F417977

General Info

Members Datasets Scaffolds Average Seq Length
349 188 349 262

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_031338|Ga0439432_031338_65_958
Length 297
Sequence MTKELTELAVTAARKITFEPEVRGGKKIDLSRVVLYLYSWEFGGWKIPALSNAPRKEIIADDPKAEAILQKAVQNLGGEKYLNVKSQIGRGKYSILKDGTVLSFQTFVDVIVYPDKERTDFKAGGIKSIQTNVGNTGWVFDGDQELVKVQDEKQIENFKRGIRTSLDYLLRGHWRGEAELAYLGKRPATLGKRNEVVKVTYKDGLVVEYEFAAEDGLPQKGSYTRLNADNEEIKEEDRYAQFVDVGGIKAPFIIDRFTGGVQSSRINYQTVEYNKTIPDSIFEKPANAKDAKKDLKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
175 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_430414 2162886007 Bacteria 1735
2 SwRhRL2b_contig_601517 2162886007 Bacteria 2618
3 MBSR1b_contig_12639720 2162886012 Bacteria 1292
4 CNAas_1000081 3300000532 Bacteria 7210
5 JGI24751J29686_10000104 3300002459 Bacteria 46525
6 Ga0065704_10102469 3300005289 Bacteria 2204
7 Ga0065712_10067727 3300005290 Bacteria 189643
8 Ga0065712_10073325 3300005290 Bacteria 4414
9 Ga0065712_10093106 3300005290 Bacteria 2305
10 Ga0065712_10131065 3300005290 Unclassified 1505
11 Ga0065715_10027809 3300005293 Bacteria 1741
12 Ga0065715_10088941 3300005293 Bacteria 22679
13 Ga0065707_10001705 3300005295 Bacteria 5847
14 Ga0065707_10107852 3300005295 Bacteria 2536
15 Ga0070690_100141926 3300005330 Bacteria 1631
16 Ga0070670_100000159 3300005331 Bacteria 61313
17 Ga0070670_100032155 3300005331 Bacteria 4519
18 Ga0068869_100010896 3300005334 Bacteria 5947
19 Ga0068869_100090435 3300005334 Bacteria 2301
20 Ga0068869_100170193 3300005334 Bacteria 1701
21 Ga0068869_100318927 3300005334 Unclassified 1260
22 Ga0068869_100444220 3300005334 Bacteria 1074
23 Ga0070666_10018376 3300005335 Bacteria 4494
24 Ga0070682_100376864 3300005337 Unclassified 1066
25 Ga0068868_100286014 3300005338 Bacteria 1397
26 Ga0070660_100079659 3300005339 Bacteria 2570
27 Ga0070689_100041414 3300005340 Bacteria 3536
28 Ga0070689_100063938 3300005340 Bacteria 2863
29 Ga0070689_100140024 3300005340 Bacteria 1945
30 Ga0070687_100000359 3300005343 Bacteria 15542
31 Ga0070687_100029355 3300005343 Bacteria 2677
32 Ga0070661_100023570 3300005344 Bacteria 4413
33 Ga0070692_10013636 3300005345 Bacteria 3793
34 Ga0070692_10013754 3300005345 Bacteria 3781
35 Ga0070692_10222799 3300005345 Bacteria 1116
36 Ga0070692_10302967 3300005345 Unclassified 976
37 Ga0070669_100083569 3300005353 Bacteria 2381
38 Ga0070669_100230061 3300005353 Unclassified 1469
39 Ga0070675_100071040 3300005354 Bacteria 2887
40 Ga0070671_100013133 3300005355 Bacteria 6672
41 Ga0070671_100441283 3300005355 Bacteria 1116
42 Ga0070674_100125841 3300005356 Bacteria 1903
43 Ga0070673_100110449 3300005364 Bacteria 2279
44 Ga0070673_100473374 3300005364 Bacteria 1130
45 Ga0070688_100074727 3300005365 Bacteria 2177
46 Ga0070659_100023578 3300005366 Bacteria 4711
47 Ga0070667_100160821 3300005367 Bacteria 1978
48 Ga0070701_10091324 3300005438 Bacteria 1669
49 Ga0070701_10102321 3300005438 Bacteria 1589
50 Ga0070705_100029723 3300005440 Bacteria 3010
51 Ga0070700_100096489 3300005441 Bacteria 1940
52 Ga0070694_100049273 3300005444 Bacteria 2836
53 Ga0070694_100073199 3300005444 Unclassified 2366
54 Ga0070694_100160581 3300005444 Bacteria 1649
55 Ga0070663_100058043 3300005455 Bacteria 2778
56 Ga0070663_100691108 3300005455 Unclassified 866
57 Ga0070678_100062524 3300005456 Bacteria 2750
58 Ga0070681_10000735 3300005458 Bacteria 27091
59 Ga0068867_100110299 3300005459 Bacteria 2113
60 Ga0070685_10102421 3300005466 Bacteria 1750
61 Ga0070685_10337440 3300005466 Unclassified 1027
62 Ga0070706_100026145 3300005467 Bacteria 5371
63 Ga0070707_100003440 3300005468 Bacteria 14965
64 Ga0070698_100002269 3300005471 Bacteria 21280
65 Ga0070698_100005557 3300005471 Bacteria 13783
66 Ga0070698_100213441 3300005471 Bacteria 1864
67 Ga0070699_100001322 3300005518 Bacteria 22849
68 Ga0070679_100052342 3300005530 Bacteria 4068
69 Ga0070697_100000100 3300005536 Bacteria 70649
70 Ga0070697_100001747 3300005536 Bacteria 16569
71 Ga0070697_100049882 3300005536 Bacteria 3397
72 Ga0070697_100131950 3300005536 Bacteria 2096
73 Ga0068853_100267981 3300005539 Bacteria 1572
74 Ga0070672_100255242 3300005543 Bacteria 1477
75 Ga0070672_100460810 3300005543 Bacteria 1096
76 Ga0070686_100001464 3300005544 Bacteria 13332
77 Ga0070686_100007743 3300005544 Bacteria 6005
78 Ga0070686_100049383 3300005544 Bacteria 2669
79 Ga0070695_100147908 3300005545 Bacteria 1636
80 Ga0070696_100014548 3300005546 Bacteria 5281
81 Ga0070696_100052526 3300005546 Bacteria 2835
82 Ga0070693_100096858 3300005547 Bacteria 1789
83 Ga0070704_100007476 3300005549 Bacteria 6504
84 Ga0070704_100076664 3300005549 Bacteria 2446
85 Ga0068855_100336522 3300005563 Bacteria 1665
86 Ga0068855_100394743 3300005563 Bacteria 1517
87 Ga0070664_100002661 3300005564 Bacteria 14406
88 Ga0068857_100000175 3300005577 Bacteria 40688
89 Ga0068857_100388553 3300005577 Bacteria 1297
90 Ga0068854_100052449 3300005578 Bacteria 2925
91 Ga0068854_100348920 3300005578 Bacteria 1211
92 Ga0070702_100117117 3300005615 Bacteria 1662
