F417924

General Info

Members Datasets Scaffolds Average Seq Length
349 207 347 155

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10704529|Ga0207691_107045292
Length 174
Sequence MPVSAVASADPNREEPWVRTTIAFLALLALATALPSVAQSPASAPKPVFDEALAKSVGADERGMRAYVLVILKTGPNKVPDGAERDEMFKGHFANIKRLAAEGKLAVAGPLDGVDGWRGLYIFAVPEIDEARKLVASDPVVMKGEMVPEFHKYYGAATLMLVNEAYPRVTKKPM

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
206 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.29
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.3
Nodule 0
Rhizoplane 2.29
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1007520 3300003771 Bacteria 5638
2 Ga0055537_1004370 3300003773 Bacteria 4055
3 Ga0055534_1002719 3300003784 Bacteria 5958
4 Ga0055528_1000387 3300003790 Bacteria 35861
5 Ga0070658_10756447 3300005327 Bacteria 844
6 Ga0070676_10002556 3300005328 Bacteria 9355
7 Ga0070676_10073127 3300005328 Bacteria 2062
8 Ga0070690_100033945 3300005330 Bacteria 3196
9 Ga0070670_100050076 3300005331 Bacteria 3590
10 Ga0070670_100055963 3300005331 Bacteria 3385
11 Ga0070670_100207390 3300005331 Bacteria 1703
12 Ga0070670_100256245 3300005331 Bacteria 1525
13 Ga0070670_100430131 3300005331 Bacteria 1168
14 Ga0070670_101927920 3300005331 Unclassified 544
15 Ga0070677_10024190 3300005333 Bacteria 2256
16 Ga0070677_10048436 3300005333 Bacteria 1708
17 Ga0070677_10062389 3300005333 Bacteria 1541
18 Ga0068869_100010507 3300005334 Bacteria 6039
19 Ga0070666_10000383 3300005335 Bacteria 27824
20 Ga0070666_11402188 3300005335 Bacteria 522
21 Ga0068868_100063306 3300005338 Bacteria 2934
22 Ga0068868_100088808 3300005338 Bacteria 2488
23 Ga0068868_100919094 3300005338 Bacteria 796
24 Ga0070689_101317599 3300005340 Bacteria 651
25 Ga0070687_100003187 3300005343 Bacteria 6336
26 Ga0070668_100009101 3300005347 Bacteria 7375
27 Ga0070668_100053919 3300005347 Bacteria 3101
28 Ga0070669_100004393 3300005353 Bacteria 10176
29 Ga0070669_100024902 3300005353 Bacteria 4295
30 Ga0070669_100105717 3300005353 Bacteria 2130
31 Ga0070669_100106268 3300005353 Bacteria 2124
32 Ga0070669_100426990 3300005353 Bacteria 1089
33 Ga0070675_100013976 3300005354 Bacteria 6320
34 Ga0070675_100610579 3300005354 Bacteria 990
35 Ga0070671_100183888 3300005355 Unclassified 1770
36 Ga0070671_100184625 3300005355 Bacteria 1766
37 Ga0070671_100243842 3300005355 Bacteria 1526
38 Ga0070671_100530126 3300005355 Unclassified 1014
39 Ga0070674_100007593 3300005356 Bacteria 6403
40 Ga0070673_100021066 3300005364 Bacteria 4716
41 Ga0070673_100145742 3300005364 Bacteria 2001
42 Ga0070673_100259837 3300005364 Bacteria 1517
43 Ga0070688_100300553 3300005365 Bacteria 1160
44 Ga0070659_100870797 3300005366 Bacteria 786
45 Ga0070667_100008041 3300005367 Bacteria 8748
46 Ga0070667_100683762 3300005367 Bacteria 949
47 Ga0070667_100816522 3300005367 Bacteria 866
48 Ga0070700_100007731 3300005441 Bacteria 5821
49 Ga0070700_101188373 3300005441 Bacteria 636
50 Ga0070663_100188058 3300005455 Bacteria 1606
51 Ga0070663_100253360 3300005455 Bacteria 1394
52 Ga0070663_100291514 3300005455 Bacteria 1303
53 Ga0070678_100263088 3300005456 Bacteria 1451
54 Ga0070678_101056184 3300005456 Bacteria 748
55 Ga0070662_100011397 3300005457 Bacteria 5867
56 Ga0070662_100020558 3300005457 Bacteria 4497
57 Ga0070662_100524825 3300005457 Bacteria 990
58 Ga0070681_10128994 3300005458 Unclassified 2461
59 Ga0068867_100009094 3300005459 Bacteria 7010
60 Ga0068867_100122153 3300005459 Bacteria 2014
61 Ga0068867_100737795 3300005459 Bacteria 872
62 Ga0068867_100880009 3300005459 Bacteria 804
63 Ga0070679_100061518 3300005530 Bacteria 3742
64 Ga0068853_100000815 3300005539 Bacteria 21746
65 Ga0070672_100000880 3300005543 Bacteria 17997
66 Ga0070672_100018795 3300005543 Bacteria 5004
67 Ga0070672_100045180 3300005543 Bacteria 3405
68 Ga0070672_100069692 3300005543 Bacteria 2793
