660 160
269 3300037471 Ga0395905_0215012 Ga0395905_0215012_87_575 160
270 3300037471 Ga0395905_0240008 Ga0395905_0240008_36_584 160
271 3300037471 Ga0395905_0290663 Ga0395905_0290663_749_1264 160
272 3300037471 Ga0395905_0369210 Ga0395905_0369210_90_599 160
273 3300037471 Ga0395905_0398246 Ga0395905_0398246_401_886 160
274 3300037471 Ga0395905_0544752 Ga0395905_0544752_347_832 160
275 3300037471 Ga0395905_0589770 Ga0395905_0589770_109_594 160
276 3300037471 Ga0395905_0781607 Ga0395905_0781607_160_648 160
277 3300038443 Ga0395901_0030623 Ga0395901_0030623_3943_4434 160
278 3300038443 Ga0395901_0131249 Ga0395901_0131249_1074_1604 160
279 3300038443 Ga0395901_0161600 Ga0395901_0161600_1093_1584 160
280 3300038443 Ga0395901_0252880 Ga0395901_0252880_117_665 160
281 3300038443 Ga0395901_0273228 Ga0395901_0273228_221_709 160
282 3300038443 Ga0395901_0361894 Ga0395901_0361894_498_980 160
283 3300044694 Ga0466963_0005175 Ga0466963_0005175_147_635 160
284 3300044694 Ga0466963_0011096 Ga0466963_0011096_2562_3047 160
285 3300044694 Ga0466963_0013204 Ga0466963_0013204_3581_4069 160
286 3300044694 Ga0466963_0017121 Ga0466963_0017121_2539_3021 160
287 3300044694 Ga0466963_0057595 Ga0466963_0057595_1740_2249 160
288 3300044694 Ga0466963_0697584 Ga0466963_0697584_71_562 160
289 3300044706 Ga0466964_0027307 Ga0466964_0027307_1414_1902 160
290 3300044706 Ga0466964_0192046 Ga0466964_0192046_456_938 160
291 3300044719 Ga0466971_0026775 Ga0466971_0026775_775_1260 160
292 3300044765 Ga0466970_0061713 Ga0466970_0061713_1105_1596 160
293 3300044842 Ga0466957_0001433 Ga0466957_0001433_829_1314 160
294 3300044842 Ga0466957_0003522 Ga0466957_0003522_1827_2411 160
295 3300044842 Ga0466957_0065666 Ga0466957_0065666_365_847 160
296 3300045049 Ga0466959_0061640 Ga0466959_0061640_1919_2410 160
297 3300045836 Ga0466958_0019234 Ga0466958_0019234_2521_3006 160
298 3300045836 Ga0466958_0207650 Ga0466958_0207650_217_708 160
299 3300045836 Ga0466958_0228204 Ga0466958_0228204_143_625 160
300 3300045976 Ga0466967_0003642 Ga0466967_0003642_4367_4852 160
301 3300045976 Ga0466967_0013752 Ga0466967_0013752_1380_1868 160
302 3300045976 Ga0466967_0048533 Ga0466967_0048533_751_1236 160
303 3300045976 Ga0466967_0059622 Ga0466967_0059622_1846_2355 160
304 3300045976 Ga0466967_0123824 Ga0466967_0123824_488_970 160
305 3300045976 Ga0466967_0256471 Ga0466967_0256471_451_933 160
306 3300045976 Ga0466967_0512548 Ga0466967_0512548_382_873 160
307 3300045976 Ga0466967_0683575 Ga0466967_0683575_455_943 160
308 3300045976 Ga0466967_0975734 Ga0466967_0975734_245_733 160
309 3300046524 Ga0495648_0102722 Ga0495648_0102722_536_1039 160
310 3300046539 Ga0495621_0054560 Ga0495621_0054560_661_1152 160
311 3300046684 Ga0495669_0020437 Ga0495669_0020437_545_1030 160
312 3300048088 Ga0495602_0103778 Ga0495602_0103778_771_1256 160
313 3300048903 Ga0496100_0111428 Ga0496100_0111428_105_590 160
314 3300048904 Ga0496101_0311027 Ga0496101_0311027_696_1178 160
315 3300048905 Ga0496102_0180636 Ga0496102_0180636_566_1066 160
316 3300048906 Ga0496103_0169322 Ga0496103_0169322_490_990 160
317 3300048907 Ga0496104_0026150 Ga0496104_0026150_364_849 160
318 3300048908 Ga0496105_0132343 Ga0496105_0132343_379_864 160
319 3300048909 Ga0496106_0125869 Ga0496106_0125869_1487_1969 160
320 3300048909 Ga0496106_0745765 Ga0496106_0745765_22_504 160