93 Ga0068859_100056357 3300005617 Bacteria 3955
94 Ga0068859_100092988 3300005617 Bacteria 3067
95 Ga0068859_100332101 3300005617 Bacteria 1614
96 Ga0068859_100406450 3300005617 Bacteria 1457
97 Ga0068859_100482276 3300005617 Bacteria 1335
98 Ga0068864_100029987 3300005618 Bacteria 4610
99 Ga0068864_100069541 3300005618 Bacteria 3061
100 Ga0068864_100207884 3300005618 Bacteria 1801
101 Ga0068866_10000940 3300005718 Bacteria 12794
102 Ga0068861_100036866 3300005719 Unclassified 3632
103 Ga0068861_100051336 3300005719 Bacteria 3130
104 Ga0068861_100175175 3300005719 Bacteria 1781
105 Ga0068870_10032768 3300005840 Bacteria 2646
106 Ga0068870_10050113 3300005840 Bacteria 2205
107 Ga0068870_10232095 3300005840 Bacteria 1135
108 Ga0068863_100061956 3300005841 Bacteria 3537
109 Ga0068863_100096647 3300005841 Unclassified 2804
110 Ga0068863_100437016 3300005841 Bacteria 1283
111 Ga0068863_100658664 3300005841 Bacteria 1039
112 Ga0068858_100167707 3300005842 Bacteria 2069
113 Ga0068860_100056761 3300005843 Bacteria 3721
114 Ga0068860_100082098 3300005843 Bacteria 3066
115 Ga0068860_100246453 3300005843 Bacteria 1739
116 Ga0068860_100400729 3300005843 Bacteria 1357
117 Ga0068860_100711955 3300005843 Bacteria 1014
118 Ga0068862_100043798 3300005844 Bacteria 3815
119 Ga0068862_100174778 3300005844 Unclassified 1925
120 Ga0068862_100185427 3300005844 Unclassified 1869
121 Ga0068862_100480039 3300005844 Bacteria 1176
122 Ga0097621_100019625 3300006237 Bacteria 5193
123 Ga0097621_100051743 3300006237 Unclassified 3344
124 Ga0068871_100037891 3300006358 Bacteria 3847
125 Ga0068871_100095105 3300006358 Bacteria 2487
126 Ga0068871_100117672 3300006358 Bacteria 2241
127 Ga0075428_100356644 3300006844 Bacteria 1569
128 Ga0075430_100047167 3300006846 Bacteria 3637
129 Ga0075431_100271470 3300006847 Bacteria 1718
130 Ga0075433_10043577 3300006852 Bacteria 3896
131 Ga0075433_10050157 3300006852 Bacteria 3633
132 Ga0075434_100048125 3300006871 Bacteria 4231
133 Ga0068865_100317670 3300006881 Bacteria 1252
134 Ga0097620_100056355 3300006931 Bacteria 3955
135 Ga0097620_100092988 3300006931 Bacteria 3067
136 Ga0097620_100332134 3300006931 Bacteria 1614
137 Ga0097620_100406428 3300006931 Bacteria 1457
138 Ga0097620_100482243 3300006931 Bacteria 1335
139 Ga0105250_10048113 3300009092 Unclassified 1711
140 Ga0111539_10018183 3300009094 Bacteria 8707
141 Ga0111539_10023858 3300009094 Bacteria 7514
142 Ga0111539_10109284 3300009094 Bacteria 3245
143 Ga0105245_10103011 3300009098 Bacteria 2644
144 Ga0105247_10002148 3300009101 Bacteria 13615
145 Ga0105247_10096547 3300009101 Bacteria 1884
146 Ga0114129_10095031 3300009147 Bacteria 4128
147 Ga0114129_10161638 3300009147 Bacteria 3059
148 Ga0114129_10548052 3300009147 Bacteria 1504
149 Ga0114129_10558952 3300009147 Bacteria 1487
150 Ga0114129_10960265 3300009147 Bacteria 1079
151 Ga0105243_10011599 3300009148 Bacteria 6667
152 Ga0105243_10017018 3300009148 Bacteria 5496
153 Ga0105243_10291273 3300009148 Bacteria 1475
154 Ga0105243_10780382 3300009148 Bacteria 940
155 Ga0105241_10150088 3300009174 Bacteria 1906
156 Ga0105241_10231750 3300009174 Unclassified 1557
157 Ga0105242_10022083 3300009176 Bacteria 5000
158 Ga0105242_10299477 3300009176 Bacteria 1467
159 Ga0105248_10018023 3300009177 Bacteria 7794
160 Ga0105248_10028386 3300009177 Bacteria 6234
161 Ga0105248_10218093 3300009177 Bacteria 2148
162 Ga0105248_10300067 3300009177 Bacteria 1809
163 Ga0105248_10542258 3300009177 Unclassified 1312
164 Ga0105237_10707407 3300009545 Bacteria 1014
165 Ga0105238_10063627 3300009551 Bacteria 3689
166 Ga0105249_10002693 3300009553 Bacteria 15358
167 Ga0105249_10025733 3300009553 Bacteria 5299
168 Ga0105249_10084858 3300009553 Bacteria 2950
169 Ga0105249_10188341 3300009553 Bacteria 2012
170 Ga0105249_10281232 3300009553 Bacteria 1662
171 Ga0105246_10124633 3300011119 Bacteria 1915
172 Ga0157373_10015823 3300013100 Bacteria 5507
173 Ga0157373_10043677 3300013100 Bacteria 3201
174 Ga0157378_10008848 3300013297 Bacteria 8760
175 Ga0157378_10030413 3300013297 Unclassified 4772
176 Ga0163162_10026985 3300013306 Bacteria 5679
177 Ga0163162_10035910 3300013306 Bacteria 4938
178 Ga0163162_10099893 3300013306 Bacteria 2993
179 Ga0163162_10428864 3300013306 Unclassified 1454
180 Ga0163162_10499849 3300013306 Bacteria 1346
181 Ga0157372_10554786 3300013307 Bacteria 1339
182 Ga0157375_10118692 3300013308 Bacteria 2752
183 Ga0157375_10119112 3300013308 Bacteria 2747
184 Ga0163163_10002062 3300014325 Bacteria 16976
185 Ga0163163_10020621 3300014325 Bacteria 6212
186 Ga0163163_10033718 3300014325 Bacteria 4955
187 Ga0163163_10069657 3300014325 Bacteria 3502
188 Ga0163163_10092605 3300014325 Bacteria 3038
189 Ga0163163_10339779 3300014325 Bacteria 1557
190 Ga0163163_10485778 3300014325 Bacteria 1296
191 Ga0163163_10603474 3300014325 Bacteria 1161
192 Ga0157380_10005925 3300014326 Bacteria 8552
193 Ga0157380_10039150 3300014326 Bacteria 3685
194 Ga0157380_10571634 3300014326 Bacteria 1113