69 Ga0070672_100226682 3300005543 Bacteria 1569
70 Ga0070672_100388613 3300005543 Bacteria 1194
71 Ga0070672_100895673 3300005543 Bacteria 784
72 Ga0070693_100963062 3300005547 Bacteria 643
73 Ga0070665_100362279 3300005548 Bacteria 1456
74 Ga0068855_100354514 3300005563 Bacteria 1616
75 Ga0070664_100480002 3300005564 Bacteria 1144
76 Ga0070664_100508668 3300005564 Bacteria 1111
77 Ga0068857_100735870 3300005577 Bacteria 939
78 Ga0068854_100301762 3300005578 Bacteria 1296
79 Ga0068854_101325280 3300005578 Bacteria 649
80 Ga0070702_100360973 3300005615 Bacteria 1027
81 Ga0068852_100009536 3300005616 Bacteria 7214
82 Ga0068852_100066624 3300005616 Bacteria 3145
83 Ga0068852_100331352 3300005616 Bacteria 1481
84 Ga0068852_100574438 3300005616 Bacteria 1130
85 Ga0068859_100317087 3300005617 Bacteria 1653
86 Ga0068864_100024738 3300005618 Bacteria 5052
87 Ga0068864_100212888 3300005618 Bacteria 1780
88 Ga0068864_100513877 3300005618 Bacteria 1154
89 Ga0068866_10002302 3300005718 Bacteria 7911
90 Ga0068861_100026625 3300005719 Bacteria 4206
91 Ga0068851_10052792 3300005834 Bacteria 2067
92 Ga0068851_10155020 3300005834 Bacteria 1254
93 Ga0068870_10169352 3300005840 Bacteria 1302
94 Ga0068870_10731064 3300005840 Bacteria 686
95 Ga0068863_100021677 3300005841 Bacteria 6128
96 Ga0068863_101362343 3300005841 Bacteria 717
97 Ga0068858_100021904 3300005842 Bacteria 5968
98 Ga0068858_100794897 3300005842 Bacteria 923
99 Ga0068858_102267914 3300005842 Bacteria 537
100 Ga0068860_100016513 3300005843 Bacteria 7200
101 Ga0068860_101873774 3300005843 Bacteria 621
102 Ga0068862_100009567 3300005844 Bacteria 8015
103 Ga0075365_10904568 3300006038 Bacteria 622
104 Ga0097621_100014845 3300006237 Bacteria 5843
105 Ga0097621_101525555 3300006237 Bacteria 634
106 Ga0075370_10001299 3300006353 Bacteria 10684
107 Ga0068871_100129244 3300006358 Bacteria 2140
108 Ga0068871_100591836 3300006358 Bacteria 1008
109 Ga0075430_100518843 3300006846 Bacteria 983
110 Ga0068865_100021423 3300006881 Bacteria 4202
111 Ga0097620_100317082 3300006931 Bacteria 1653
112 Ga0105250_10000091 3300009092 Bacteria 80262
113 Ga0111539_10125153 3300009094 Bacteria 3012
114 Ga0111539_10795944 3300009094 Bacteria 1100
115 Ga0105245_10043120 3300009098 Bacteria 4025
116 Ga0105243_10004458 3300009148 Bacteria 11067
117 Ga0105242_10003366 3300009176 Bacteria 12448
118 Ga0105242_10752783 3300009176 Bacteria 959
119 Ga0105248_10002726 3300009177 Bacteria 19624
120 Ga0105237_10027841 3300009545 Bacteria 5759
121 Ga0105237_10888603 3300009545 Bacteria 898
122 Ga0105249_10018770 3300009553 Bacteria 6161
123 Ga0105239_10180972 3300010375 Bacteria 2359
124 Ga0157370_11046186 3300013104 Bacteria 738
125 Ga0157369_10279568 3300013105 Bacteria 1739
126 Ga0157374_10207567 3300013296 Bacteria 1920
127 Ga0157378_10382139 3300013297 Bacteria 1383
128 Ga0163162_10005282 3300013306 Bacteria 12464
129 Ga0157375_10006696 3300013308 Bacteria 10035
130 Ga0157375_10106559 3300013308 Bacteria 2895
131 Ga0157375_10598178 3300013308 Bacteria 1262
132 Ga0157375_10998084 3300013308 Bacteria 977
133 Ga0157375_11364429 3300013308 Bacteria 834
134 Ga0157380_10035828 3300014326 Bacteria 3835
135 Ga0157380_10435606 3300014326 Bacteria 1255
136 Ga0157380_11474938 3300014326 Bacteria 733
137 Ga0157380_12316333 3300014326 Bacteria 602
138 Ga0157379_10008418 3300014968 Bacteria 8966
139 Ga0157379_10540063 3300014968 Bacteria 1084
140 Ga0157376_10061113 3300014969 Bacteria 3166
141 Ga0163161_10007699 3300017792 Bacteria 7450
142 Ga0163161_10417682 3300017792 Bacteria 1079
143 Ga0213872_10000023 3300021361 Bacteria 157443
144 Ga0213872_10141062 3300021361 Bacteria 1057
145 Ga0209565_1000722 3300025263 Bacteria 20001
146 Ga0209673_1000019 3300025273 Bacteria 449094
147 Ga0209675_1000846 3300025291 Bacteria 20002
148 Ga0209564_1001779 3300025295 Bacteria 19960
149 Ga0209256_1000093 3300025299 Bacteria 209318