321 3300048910 Ga0496107_0102720 Ga0496107_0102720_1240_1722 160
322 3300048911 Ga0496108_0339468 Ga0496108_0339468_517_1002 160
323 3300048912 Ga0496109_0052852 Ga0496109_0052852_853_1335 160
324 3300048912 Ga0496109_0265042 Ga0496109_0265042_778_1263 160
325 3300048913 Ga0496110_0008265 Ga0496110_0008265_2104_2586 160
326 3300048913 Ga0496110_0031776 Ga0496110_0031776_2284_2769 160
327 3300048914 Ga0496111_0035600 Ga0496111_0035600_364_849 160
328 3300048914 Ga0496111_0051086 Ga0496111_0051086_259_741 160
329 3300048915 Ga0496112_0045434 Ga0496112_0045434_2711_3196 160
330 3300048915 Ga0496112_0090688 Ga0496112_0090688_2014_2496 160
331 3300048915 Ga0496112_1187651 Ga0496112_1187651_25_510 160
332 3300048916 Ga0496113_0015623 Ga0496113_0015623_265_747 160
333 3300048916 Ga0496113_0541950 Ga0496113_0541950_363_848 160
334 3300048919 Ga0496116_0308784 Ga0496116_0308784_93_590 160
335 3300048925 Ga0496122_0099045 Ga0496122_0099045_1387_1884 160
336 3300048926 Ga0496123_0004066 Ga0496123_0004066_11952_12449 160
337 3300048926 Ga0496123_0023495 Ga0496123_0023495_1769_2266 160
338 3300048927 Ga0496124_0003359 Ga0496124_0003359_9874_10371 160
339 3300048927 Ga0496124_0008319 Ga0496124_0008319_4618_5115 160
340 3300048928 Ga0496125_0284459 Ga0496125_0284459_510_1007 160
341 3300048929 Ga0496126_0937682 Ga0496126_0937682_127_624 160
342 3300049583 Ga0501067_0302971 Ga0501067_0302971_40_522 160
343 3300061719 Ga0466962_0029172 Ga0466962_0029172_1130_1615 160
344 3300061719 Ga0466962_0037133 Ga0466962_0037133_51_542 160
345 3300061719 Ga0466962_0249486 Ga0466962_0249486_302_790 160
346 iso_pu_bacteria 2599185359 2600226699 160
347 iso_pu_bacteria 2818991466 2819712328 160
348 iso_pu_bacteria 2928526807 2928526841 160
349 iso_pu_bacteria 2928968154 2928969608 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

89

161

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

29

153

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

63

155

0.81

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

47

166

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fyn-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 0.8612 7 160
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8506 5 152
8a9o-assembly1.cif.gz_B structure of the polyamine acetyltransferase dpa 0.8501 5 152
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8497 56 160
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8467 54 160
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9262 111 160 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8904 94 160 3.40.630.30
af_Q4DGZ6_132_293_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8776 69 160 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8633 4 152 3.40.630.30
af_Q5AMM9_17_172_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8605 69 160 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Y5QWP4-F1-model_v4 GNAT family N-acetyltransferase 0.9539 3 95 GO:0016740
AF-A0A4Q5R6W4-F1-model_v4 GNAT family N-acetyltransferase 0.9515 19 109 GO:0016747
AF-A0A538SFI9-F1-model_v4 GNAT family N-acetyltransferase 0.951 3 127 GO:0016747
AF-A0A538SFI9-F1-model_v4 GNAT family N-acetyltransferase 0.9364 3 127 GO:0016747
AF-S3HSK1-F1-model_v4 Acetyltransferase 0.932 3 160 GO:0016747

Feature Viewer

pLDDT pTM Quality
90.19 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map