195 Ga0157380_10676274 3300014326 Unclassified 1033
196 Ga0157377_10010688 3300014745 Bacteria 4551
197 Ga0157379_10074637 3300014968 Unclassified 3036
198 Ga0157379_10199046 3300014968 Bacteria 1811
199 Ga0157376_10095771 3300014969 Bacteria 2582
200 Ga0157376_10248185 3300014969 Bacteria 1661
201 Ga0163161_10003967 3300017792 Bacteria 10376
202 Ga0163161_10312094 3300017792 Unclassified 1241
203 Ga0207710_10000680 3300025900 Bacteria 19152
204 Ga0207710_10003417 3300025900 Bacteria 7093
205 Ga0207680_10054747 3300025903 Bacteria 2401
206 Ga0207643_10010664 3300025908 Bacteria 4953
207 Ga0207643_10178075 3300025908 Unclassified 1286
208 Ga0207684_10007053 3300025910 Bacteria 10163
209 Ga0207684_10011160 3300025910 Bacteria 7865
210 Ga0207684_10021961 3300025910 Bacteria 5450
211 Ga0207684_10039388 3300025910 Bacteria 4009
212 Ga0207654_10058149 3300025911 Bacteria 2250
213 Ga0207707_10105247 3300025912 Bacteria 2466
214 Ga0207660_10090191 3300025917 Bacteria 2271
215 Ga0207662_10005948 3300025918 Bacteria 6553
216 Ga0207662_10006269 3300025918 Bacteria 6408
217 Ga0207657_10098545 3300025919 Bacteria 2429
218 Ga0207649_10186337 3300025920 Unclassified 1456
219 Ga0207652_10042215 3300025921 Bacteria 3881
220 Ga0207646_10048787 3300025922 Unclassified 3794
221 Ga0207646_10104709 3300025922 Bacteria 2537
222 Ga0207681_10014432 3300025923 Bacteria 4910
223 Ga0207681_10017947 3300025923 Bacteria 4450
224 Ga0207694_10041593 3300025924 Bacteria 3542
225 Ga0207650_10000007 3300025925 Bacteria 530810
226 Ga0207650_10180984 3300025925 Unclassified 1679
227 Ga0207650_10350595 3300025925 Bacteria 1214
228 Ga0207650_10614700 3300025925 Bacteria 914
229 Ga0207659_10182316 3300025926 Bacteria 1664
230 Ga0207687_10106664 3300025927 Bacteria 2071
231 Ga0207687_10468552 3300025927 Bacteria 1047
232 Ga0207690_10088455 3300025932 Bacteria 2182
233 Ga0207706_10117192 3300025933 Bacteria 2342
234 Ga0207686_10030583 3300025934 Bacteria 3189
235 Ga0207686_10035599 3300025934 Bacteria 2990
236 Ga0207709_10030610 3300025935 Bacteria 3132
237 Ga0207670_10115417 3300025936 Bacteria 1942
238 Ga0207670_10197930 3300025936 Unclassified 1525
239 Ga0207670_10226102 3300025936 Bacteria 1435
240 Ga0207670_10422904 3300025936 Unclassified 1069
241 Ga0207669_10052881 3300025937 Bacteria 2443
242 Ga0207704_10042650 3300025938 Bacteria 2672
243 Ga0207704_10145388 3300025938 Bacteria 1665
244 Ga0207665_10052769 3300025939 Bacteria 2739
245 Ga0207691_10013297 3300025940 Bacteria 7885
246 Ga0207711_10141757 3300025941 Bacteria 2163
247 Ga0207711_10146257 3300025941 Bacteria 2130
248 Ga0207711_10267435 3300025941 Bacteria 1572
249 Ga0207689_10000395 3300025942 Bacteria 40984
250 Ga0207689_10008000 3300025942 Bacteria 9232
251 Ga0207689_10020516 3300025942 Bacteria 5561
252 Ga0207689_10070385 3300025942 Bacteria 2874
253 Ga0207679_10182986 3300025945 Bacteria 1735
254 Ga0207667_10250947 3300025949 Bacteria 1810
255 Ga0207712_10006494 3300025961 Bacteria 7374
256 Ga0207712_10091608 3300025961 Bacteria 2240
257 Ga0207712_10214900 3300025961 Bacteria 1534
258 Ga0207640_10047866 3300025981 Bacteria 2761
259 Ga0207640_10224714 3300025981 Bacteria 1440
260 Ga0207640_10295652 3300025981 Bacteria 1279
261 Ga0207658_10112373 3300025986 Bacteria 2156
262 Ga0207703_10102171 3300026035 Bacteria 2432
263 Ga0207703_10487768 3300026035 Bacteria 1155
264 Ga0207639_10168649 3300026041 Unclassified 1852
265 Ga0207678_10195848 3300026067 Unclassified 1727
266 Ga0207708_10052446 3300026075 Bacteria 3107
267 Ga0207708_10133237 3300026075 Bacteria 1944
268 Ga0207708_10325546 3300026075 Unclassified 1255
269 Ga0207641_10223656 3300026088 Bacteria 1747
270 Ga0207641_10696641 3300026088 Bacteria 1000
271 Ga0207648_10007085 3300026089 Bacteria 11066
272 Ga0207648_10448532 3300026089 Bacteria 1174
273 Ga0207676_10036300 3300026095 Bacteria 3748
274 Ga0207676_10195202 3300026095 Bacteria 1784
275 Ga0207676_10207711 3300026095 Bacteria 1735
276 Ga0207676_10371885 3300026095 Bacteria 1328
277 Ga0207674_10000472 3300026116 Bacteria 52784
278 Ga0207674_10090040 3300026116 Bacteria 3060
279 Ga0207674_10199525 3300026116 Bacteria 1950
280 Ga0207674_10413812 3300026116 Bacteria 1303
281 Ga0207675_100002984 3300026118 Bacteria 16627
282 Ga0207675_100009005 3300026118 Bacteria 9365
283 Ga0207675_100097714 3300026118 Bacteria 2765
284 Ga0207675_100122871 3300026118 Bacteria 2458
285 Ga0207683_10047390 3300026121 Bacteria 3764
286 Ga0207683_10051279 3300026121 Bacteria 3615
287 Ga0268265_10318175 3300028380 Bacteria 1408
288 Ga0268264_10011983 3300028381 Bacteria 7140
289 Ga0268264_10337498 3300028381 Unclassified 1430
290 Ga0268264_10513863 3300028381 Bacteria 1170
291 Ga0268264_10662922 3300028381 Unclassified 1033
292 Ga0314311_1173195 3300030733 Unclassified 924
293 Ga0307408_100210173 3300031548 Bacteria 1581
294 Ga0307405_10051945 3300031731 Bacteria 2546
295 Ga0307406_10007128 3300031901 Bacteria 6190
296 Ga0307407_10019729 3300031903 Unclassified 3439
297 Ga0307412_10282830 3300031911 Bacteria 1303