150 Ga0209051_1009919 3300025303 Bacteria 4860
151 Ga0207697_10110124 3300025315 Bacteria 1179
152 Ga0207656_10107740 3300025321 Bacteria 1284
153 Ga0207656_10111386 3300025321 Bacteria 1265
154 Ga0207696_1001282 3300025711 Bacteria 14019
155 Ga0207682_10002098 3300025893 Bacteria 9032
156 Ga0207682_10022241 3300025893 Bacteria 2497
157 Ga0207642_10003623 3300025899 Bacteria 4901
158 Ga0207642_10132546 3300025899 Bacteria 1303
159 Ga0207688_10218079 3300025901 Bacteria 1148
160 Ga0207680_10002448 3300025903 Bacteria 8658
161 Ga0207680_10664064 3300025903 Bacteria 747
162 Ga0207647_10016181 3300025904 Bacteria 5092
163 Ga0207645_10000390 3300025907 Bacteria 36191
164 Ga0207645_10082253 3300025907 Bacteria 2064
165 Ga0207645_10618115 3300025907 Bacteria 736
166 Ga0207643_10062337 3300025908 Bacteria 2131
167 Ga0207705_10040425 3300025909 Bacteria 3345
168 Ga0207707_10062589 3300025912 Bacteria 3238
169 Ga0207671_10258530 3300025914 Bacteria 1370
170 Ga0207662_10036122 3300025918 Bacteria 2887
171 Ga0207657_10312769 3300025919 Bacteria 1243
172 Ga0207681_10003053 3300025923 Bacteria 10524
173 Ga0207681_10149799 3300025923 Bacteria 1747
174 Ga0207681_10255484 3300025923 Bacteria 1370
175 Ga0207681_10521195 3300025923 Bacteria 975
176 Ga0207694_10623477 3300025924 Bacteria 908
177 Ga0207650_10177637 3300025925 Bacteria 1695
178 Ga0207650_10465725 3300025925 Bacteria 1053
179 Ga0207659_10005549 3300025926 Bacteria 7655
180 Ga0207659_10151244 3300025926 Bacteria 1813
181 Ga0207659_10873057 3300025926 Bacteria 773
182 Ga0207687_10017737 3300025927 Bacteria 4692
183 Ga0207687_11606065 3300025927 Bacteria 558
184 Ga0207644_10170221 3300025931 Bacteria 1700
185 Ga0207644_10171198 3300025931 Unclassified 1695
186 Ga0207644_10193461 3300025931 Bacteria 1600
187 Ga0207644_10199996 3300025931 Unclassified 1576
188 Ga0207706_10021208 3300025933 Bacteria 5837
189 Ga0207706_10034489 3300025933 Bacteria 4502
190 Ga0207706_10177582 3300025933 Bacteria 1871
191 Ga0207706_10445608 3300025933 Bacteria 1120
192 Ga0207686_10036777 3300025934 Bacteria 2950
193 Ga0207709_10010315 3300025935 Bacteria 5146
194 Ga0207670_10294887 3300025936 Bacteria 1268
195 Ga0207669_10040385 3300025937 Bacteria 2706
196 Ga0207669_10879049 3300025937 Bacteria 747
197 Ga0207691_10000754 3300025940 Bacteria 31954
198 Ga0207691_10099396 3300025940 Bacteria 2598
199 Ga0207691_10191785 3300025940 Bacteria 1782
200 Ga0207691_10704529 3300025940 Bacteria 851
201 Ga0207711_10069378 3300025941 Bacteria 3055
202 Ga0207711_10518639 3300025941 Bacteria 1111
203 Ga0207689_10004319 3300025942 Bacteria 12943
204 Ga0207679_10138698 3300025945 Bacteria 1962
205 Ga0207679_10256483 3300025945 Bacteria 1489
206 Ga0207679_10880312 3300025945 Bacteria 819
207 Ga0207667_10062567 3300025949 Bacteria 3891
208 Ga0207651_10034239 3300025960 Bacteria 3287
209 Ga0207651_10036296 3300025960 Bacteria 3216
210 Ga0207651_10149016 3300025960 Bacteria 1818
211 Ga0207712_10014950 3300025961 Bacteria 5000
212 Ga0207668_10002995 3300025972 Bacteria 9900
213 Ga0207668_10269975 3300025972 Bacteria 1390
214 Ga0207668_10499480 3300025972 Bacteria 1046
215 Ga0207640_10192421 3300025981 Bacteria 1539
216 Ga0207658_10004261 3300025986 Bacteria 9965
217 Ga0207677_10047843 3300026023 Bacteria 2875
218 Ga0207677_10275495 3300026023 Unclassified 1378
219 Ga0207703_10006227 3300026035 Bacteria 9550
220 Ga0207703_10554709 3300026035 Bacteria 1084
221 Ga0207639_10002409 3300026041 Bacteria 12560
222 Ga0207678_10141745 3300026067 Bacteria 2051
223 Ga0207678_10157195 3300026067 Bacteria 1941
224 Ga0207678_10351765 3300026067 Bacteria 1271
225 Ga0207708_10049010 3300026075 Bacteria 3216
226 Ga0207702_11112371 3300026078 Bacteria 784
227 Ga0207641_10011162 3300026088 Bacteria 7368
228 Ga0207641_10490547 3300026088 Bacteria 1192
229 Ga0207641_10748541 3300026088 Unclassified 965