298 Ga0307409_100017950 3300031995 Bacteria 4735
299 Ga0307409_100125146 3300031995 Bacteria 2185
300 Ga0307409_100221957 3300031995 Bacteria 1707
301 Ga0307414_10070726 3300032004 Bacteria 2514
302 Ga0307411_10022017 3300032005 Unclassified 3744
303 Ga0307411_10186694 3300032005 Bacteria 1579
304 Ga0307415_100328890 3300032126 Bacteria 1278
305 Ga0373951_0035247 3300035091 Unclassified 1191
306 Ga0373942_0007902 3300035207 Bacteria 2472
307 Ga0395905_0158745 3300037471 Bacteria 2126
308 Ga0242419_005826 3300038698 Bacteria 884
309 Ga0439448_0002306 3300042005 Bacteria 5165
310 Ga0439432_031338 3300042006 Bacteria 1720
311 Ga0439455_0006515 3300042012 Bacteria 2429
312 Ga0451576_0312512 3300045051 Bacteria 1644
313 Ga0495663_0000092 3300046525 Bacteria 39532
314 Ga0495598_0000125 3300046537 Bacteria 12958
315 Ga0495621_0000129 3300046539 Bacteria 15996
316 Ga0495621_0001547 3300046539 Bacteria 5990
317 Ga0496102_0421054 3300048905 Bacteria 1254
318 Ga0496104_0404739 3300048907 Bacteria 1277
319 Ga0496106_0268774 3300048909 Bacteria 1365
320 Ga0496108_0487553 3300048911 Bacteria 1077
321 Ga0496110_0194460 3300048913 Bacteria 1842
322 Ga0496113_0271432 3300048916 Bacteria 1356
323 Ga0501291_002112 3300049514 Bacteria 2355
324 Ga0501292_005809 3300049515 Bacteria 1734
325 Ga0501298_018229 3300049521 Bacteria 1289
326 Ga0501072_0010483 3300049588 Bacteria 7060
327 Ga0501076_0227456 3300049592 Bacteria 1525
328 Ga0501198_005543 3300049649 Unclassified 1780
329 Ga0501202_016402 3300049652 Bacteria 1437
330 Ga0501217_002274 3300049661 Bacteria 3753
331 Ga0501227_054407 3300049665 Unclassified 1015
332 Ga0501235_005423 3300049669 Bacteria 2778
333 Ga0501249_009948 3300049679 Bacteria 1982
334 Ga0501257_020389 3300049686 Bacteria 1556
335 Ga0501260_004996 3300049689 Bacteria 1237
336 Ga0501221_007391 3300049704 Bacteria 1884
337 Ga0501229_007554 3300049706 Bacteria 1354
338 nmdc:mga05p37_23197_c1 3300050507 Bacteria 7528
339 nmdc:mga05p37_812034_c1 3300050507 Bacteria 1021
340 nmdc:mga06r32_101051_c1 3300050510 Bacteria 2830
341 nmdc:mga08y16_14012_c1 3300050511 Bacteria 8438
342 nmdc:mga08y16_43374_c1 3300050511 Bacteria 4713
343 nmdc:mga08y16_69058_c1 3300050511 Bacteria 3684
344 nmdc:mga0n895_154731_c1 3300050512 Bacteria 2323
345 nmdc:mga0n895_306099_c1 3300050512 Bacteria 1611
346 nmdc:mga0a205_152279_c1 3300050515 Bacteria 2212
347 nmdc:mga0a205_27607_c1 3300050515 Bacteria 5421
348 nmdc:mga0a205_30558_c1 3300050515 Bacteria 5159
349 nmdc:mga0a205_439205_c1 3300050515 Bacteria 1166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10070385 Ga0207689_100703853 230
2 3300038698 Ga0242419_005826 Ga0242419_005826_128_850 237
3 3300025925 Ga0207650_10614700 Ga0207650_106147001 239
4 3300005295 Ga0065707_10107852 Ga0065707_101078522 240
5 3300005334 Ga0068869_100090435 Ga0068869_1000904352 240
6 3300005345 Ga0070692_10013754 Ga0070692_100137542 240
7 3300009174 Ga0105241_10231750 Ga0105241_102317502 240
8 3300013100 Ga0157373_10015823 Ga0157373_100158233 240
9 3300013306 Ga0163162_10026985 Ga0163162_100269853 240
10 3300050515 nmdc:mga0a205_439205_c1 nmdc:mga0a205_439205_c1_306_1088 241
11 3300049686 Ga0501257_020389 Ga0501257_020389_723_1466 242
12 3300050512 nmdc:mga0n895_154731_c1 nmdc:mga0n895_154731_c1_1465_2256 242
13 3300006852 Ga0075433_10050157 Ga0075433_100501571 243
14 3300050515 nmdc:mga0a205_30558_c1 nmdc:mga0a205_30558_c1_822_1613 243
15 3300005334 Ga0068869_100170193 Ga0068869_1001701932 245
16 3300005335 Ga0070666_10018376 Ga0070666_100183764 245
17 3300005340 Ga0070689_100063938 Ga0070689_1000639382 245
18 3300005343 Ga0070687_100029355 Ga0070687_1000293552 245
19 3300005355 Ga0070671_100013133 Ga0070671_1000131332 245
20 3300005356 Ga0070674_100125841 Ga0070674_1001258412 245
21 3300005364 Ga0070673_100110449 Ga0070673_1001104492 245
22 3300005365 Ga0070688_100074727 Ga0070688_1000747272 245
23 3300005367 Ga0070667_100160821 Ga0070667_1001608212 245
24 3300005440 Ga0070705_100029723 Ga0070705_1000297232 245
25 3300005441 Ga0070700_100096489 Ga0070700_1000964892 245
26 3300005459 Ga0068867_100110299 Ga0068867_1001102991 245
27 3300005466 Ga0070685_10102421 Ga0070685_101024212 245
28 3300005544 Ga0070686_100007743 Ga0070686_1000077435 245
29 3300005577 Ga0068857_100388553 Ga0068857_1003885532 245
30 3300005578 Ga0068854_100052449 Ga0068854_1000524492 245
31 3300005615 Ga0070702_100117117 Ga0070702_1001171172 245
32 3300005617 Ga0068859_100482276 Ga0068859_1004822762 245
33 3300005718 Ga0068866_10000940 Ga0068866_100009407 245
34 3300005840 Ga0068870_10032768 Ga0068870_100327682 245
35 3300005841 Ga0068863_100061956 Ga0068863_1000619562 245
36 3300006237 Ga0097621_100019625 Ga0097621_1000196253 245
37 3300006358 Ga0068871_100037891 Ga0068871_1000378915 245
38 3300006881 Ga0068865_100317670 Ga0068865_1003176702 245
39 3300006931 Ga0097620_100482243 Ga0097620_1004822432 245
40 3300009098 Ga0105245_10103011 Ga0105245_101030112 245
41 3300009148 Ga0105243_10011599 Ga0105243_100115993 245