230 Ga0207641_11018384 3300026088 Bacteria 825
231 Ga0207648_10001878 3300026089 Bacteria 22968
232 Ga0207648_10100996 3300026089 Bacteria 2528
233 Ga0207648_10236780 3300026089 Bacteria 1625
234 Ga0207676_10049625 3300026095 Bacteria 3266
235 Ga0207674_10354177 3300026116 Bacteria 1419
236 Ga0207675_100023619 3300026118 Bacteria 5720
237 Ga0207683_10021024 3300026121 Bacteria 5585
238 Ga0207683_10094897 3300026121 Bacteria 2659
239 Ga0207683_10697017 3300026121 Bacteria 941
240 Ga0207698_10075976 3300026142 Bacteria 2687
241 Ga0207698_10077352 3300026142 Bacteria 2668
242 Ga0207698_10081812 3300026142 Bacteria 2608
243 Ga0268266_10310396 3300028379 Bacteria 1474
244 Ga0268266_10727846 3300028379 Bacteria 957
245 Ga0268265_10027370 3300028380 Bacteria 4068
246 Ga0268264_10007375 3300028381 Bacteria 9186
247 Ga0268264_10123476 3300028381 Bacteria 2285
248 Ga0307509_10645871 3300031507 Bacteria 727
249 Ga0307408_100000488 3300031548 Bacteria 34667
250 Ga0307408_100624654 3300031548 Bacteria 960
251 Ga0307508_10434910 3300031616 Unclassified 904
252 Ga0307514_10001108 3300031649 Bacteria 37572
253 Ga0307516_10005205 3300031730 Bacteria 15661
254 Ga0307405_10188093 3300031731 Bacteria 1489
255 Ga0307416_100086832 3300032002 Bacteria 2668
256 Ga0307416_100194479 3300032002 Bacteria 1917
257 Ga0307416_100363811 3300032002 Bacteria 1470
258 Ga0307416_101561014 3300032002 Bacteria 766
259 Ga0395900_0542792 3300037418 Unclassified 1108
260 Ga0395905_0018536 3300037471 Bacteria 6605
261 Ga0395905_0022963 3300037471 Bacteria 5895
262 Ga0436361_0060434 3300039447 Bacteria 165633
263 Ga0436361_0280984 3300039447 Bacteria 782
264 Ga0436361_0350152 3300039447 Bacteria 1447
265 Ga0436361_0424027 3300039447 Bacteria 1097
266 Ga0436361_1144678 3300039447 Bacteria 1585
267 Ga0451800_0417252 3300041459 Bacteria 759
268 Ga0451807_0290195 3300041486 Bacteria 775
269 Ga0451843_0194517 3300041509 Bacteria 750
270 Ga0451853_1309748 3300041512 Bacteria 882
271 Ga0451577_0164222 3300042876 Bacteria 2000
272 Ga0453684_0149696 3300044712 Bacteria 2775
273 Ga0451576_0088027 3300045051 Bacteria 3230
274 Ga0451576_1258518 3300045051 Bacteria 772
275 Ga0495584_0040274 3300046491 Bacteria 2359
276 Ga0495585_0000501 3300046492 Bacteria 37082
277 Ga0495585_0112915 3300046492 Bacteria 1443
278 Ga0495585_0155074 3300046492 Bacteria 1192
279 Ga0495596_0010942 3300046500 Bacteria 3930
280 Ga0495596_0020926 3300046500 Bacteria 2674
281 Ga0495583_0043409 3300046506 Bacteria 2093
282 Ga0495606_0003529 3300046507 Bacteria 16533
283 Ga0495606_0082376 3300046507 Unclassified 1997
284 Ga0495606_0207215 3300046507 Bacteria 1113
285 Ga0495616_0008827 3300046513 Bacteria 5932
286 Ga0495616_0318940 3300046513 Unclassified 653
287 Ga0495631_0007784 3300046518 Bacteria 5435
288 Ga0495631_0059284 3300046518 Bacteria 1663
289 Ga0495648_0213649 3300046524 Bacteria 956
290 Ga0495663_0060225 3300046525 Bacteria 1192
291 Ga0495642_0002200 3300046528 Bacteria 7994
292 Ga0495642_0013090 3300046528 Bacteria 3204
293 Ga0495642_0067826 3300046528 Bacteria 1488
294 Ga0495642_0084495 3300046528 Bacteria 1339
295 Ga0495609_0010750 3300046538 Bacteria 4379
296 Ga0495609_0080994 3300046538 Bacteria 1419
297 Ga0495633_0107834 3300046558 Unclassified 1291
298 Ga0495633_0277200 3300046558 Bacteria 763
299 Ga0495656_0453906 3300046615 Bacteria 675
300 Ga0495668_0047799 3300046616 Bacteria 2375
301 Ga0495668_0144371 3300046616 Bacteria 1302
302 Ga0495668_0302097 3300046616 Bacteria 877
303 Ga0495661_0035804 3300046665 Bacteria 3113
304 Ga0495670_0170383 3300046691 Bacteria 1146
305 Ga0495671_0029536 3300046692 Bacteria 2814
306 Ga0495671_0133898 3300046692 Bacteria 1208
307 Ga0495649_0038043 3300046694 Bacteria 2641
308 Ga0495589_0019180 3300046794 Bacteria 3509
309 Ga0495660_0007977 3300046810 Bacteria 6219
310 Ga0495660_0042728 3300046810 Bacteria 2503