42 3300009176 Ga0105242_10022083 Ga0105242_100220832 245
43 3300009177 Ga0105248_10018023 Ga0105248_100180233 245
44 3300011119 Ga0105246_10124633 Ga0105246_101246332 245
45 3300013297 Ga0157378_10008848 Ga0157378_100088483 245
46 3300014325 Ga0163163_10603474 Ga0163163_106034741 245
47 3300014326 Ga0157380_10039150 Ga0157380_100391504 245
48 3300014969 Ga0157376_10095771 Ga0157376_100957713 245
49 3300017792 Ga0163161_10003967 Ga0163161_100039672 245
50 3300025903 Ga0207680_10054747 Ga0207680_100547472 245
51 3300025908 Ga0207643_10010664 Ga0207643_100106644 245
52 3300025927 Ga0207687_10106664 Ga0207687_101066642 245
53 3300025934 Ga0207686_10030583 Ga0207686_100305832 245
54 3300025936 Ga0207670_10115417 Ga0207670_101154171 245
55 3300025937 Ga0207669_10052881 Ga0207669_100528812 245
56 3300025940 Ga0207691_10013297 Ga0207691_100132974 245
57 3300025941 Ga0207711_10141757 Ga0207711_101417572 245
58 3300025942 Ga0207689_10000395 Ga0207689_100003954 245
59 3300025981 Ga0207640_10047866 Ga0207640_100478662 245
60 3300025986 Ga0207658_10112373 Ga0207658_101123732 245
61 3300026035 Ga0207703_10487768 Ga0207703_104877681 245
62 3300026075 Ga0207708_10133237 Ga0207708_101332372 245
63 3300026089 Ga0207648_10007085 Ga0207648_100070852 245
64 3300026095 Ga0207676_10195202 Ga0207676_101952021 245
65 3300026116 Ga0207674_10413812 Ga0207674_104138122 245
66 3300026118 Ga0207675_100002984 Ga0207675_1000029848 245
67 3300026121 Ga0207683_10051279 Ga0207683_100512792 245
68 3300009177 Ga0105248_10300067 Ga0105248_103000672 246
69 3300014968 Ga0157379_10074637 Ga0157379_100746373 247
70 3300025927 Ga0207687_10468552 Ga0207687_104685521 247
71 3300032005 Ga0307411_10022017 Ga0307411_100220172 247
72 3300048911 Ga0496108_0487553 Ga0496108_0487553_315_1067 247
73 3300048916 Ga0496113_0271432 Ga0496113_0271432_334_1086 247
74 3300005290 Ga0065712_10073325 Ga0065712_100733251 248
75 3300005293 Ga0065715_10027809 Ga0065715_100278092 248
76 3300005543 Ga0070672_100255242 Ga0070672_1002552421 248
77 3300005844 Ga0068862_100480039 Ga0068862_1004800392 248
78 3300009545 Ga0105237_10707407 Ga0105237_107074071 248
79 3300014745 Ga0157377_10010688 Ga0157377_100106884 248
80 3300025918 Ga0207662_10005948 Ga0207662_100059485 248
81 3300025923 Ga0207681_10017947 Ga0207681_100179474 248
82 3300025926 Ga0207659_10182316 Ga0207659_101823162 248
83 3300031995 Ga0307409_100125146 Ga0307409_1001251461 248
84 3300013308 Ga0157375_10118692 Ga0157375_101186923 249
85 3300005289 Ga0065704_10102469 Ga0065704_101024692 250
86 3300031731 Ga0307405_10051945 Ga0307405_100519452 250
87 3300031901 Ga0307406_10007128 Ga0307406_100071284 250
88 3300031995 Ga0307409_100017950 Ga0307409_1000179502 250
89 3300005353 Ga0070669_100230061 Ga0070669_1002300612 251
90 3300005617 Ga0068859_100056357 Ga0068859_1000563572 251
91 3300005618 Ga0068864_100207884 Ga0068864_1002078842 251
92 3300005840 Ga0068870_10050113 Ga0068870_100501132 251
93 3300006931 Ga0097620_100056355 Ga0097620_1000563554 251
94 3300026095 Ga0207676_10207711 Ga0207676_102077112 251
95 3300005290 Ga0065712_10067727 Ga0065712_1006772714 252
96 3300005293 Ga0065715_10088941 Ga0065715_1008894114 252
97 3300013308 Ga0157375_10119112 Ga0157375_101191122 252
98 3300031911 Ga0307412_10282830 Ga0307412_102828302 252
99 3300032004 Ga0307414_10070726 Ga0307414_100707262 252
100 3300032005 Ga0307411_10186694 Ga0307411_101866942 252
101 3300032126 Ga0307415_100328890 Ga0307415_1003288901 252
102 3300048909 Ga0496106_0268774 Ga0496106_0268774_338_1105 252
103 3300002459 JGI24751J29686_10000104 JGI24751J29686_100001048 253
104 3300005331 Ga0070670_100000159 Ga0070670_1000001595 253
105 3300005338 Ga0068868_100286014 Ga0068868_1002860142 253
106 3300005547 Ga0070693_100096858 Ga0070693_1000968581 253
107 3300005549 Ga0070704_100076664 Ga0070704_1000766642 253
108 3300005617 Ga0068859_100332101 Ga0068859_1003321012 253
109 3300005719 Ga0068861_100175175 Ga0068861_1001751752 253
110 3300005840 Ga0068870_10232095 Ga0068870_102320951 253
111 3300005841 Ga0068863_100658664 Ga0068863_1006586641 253
112 3300005844 Ga0068862_100043798 Ga0068862_1000437982 253
113 3300005844 Ga0068862_100174778 Ga0068862_1001747782 253
114 3300006931 Ga0097620_100332134 Ga0097620_1003321342 253
115 3300009094 Ga0111539_10109284 Ga0111539_101092842 253
116 3300009147 Ga0114129_10161638 Ga0114129_101616382 253
117 3300009177 Ga0105248_10218093 Ga0105248_102180932 253
118 3300009553 Ga0105249_10025733 Ga0105249_100257336 253
119 3300009553 Ga0105249_10084858 Ga0105249_100848582 253
120 3300014325 Ga0163163_10002062 Ga0163163_100020627 253
121 3300014325 Ga0163163_10339779 Ga0163163_103397792 253
122 3300014326 Ga0157380_10571634 Ga0157380_105716341 253
123 3300025925 Ga0207650_10000007 Ga0207650_10000007382 253
124 3300025935 Ga0207709_10030610 Ga0207709_100306102 253
125 3300025961 Ga0207712_10091608 Ga0207712_100916082 253
126 3300026088 Ga0207641_10696641 Ga0207641_106966411 253
127 3300026118 Ga0207675_100122871 Ga0207675_1001228713 253
128 3300028380 Ga0268265_10318175 Ga0268265_103181752 253
129 3300030733 Ga0314311_1173195 Ga0314311_11731951 253
130 3300046525 Ga0495663_0000092 Ga0495663_0000092_3750_4574 253
131 3300046537 Ga0495598_0000125 Ga0495598_0000125_812_1636 253
132 3300046539 Ga0495621_0000129 Ga0495621_0000129_11117_11941 253
133 3300050511 nmdc:mga08y16_69058_c1 nmdc:mga08y16_69058_c1_992_1762 253
134 3300005843 Ga0068860_100056761 Ga0068860_1000567613 254
135 3300005844 Ga0068862_100185427 Ga0068862_1001854273 254
136 3300009092 Ga0105250_10048113 Ga0105250_100481131 254
137 3300014325 Ga0163163_10485778 Ga0163163_104857781 254
138 3300025900 Ga0207710_10003417 Ga0207710_100034173 254
139 3300025911 Ga0207654_10058149 Ga0207654_100581492 254
140 3300025922 Ga0207646_10104709 Ga0207646_101047092 254
141 3300025961 Ga0207712_10006494 Ga0207712_100064945 254
142 3300026035 Ga0207703_10102171 Ga0207703_101021712 254
143 3300028381 Ga0268264_10011983 Ga0268264_100119835 254
144 3300000532 CNAas_1000081 CNAas_10000812 255
145 3300005290 Ga0065712_10093106 Ga0065712_100931061 255
146 3300005331 Ga0070670_100032155 Ga0070670_1000321553 255
147 3300005334 Ga0068869_100318927 Ga0068869_1003189272 255
148 3300005334 Ga0068869_100444220 Ga0068869_1004442202 255
149 3300005345 Ga0070692_10013636 Ga0070692_100136364 255
150 3300005364 Ga0070673_100473374 Ga0070673_1004733742 255
151 3300005438 Ga0070701_10091324 Ga0070701_100913242 255
152 3300005444 Ga0070694_100049273 Ga0070694_1000492732 255
153 3300005444 Ga0070694_100160581 Ga0070694_1001605812 255
154 3300005455 Ga0070663_100691108 Ga0070663_1006911081 255
155 3300005456 Ga0070678_100062524 Ga0070678_1000625243 255
156 3300005539 Ga0068853_100267981 Ga0068853_1002679811 255
157 3300005546 Ga0070696_100052526 Ga0070696_1000525262 255
158 3300005563 Ga0068855_100394743 Ga0068855_1003947432 255
159 3300005617 Ga0068859_100092988 Ga0068859_1000929882 255
160 3300005618 Ga0068864_100069541 Ga0068864_1000695412 255
161 3300005719 Ga0068861_100051336 Ga0068861_1000513362 255
162 3300005841 Ga0068863_100096647 Ga0068863_1000966473 255
163 3300005842 Ga0068858_100167707 Ga0068858_1001677072 255
164 3300005843 Ga0068860_100082098 Ga0068860_1000820984 255
165 3300005843 Ga0068860_100400729 Ga0068860_1004007292 255
166 3300006237 Ga0097621_100051743 Ga0097621_1000517432 255
167 3300006358 Ga0068871_100095105 Ga0068871_1000951052 255
168 3300006358 Ga0068871_100117672 Ga0068871_1001176722 255
169 3300006846 Ga0075430_100047167 Ga0075430_1000471672 255
170 3300006847 Ga0075431_100271470 Ga0075431_1002714702 255
171 3300006931 Ga0097620_100092988 Ga0097620_1000929883 255
172 3300009094 Ga0111539_10023858 Ga0111539_100238583 255
173 3300009101 Ga0105247_10002148 Ga0105247_100021487 255
174 3300009101 Ga0105247_10096547 Ga0105247_100965472 255
175 3300009147 Ga0114129_10960265 Ga0114129_109602652 255
176 3300009148 Ga0105243_10291273 Ga0105243_102912732 255
177 3300009148 Ga0105243_10780382 Ga0105243_107803822 255
178 3300009176 Ga0105242_10299477 Ga0105242_102994772 255
179 3300009177 Ga0105248_10542258 Ga0105248_105422582 255
180 3300009551 Ga0105238_10063627 Ga0105238_100636272 255
181 3300009553 Ga0105249_10002693 Ga0105249_1000269314 255
182 3300013306 Ga0163162_10099893 Ga0163162_100998933 255
183 3300013306 Ga0163162_10428864 Ga0163162_104288642 255
184 3300013307 Ga0157372_10554786 Ga0157372_105547862 255
185 3300014326 Ga0157380_10005925 Ga0157380_100059252 255
186 3300014968 Ga0157379_10199046 Ga0157379_101990462 255
187 3300014969 Ga0157376_10248185 Ga0157376_102481852 255
188 3300025900 Ga0207710_10000680 Ga0207710_100006809 255
189 3300025908 Ga0207643_10178075 Ga0207643_101780752 255
190 3300025923 Ga0207681_10014432 Ga0207681_100144322 255
191 3300025924 Ga0207694_10041593 Ga0207694_100415932 255
192 3300025925 Ga0207650_10350595 Ga0207650_103505952 255
193 3300025932 Ga0207690_10088455 Ga0207690_100884551 255
194 3300025934 Ga0207686_10035599 Ga0207686_100355992 255
195 3300025938 Ga0207704_10145388 Ga0207704_101453882 255
196 3300025941 Ga0207711_10267435 Ga0207711_102674352 255
197 3300025949 Ga0207667_10250947 Ga0207667_102509472 255
198 3300025961 Ga0207712_10214900 Ga0207712_102149002 255
199 3300026075 Ga0207708_10052446 Ga0207708_100524462 255
200 3300026088 Ga0207641_10223656 Ga0207641_102236562 255
201 3300026118 Ga0207675_100009005 Ga0207675_1000090052 255
202 3300026121 Ga0207683_10047390 Ga0207683_100473902 255
203 3300028381 Ga0268264_10337498 Ga0268264_103374982 255
204 3300028381 Ga0268264_10513863 Ga0268264_105138631 255
205 3300028381 Ga0268264_10662922 Ga0268264_106629222 255
206 3300035207 Ga0373942_0007902 Ga0373942_0007902_619_1395 255
207 3300042005 Ga0439448_0002306 Ga0439448_0002306_579_1355 255
208 3300042012 Ga0439455_0006515 Ga0439455_0006515_443_1219 255
209 3300045051 Ga0451576_0312512 Ga0451576_0312512_412_1188 255
210 3300049514 Ga0501291_002112 Ga0501291_002112_117_893 255
211 3300049515 Ga0501292_005809 Ga0501292_005809_868_1644 255