311 Ga0495676_0148777 3300047321 Bacteria 1669
312 Ga0495683_0049469 3300047323 Bacteria 2105
313 Ga0495687_000115 3300047443 Bacteria 122883
314 Ga0495681_0015958 3300047470 Bacteria 4235
315 Ga0495686_0032740 3300047472 Bacteria 3362
316 Ga0495686_0504999 3300047472 Unclassified 636
317 Ga0495626_0015989 3300048091 Bacteria 3825
318 Ga0496100_0240508 3300048903 Bacteria 1335
319 Ga0496100_0316327 3300048903 Bacteria 1172
320 Ga0496102_0000196 3300048905 Bacteria 82747
321 Ga0496108_0301709 3300048911 Bacteria 1395
322 Ga0496109_1721866 3300048912 Bacteria 560
323 Ga0496114_0248940 3300048917 Bacteria 1564
324 Ga0501304_040737 3300049160 Bacteria 518
325 Ga0495678_000622 3300049459 Bacteria 32958
326 Ga0495678_002745 3300049459 Bacteria 11549
327 Ga0495682_0000578 3300049460 Bacteria 24806
328 Ga0501034_0007048 3300049571 Bacteria 11989
329 Ga0501067_0208677 3300049583 Bacteria 1088
330 Ga0501068_0833844 3300049584 Unclassified 605
331 Ga0501076_1503205 3300049592 Bacteria 553
332 Ga0501257_023704 3300049686 Bacteria 1456
333 Ga0501265_001951 3300049762 Bacteria 2351
334 nmdc:mga07m45_7089_c1 3300050496 Bacteria 5707
335 nmdc:mga08y16_516975_c1 3300050511 Bacteria 1211
336 nmdc:mga08y16_831172_c1 3300050511 Bacteria 914
337 nmdc:mga0a205_386631_c1 3300050515 Bacteria 1264
338 Ga0500578_0036160 3300053086 Bacteria 3173
339 Ga0500644_0003607 3300053088 Bacteria 3840
340 Ga0500594_0177130 3300053118 Unclassified 694
341 Ga0500559_0000422 3300053136 Bacteria 30315
342 Ga0500620_236142 3300053155 Bacteria 613
343 Ga0500622_0000912 3300053156 Bacteria 25132
344 Ga0500645_002335 3300053730 Bacteria 8541
345 Ga0500599_023863 3300053736 Unclassified 880
346 Ga0500587_001651 3300053739 Unclassified 3171
347 Ga0501084_0692997 3300054114 Unclassified 859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10141745 Ga0207678_101417451 134
2 3300005458 Ga0070681_10128994 Ga0070681_101289943 136
3 3300005530 Ga0070679_100061518 Ga0070679_1000615182 136
4 3300025912 Ga0207707_10062589 Ga0207707_100625893 136
5 3300053088 Ga0500644_0003607 Ga0500644_0003607_778_1200 137
6 3300053118 Ga0500594_0177130 Ga0500594_0177130_110_532 137
7 3300053136 Ga0500559_0000422 Ga0500559_0000422_25479_25901 137
8 3300053739 Ga0500587_001651 Ga0500587_001651_348_770 137
9 3300037471 Ga0395905_0022963 Ga0395905_0022963_2541_2990 138
10 3300046615 Ga0495656_0453906 Ga0495656_0453906_235_660 138
11 3300048903 Ga0496100_0240508 Ga0496100_0240508_22_456 139
12 3300032002 Ga0307416_100086832 Ga0307416_1000868322 141
13 3300049762 Ga0501265_001951 Ga0501265_001951_109_615 141
14 3300014326 Ga0157380_12316333 Ga0157380_123163331 142
15 3300037418 Ga0395900_0542792 Ga0395900_0542792_90_527 142
16 3300041459 Ga0451800_0417252 Ga0451800_0417252_180_608 142
17 3300041512 Ga0451853_1309748 Ga0451853_1309748_391_819 142
18 3300046491 Ga0495584_0040274 Ga0495584_0040274_1179_1622 142
19 3300046492 Ga0495585_0000501 Ga0495585_0000501_8648_9091 142
20 3300046492 Ga0495585_0112915 Ga0495585_0112915_449_892 142
21 3300046492 Ga0495585_0155074 Ga0495585_0155074_110_553 142
22 3300046507 Ga0495606_0003529 Ga0495606_0003529_7219_7662 142
23 3300046518 Ga0495631_0059284 Ga0495631_0059284_534_977 142
24 3300046528 Ga0495642_0002200 Ga0495642_0002200_4042_4485 142
25 3300046528 Ga0495642_0013090 Ga0495642_0013090_65_508 142
26 3300046528 Ga0495642_0067826 Ga0495642_0067826_120_563 142
27 3300046538 Ga0495609_0080994 Ga0495609_0080994_899_1342 142
28 3300046558 Ga0495633_0107834 Ga0495633_0107834_339_782 142
29 3300046691 Ga0495670_0170383 Ga0495670_0170383_522_965 142
30 3300046692 Ga0495671_0029536 Ga0495671_0029536_497_940 142
31 3300047443 Ga0495687_000115 Ga0495687_000115_18040_18492 142
32 3300049160 Ga0501304_040737 Ga0501304_040737_16_465 142
33 3300049592 Ga0501076_1503205 Ga0501076_1503205_21_515 142
34 3300049686 Ga0501257_023704 Ga0501257_023704_510_1016 142