212 3300049521 Ga0501298_018229 Ga0501298_018229_482_1258 255
213 3300049649 Ga0501198_005543 Ga0501198_005543_696_1472 255
214 3300049652 Ga0501202_016402 Ga0501202_016402_39_815 255
215 3300049661 Ga0501217_002274 Ga0501217_002274_2522_3298 255
216 3300049665 Ga0501227_054407 Ga0501227_054407_199_975 255
217 3300049669 Ga0501235_005423 Ga0501235_005423_1184_1960 255
218 3300049679 Ga0501249_009948 Ga0501249_009948_1046_1822 255
219 3300049689 Ga0501260_004996 Ga0501260_004996_448_1224 255
220 3300049704 Ga0501221_007391 Ga0501221_007391_1010_1786 255
221 3300049706 Ga0501229_007554 Ga0501229_007554_381_1157 255
222 3300050510 nmdc:mga06r32_101051_c1 nmdc:mga06r32_101051_c1_1092_1868 255
223 3300050511 nmdc:mga08y16_43374_c1 nmdc:mga08y16_43374_c1_2198_2983 255
224 3300050515 nmdc:mga0a205_152279_c1 nmdc:mga0a205_152279_c1_1121_1897 255
225 2162886007 SwRhRL2b_contig_601517 SwRhRL2b_0498.00009050 256
226 3300005334 Ga0068869_100010896 Ga0068869_1000108964 256
227 3300005471 Ga0070698_100213441 Ga0070698_1002134412 256
228 3300005536 Ga0070697_100049882 Ga0070697_1000498823 256
229 3300006852 Ga0075433_10043577 Ga0075433_100435772 256
230 3300009147 Ga0114129_10095031 Ga0114129_100950312 256
231 3300025942 Ga0207689_10008000 Ga0207689_100080005 256
232 3300026116 Ga0207674_10090040 Ga0207674_100900403 256
233 3300026116 Ga0207674_10199525 Ga0207674_101995252 256
234 3300031548 Ga0307408_100210173 Ga0307408_1002101732 256
235 3300031903 Ga0307407_10019729 Ga0307407_100197292 256
236 3300031995 Ga0307409_100221957 Ga0307409_1002219572 256
237 3300035091 Ga0373951_0035247 Ga0373951_0035247_213_992 256
238 3300048913 Ga0496110_0194460 Ga0496110_0194460_689_1468 256
239 3300050507 nmdc:mga05p37_23197_c1 nmdc:mga05p37_23197_c1_4422_5234 256
240 3300005340 Ga0070689_100140024 Ga0070689_1001400242 259
241 3300005466 Ga0070685_10337440 Ga0070685_103374401 259
242 3300005543 Ga0070672_100460810 Ga0070672_1004608101 259
243 3300005617 Ga0068859_100406450 Ga0068859_1004064501 259
244 3300006931 Ga0097620_100406428 Ga0097620_1004064281 259
245 3300009553 Ga0105249_10281232 Ga0105249_102812322 259
246 3300014325 Ga0163163_10033718 Ga0163163_100337184 259
247 3300014326 Ga0157380_10676274 Ga0157380_106762741 259
248 3300025936 Ga0207670_10226102 Ga0207670_102261022 259
249 3300005337 Ga0070682_100376864 Ga0070682_1003768641 260
250 3300005340 Ga0070689_100041414 Ga0070689_1000414143 260
251 3300005354 Ga0070675_100071040 Ga0070675_1000710402 260
252 3300005355 Ga0070671_100441283 Ga0070671_1004412831 260
253 3300005455 Ga0070663_100058043 Ga0070663_1000580432 260
254 3300005618 Ga0068864_100029987 Ga0068864_1000299872 260
255 3300017792 Ga0163161_10312094 Ga0163161_103120941 260
256 3300025936 Ga0207670_10422904 Ga0207670_104229041 260
257 3300026067 Ga0207678_10195848 Ga0207678_101958481 260
258 3300026095 Ga0207676_10036300 Ga0207676_100363003 260
259 3300026118 Ga0207675_100097714 Ga0207675_1000977143 260
260 3300005438 Ga0070701_10102321 Ga0070701_101023211 261
261 3300005544 Ga0070686_100001464 Ga0070686_1000014642 261
262 3300005841 Ga0068863_100437016 Ga0068863_1004370162 261
263 3300006871 Ga0075434_100048125 Ga0075434_1000481255 261
264 3300009147 Ga0114129_10558952 Ga0114129_105589521 261
265 3300009553 Ga0105249_10188341 Ga0105249_101883412 261
266 3300025981 Ga0207640_10224714 Ga0207640_102247142 261
267 3300026041 Ga0207639_10168649 Ga0207639_101686492 261
268 3300048905 Ga0496102_0421054 Ga0496102_0421054_75_887 261
269 3300048907 Ga0496104_0404739 Ga0496104_0404739_89_901 261
270 3300049588 Ga0501072_0010483 Ga0501072_0010483_2988_4082 261
271 3300050507 nmdc:mga05p37_812034_c1 nmdc:mga05p37_812034_c1_38_850 261
272 3300050512 nmdc:mga0n895_306099_c1 nmdc:mga0n895_306099_c1_186_998 261
273 3300050515 nmdc:mga0a205_27607_c1 nmdc:mga0a205_27607_c1_2236_3048 261
274 3300005536 Ga0070697_100000100 Ga0070697_10000010022 262
275 3300005546 Ga0070696_100014548 Ga0070696_1000145482 262
276 3300025910 Ga0207684_10011160 Ga0207684_100111604 262
277 3300042006 Ga0439432_031338 Ga0439432_031338_65_958 262
278 3300037471 Ga0395905_0158745 Ga0395905_0158745_603_1406 264
279 2162886012 MBSR1b_contig_12639720 MBSR1b_0662.00005510 266
280 3300005330 Ga0070690_100141926 Ga0070690_1001419262 266
281 3300005343 Ga0070687_100000359 Ga0070687_1000003599 266
282 3300005345 Ga0070692_10222799 Ga0070692_102227992 266
283 3300005353 Ga0070669_100083569 Ga0070669_1000835692 266
284 3300005444 Ga0070694_100073199 Ga0070694_1000731992 266
285 3300005544 Ga0070686_100049383 Ga0070686_1000493832 266
286 3300005545 Ga0070695_100147908 Ga0070695_1001479081 266
287 3300005549 Ga0070704_100007476 Ga0070704_1000074765 266
288 3300005578 Ga0068854_100348920 Ga0068854_1003489201 266
289 3300005719 Ga0068861_100036866 Ga0068861_1000368663 266
290 3300005843 Ga0068860_100711955 Ga0068860_1007119551 266
291 3300009094 Ga0111539_10018183 Ga0111539_100181837 266
292 3300009147 Ga0114129_10548052 Ga0114129_105480522 266
293 3300013297 Ga0157378_10030413 Ga0157378_100304132 266