35 iso_pu_bacteria 2920107658 2920110470 142
36 3300005331 Ga0070670_100430131 Ga0070670_1004301312 143
37 3300005335 Ga0070666_11402188 Ga0070666_114021881 143
38 3300005353 Ga0070669_100024902 Ga0070669_1000249022 143
39 3300005367 Ga0070667_100816522 Ga0070667_1008165222 143
40 3300005459 Ga0068867_100737795 Ga0068867_1007377952 143
41 3300005543 Ga0070672_100069692 Ga0070672_1000696922 143
42 3300005618 Ga0068864_100513877 Ga0068864_1005138772 143
43 3300006358 Ga0068871_100591836 Ga0068871_1005918361 143
44 3300009094 Ga0111539_10125153 Ga0111539_101251536 143
45 3300014326 Ga0157380_11474938 Ga0157380_114749381 143
46 3300025923 Ga0207681_10149799 Ga0207681_101497993 143
47 3300026089 Ga0207648_10236780 Ga0207648_102367802 143
48 3300046524 Ga0495648_0213649 Ga0495648_0213649_489_938 143
49 3300046810 Ga0495660_0042728 Ga0495660_0042728_1214_1660 143
50 3300047472 Ga0495686_0032740 Ga0495686_0032740_641_1087 143
51 3300050511 nmdc:mga08y16_831172_c1 nmdc:mga08y16_831172_c1_444_896 143
52 3300005331 Ga0070670_100256245 Ga0070670_1002562452 144
53 3300005353 Ga0070669_100105717 Ga0070669_1001057172 144
54 3300005355 Ga0070671_100243842 Ga0070671_1002438423 144
55 3300005365 Ga0070688_100300553 Ga0070688_1003005532 144
56 3300005367 Ga0070667_100683762 Ga0070667_1006837622 144
57 3300005441 Ga0070700_101188373 Ga0070700_1011883731 144
58 3300005457 Ga0070662_100524825 Ga0070662_1005248252 144
59 3300005459 Ga0068867_100880009 Ga0068867_1008800091 144
60 3300005543 Ga0070672_100226682 Ga0070672_1002266822 144
61 3300005548 Ga0070665_100362279 Ga0070665_1003622792 144
62 3300005616 Ga0068852_100574438 Ga0068852_1005744383 144
63 3300005834 Ga0068851_10155020 Ga0068851_101550202 144
64 3300005841 Ga0068863_101362343 Ga0068863_1013623432 144
65 3300005842 Ga0068858_102267914 Ga0068858_1022679141 144
66 3300005843 Ga0068860_101873774 Ga0068860_1018737741 144
67 3300013308 Ga0157375_10598178 Ga0157375_105981781 144
68 3300014326 Ga0157380_10435606 Ga0157380_104356062 144
69 3300025321 Ga0207656_10111386 Ga0207656_101113862 144
70 3300025901 Ga0207688_10218079 Ga0207688_102180792 144
71 3300025907 Ga0207645_10618115 Ga0207645_106181151 144
72 3300025923 Ga0207681_10255484 Ga0207681_102554842 144
73 3300025925 Ga0207650_10177637 Ga0207650_101776372 144
74 3300025933 Ga0207706_10445608 Ga0207706_104456082 144
75 3300025940 Ga0207691_10099396 Ga0207691_100993963 144
76 3300025945 Ga0207679_10880312 Ga0207679_108803122 144
77 3300025972 Ga0207668_10269975 Ga0207668_102699752 144
78 3300026023 Ga0207677_10275495 Ga0207677_102754952 144
79 3300026088 Ga0207641_10748541 Ga0207641_107485411 144
80 3300026142 Ga0207698_10075976 Ga0207698_100759764 144
81 3300028379 Ga0268266_10727846 Ga0268266_107278462 144
82 3300028381 Ga0268264_10123476 Ga0268264_101234761 144
83 3300031731 Ga0307405_10188093 Ga0307405_101880932 144
84 3300032002 Ga0307416_100363811 Ga0307416_1003638112 144
85 3300032002 Ga0307416_101561014 Ga0307416_1015610141 144
86 3300050515 nmdc:mga0a205_386631_c1 nmdc:mga0a205_386631_c1_339_794 144
87 3300005328 Ga0070676_10073127 Ga0070676_100731274 145
88 3300005331 Ga0070670_101927920 Ga0070670_1019279201 145
89 3300005564 Ga0070664_100480002 Ga0070664_1004800023 145
90 3300009092 Ga0105250_10000091 Ga0105250_1000009110 145
91 3300021361 Ga0213872_10141062 Ga0213872_101410622 145
92 3300025711 Ga0207696_1001282 Ga0207696_100128211 145
93 3300025907 Ga0207645_10082253 Ga0207645_100822533 145
94 3300025945 Ga0207679_10138698 Ga0207679_101386981 145
95 3300039447 Ga0436361_0280984 Ga0436361_0280984_199_648 145
96 3300039447 Ga0436361_0350152 Ga0436361_0350152_208_657 145
97 3300039447 Ga0436361_0424027 Ga0436361_0424027_366_815 145
98 3300046528 Ga0495642_0084495 Ga0495642_0084495_460_921 145
99 3300046538 Ga0495609_0010750 Ga0495609_0010750_3336_3797 145
100 3300046665 Ga0495661_0035804 Ga0495661_0035804_2201_2662 145