294 3300013306 Ga0163162_10499849 Ga0163162_104998491 266
295 3300025918 Ga0207662_10006269 Ga0207662_100062693 266
296 3300025933 Ga0207706_10117192 Ga0207706_101171922 266
297 3300025938 Ga0207704_10042650 Ga0207704_100426502 266
298 3300025939 Ga0207665_10052769 Ga0207665_100527693 266
299 3300025981 Ga0207640_10295652 Ga0207640_102956522 266
300 3300026075 Ga0207708_10325546 Ga0207708_103255462 266
301 3300026089 Ga0207648_10448532 Ga0207648_104485321 266
302 3300050511 nmdc:mga08y16_14012_c1 nmdc:mga08y16_14012_c1_1494_2306 266
303 3300005290 Ga0065712_10131065 Ga0065712_101310652 267
304 3300005467 Ga0070706_100026145 Ga0070706_1000261451 269
305 3300005468 Ga0070707_100003440 Ga0070707_1000034404 269
306 3300005471 Ga0070698_100002269 Ga0070698_1000022697 269
307 3300005518 Ga0070699_100001322 Ga0070699_1000013228 269
308 3300005536 Ga0070697_100001747 Ga0070697_1000017474 269
309 3300006844 Ga0075428_100356644 Ga0075428_1003566441 269
310 3300025910 Ga0207684_10021961 Ga0207684_100219615 269
311 3300025922 Ga0207646_10048787 Ga0207646_100487872 269
312 3300005536 Ga0070697_100131950 Ga0070697_1001319502 270
313 3300049592 Ga0501076_0227456 Ga0501076_0227456_404_1243 270
314 3300005339 Ga0070660_100079659 Ga0070660_1000796592 271
315 3300005344 Ga0070661_100023570 Ga0070661_1000235706 271
316 3300005345 Ga0070692_10302967 Ga0070692_103029671 271
317 3300005366 Ga0070659_100023578 Ga0070659_1000235782 271
318 3300005458 Ga0070681_10000735 Ga0070681_1000073511 271
319 3300005530 Ga0070679_100052342 Ga0070679_1000523422 271
320 3300005563 Ga0068855_100336522 Ga0068855_1003365222 271
321 3300005564 Ga0070664_100002661 Ga0070664_1000026614 271
322 3300005577 Ga0068857_100000175 Ga0068857_10000017529 271
323 3300005843 Ga0068860_100246453 Ga0068860_1002464532 271
324 3300009174 Ga0105241_10150088 Ga0105241_101500881 271
325 3300009177 Ga0105248_10028386 Ga0105248_100283866 271
326 3300013100 Ga0157373_10043677 Ga0157373_100436772 271
327 3300013306 Ga0163162_10035910 Ga0163162_100359102 271
328 3300014325 Ga0163163_10020621 Ga0163163_100206214 271
329 3300014325 Ga0163163_10069657 Ga0163163_100696572 271
330 3300025912 Ga0207707_10105247 Ga0207707_101052472 271
331 3300025917 Ga0207660_10090191 Ga0207660_100901912 271
332 3300025919 Ga0207657_10098545 Ga0207657_100985452 271
333 3300025920 Ga0207649_10186337 Ga0207649_101863372 271
334 3300025921 Ga0207652_10042215 Ga0207652_100422152 271
335 3300025941 Ga0207711_10146257 Ga0207711_101462572 271
336 3300025945 Ga0207679_10182986 Ga0207679_101829862 271
337 3300026116 Ga0207674_10000472 Ga0207674_1000047210 271
338 3300025910 Ga0207684_10039388 Ga0207684_100393883 272
339 3300046539 Ga0495621_0001547 Ga0495621_0001547_657_1490 272
340 3300014325 Ga0163163_10092605 Ga0163163_100926052 273
341 3300025942 Ga0207689_10020516 Ga0207689_100205163 273
342 2162886007 SwRhRL2b_contig_430414 SwRhRL2b_0652.00000240 274
343 3300005295 Ga0065707_10001705 Ga0065707_100017052 274
344 3300005471 Ga0070698_100005557 Ga0070698_1000055579 274
345 3300009148 Ga0105243_10017018 Ga0105243_100170187 274
346 3300025910 Ga0207684_10007053 Ga0207684_100070533 274
347 3300025925 Ga0207650_10180984 Ga0207650_101809842 274
348 3300025936 Ga0207670_10197930 Ga0207670_101979302 274
349 3300026095 Ga0207676_10371885 Ga0207676_103718851 274

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z48-assembly2.cif.gz_B crystal structure of a duf1329 family protein (despig_00262) from desulfovibrio piger atcc 29098 at 1.75 a resolution 0.6592 41 265
3buu-assembly2.cif.gz_B crystal structure of lola superfamily protein ne2245 from nitrosomonas europaea 0.6505 41 266
1iwm-assembly1.cif.gz_A crystal structure of the outer membrane lipoprotein receptor, lolb 0.6377 44 256
3wjv-assembly1.cif.gz_A crystal structure of the l68e variant of mlolb 0.6372 44 256
3buu-assembly2.cif.gz_B crystal structure of lola superfamily protein ne2245 from nitrosomonas europaea 0.633 41 266
ID Description Score Start End Superfamily
af_A0A0P0XAU2_138_242_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.7003 147 189 3.30.390.80
3go2A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6795 155 189 3.30.390.10
af_A0A1D6H917_4_166_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.6588 148 267 2.50.20.10
af_O33271_1_245_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6466 43 258 3.40.605.10
3buuB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.6433 41 266 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A2V8RVK7-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9806 53 274
AF-A0A2V8RVK7-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9717 53 274
AF-A0A7V9GBZ5-F1-model_v4 TonB family protein 0.9692 37 273 GO:0005886
GO:0015031
GO:0055085
AF-A0A353CCV9-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9631 27 274
AF-A0A7V9ZBW4-F1-model_v4 Outer membrane lipoprotein-sorting protein 0.9623 26 274

Feature Viewer

pLDDT pTM Quality
88.35 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map