101 3300021361 Ga0213872_10000023 Ga0213872_10000023109 146
102 3300041486 Ga0451807_0290195 Ga0451807_0290195_199_678 146
103 3300041509 Ga0451843_0194517 Ga0451843_0194517_67_546 146
104 3300046500 Ga0495596_0020926 Ga0495596_0020926_286_750 146
105 3300046506 Ga0495583_0043409 Ga0495583_0043409_1061_1525 146
106 3300046507 Ga0495606_0082376 Ga0495606_0082376_1487_1951 146
107 3300046513 Ga0495616_0008827 Ga0495616_0008827_1314_1778 146
108 3300046513 Ga0495616_0318940 Ga0495616_0318940_80_541 146
109 3300046518 Ga0495631_0007784 Ga0495631_0007784_4044_4508 146
110 3300046616 Ga0495668_0302097 Ga0495668_0302097_293_757 146
111 3300046692 Ga0495671_0133898 Ga0495671_0133898_124_585 146
112 3300046694 Ga0495649_0038043 Ga0495649_0038043_1008_1472 146
113 3300049459 Ga0495678_000622 Ga0495678_000622_27386_27850 146
114 3300049460 Ga0495682_0000578 Ga0495682_0000578_15149_15613 146
115 iso_pu_bacteria 2643221654 2644304253 146
116 3300005539 Ga0068853_100000815 Ga0068853_1000008153 147
117 3300005547 Ga0070693_100963062 Ga0070693_1009630621 147
118 3300005563 Ga0068855_100354514 Ga0068855_1003545143 147
119 3300009545 Ga0105237_10888603 Ga0105237_108886032 147
120 3300010375 Ga0105239_10180972 Ga0105239_101809723 147
121 3300025303 Ga0209051_1009919 Ga0209051_10099196 147
122 3300025904 Ga0207647_10016181 Ga0207647_100161811 147
123 3300025949 Ga0207667_10062567 Ga0207667_100625672 147
124 3300026041 Ga0207639_10002409 Ga0207639_100024093 147
125 3300026116 Ga0207674_10354177 Ga0207674_103541772 147
126 3300031548 Ga0307408_100000488 Ga0307408_1000004886 147
127 3300046500 Ga0495596_0010942 Ga0495596_0010942_3172_3645 147
128 3300046525 Ga0495663_0060225 Ga0495663_0060225_57_530 147
129 3300046616 Ga0495668_0047799 Ga0495668_0047799_283_756 147
130 3300046616 Ga0495668_0144371 Ga0495668_0144371_288_761 147
131 3300046794 Ga0495589_0019180 Ga0495589_0019180_1810_2283 147
132 3300046810 Ga0495660_0007977 Ga0495660_0007977_3571_4044 147
133 3300047323 Ga0495683_0049469 Ga0495683_0049469_1527_2000 147
134 3300047470 Ga0495681_0015958 Ga0495681_0015958_3262_3735 147
135 3300048091 Ga0495626_0015989 Ga0495626_0015989_2265_2738 147
136 3300049459 Ga0495678_002745 Ga0495678_002745_8595_9068 147
137 3300049583 Ga0501067_0208677 Ga0501067_0208677_275_736 147
138 3300005347 Ga0070668_100009101 Ga0070668_10000910113 148
139 3300005843 Ga0068860_100016513 Ga0068860_10001651310 148
140 3300006038 Ga0075365_10904568 Ga0075365_109045681 148
141 3300025972 Ga0207668_10002995 Ga0207668_100029958 148
142 3300025972 Ga0207668_10499480 Ga0207668_104994802 148
143 3300026118 Ga0207675_100023619 Ga0207675_1000236195 148
144 3300031548 Ga0307408_100624654 Ga0307408_1006246542 148
145 3300032002 Ga0307416_100194479 Ga0307416_1001944793 148
146 3300039447 Ga0436361_1144678 Ga0436361_1144678_323_805 148
147 3300044712 Ga0453684_0149696 Ga0453684_0149696_877_1350 148
148 3300047321 Ga0495676_0148777 Ga0495676_0148777_381_851 148
149 3300048905 Ga0496102_0000196 Ga0496102_0000196_62100_62570 148
150 3300048912 Ga0496109_1721866 Ga0496109_1721866_71_541 148
151 3300049571 Ga0501034_0007048 Ga0501034_0007048_6166_6624 148
152 3300005327 Ga0070658_10756447 Ga0070658_107564471 149
153 3300005328 Ga0070676_10002556 Ga0070676_1000255611 149
154 3300005330 Ga0070690_100033945 Ga0070690_1000339452 149
155 3300005331 Ga0070670_100055963 Ga0070670_1000559636 149
156 3300005331 Ga0070670_100207390 Ga0070670_1002073902 149
157 3300005333 Ga0070677_10024190 Ga0070677_100241902 149
158 3300005333 Ga0070677_10048436 Ga0070677_100484362 149
159 3300005333 Ga0070677_10062389 Ga0070677_100623891 149
160 3300005334 Ga0068869_100010507 Ga0068869_1000105074 149
161 3300005335 Ga0070666_10000383 Ga0070666_1000038343 149
162 3300005338 Ga0068868_100063306 Ga0068868_1000633064 149
163 3300005338 Ga0068868_100088808 Ga0068868_1000888084 149
164 3300005340 Ga0070689_101317599 Ga0070689_1013175991 149
165 3300005343 Ga0070687_100003187 Ga0070687_1000031874 149
166 3300005347 Ga0070668_100053919 Ga0070668_1000539194 149
167 3300005353 Ga0070669_100004393 Ga0070669_10000439312 149
168 3300005353 Ga0070669_100106268 Ga0070669_1001062684 149
169 3300005353 Ga0070669_100426990 Ga0070669_1004269902 149
170 3300005354 Ga0070675_100013976 Ga0070675_10001397610 149
171 3300005354 Ga0070675_100610579 Ga0070675_1006105792 149
172 3300005355 Ga0070671_100184625 Ga0070671_1001846252 149
173 3300005355 Ga0070671_100530126 Ga0070671_1005301262 149
174 3300005356 Ga0070674_100007593 Ga0070674_1000075937 149
175 3300005364 Ga0070673_100145742 Ga0070673_1001457423 149
176 3300005364 Ga0070673_100259837 Ga0070673_1002598372 149
177 3300005366 Ga0070659_100870797 Ga0070659_1008707972 149
178 3300005367 Ga0070667_100008041 Ga0070667_1000080419 149
179 3300005441 Ga0070700_100007731 Ga0070700_1000077313 149
180 3300005455 Ga0070663_100188058 Ga0070663_1001880584 149
181 3300005455 Ga0070663_100253360 Ga0070663_1002533602 149
182 3300005455 Ga0070663_100291514 Ga0070663_1002915142 149
183 3300005456 Ga0070678_100263088 Ga0070678_1002630882 149
184 3300005456 Ga0070678_101056184 Ga0070678_1010561842 149
185 3300005457 Ga0070662_100011397 Ga0070662_1000113973 149
186 3300005457 Ga0070662_100020558 Ga0070662_1000205582 149
187 3300005459 Ga0068867_100009094 Ga0068867_1000090949 149
188 3300005459 Ga0068867_100122153 Ga0068867_1001221532 149
189 3300005543 Ga0070672_100018795 Ga0070672_1000187957 149
190 3300005543 Ga0070672_100045180 Ga0070672_1000451806 149
191 3300005543 Ga0070672_100388613 Ga0070672_1003886132 149
192 3300005543 Ga0070672_100895673 Ga0070672_1008956731 149
193 3300005564 Ga0070664_100508668 Ga0070664_1005086682 149
194 3300005577 Ga0068857_100735870 Ga0068857_1007358702 149
195 3300005578 Ga0068854_100301762 Ga0068854_1003017621 149
196 3300005578 Ga0068854_101325280 Ga0068854_1013252801 149
197 3300005615 Ga0070702_100360973 Ga0070702_1003609732 149
198 3300005616 Ga0068852_100009536 Ga0068852_1000095367 149
199 3300005616 Ga0068852_100066624 Ga0068852_1000666244 149
200 3300005617 Ga0068859_100317087 Ga0068859_1003170872 149
201 3300005618 Ga0068864_100024738 Ga0068864_1000247382 149
202 3300005618 Ga0068864_100212888 Ga0068864_1002128882 149
203 3300005718 Ga0068866_10002302 Ga0068866_100023028 149
204 3300005719 Ga0068861_100026625 Ga0068861_1000266257 149
205 3300005834 Ga0068851_10052792 Ga0068851_100527923 149
206 3300005840 Ga0068870_10731064 Ga0068870_107310642 149
207 3300005841 Ga0068863_100021677 Ga0068863_1000216779 149
208 3300005842 Ga0068858_100021904 Ga0068858_1000219042 149
209 3300005844 Ga0068862_100009567 Ga0068862_1000095677 149
210 3300006353 Ga0075370_10001299 Ga0075370_100012992 149
211 3300006358 Ga0068871_100129244 Ga0068871_1001292444 149
212 3300006881 Ga0068865_100021423 Ga0068865_1000214237 149
213 3300006931 Ga0097620_100317082 Ga0097620_1003170824 149
214 3300009094 Ga0111539_10795944 Ga0111539_107959442 149
215 3300009098 Ga0105245_10043120 Ga0105245_100431204 149
216 3300009148 Ga0105243_10004458 Ga0105243_100044587 149
217 3300009176 Ga0105242_10003366 Ga0105242_100033667 149
218 3300009176 Ga0105242_10752783 Ga0105242_107527831 149
219 3300009177 Ga0105248_10002726 Ga0105248_1000272631 149
220 3300009553 Ga0105249_10018770 Ga0105249_1001877011 149
221 3300013104 Ga0157370_11046186 Ga0157370_110461861 149
222 3300013105 Ga0157369_10279568 Ga0157369_102795682 149
223 3300013296 Ga0157374_10207567 Ga0157374_102075673 149
224 3300013297 Ga0157378_10382139 Ga0157378_103821392 149
225 3300013306 Ga0163162_10005282 Ga0163162_100052827 149
226 3300013308 Ga0157375_10006696 Ga0157375_100066969 149
227 3300013308 Ga0157375_10998084 Ga0157375_109980842 149
228 3300013308 Ga0157375_11364429 Ga0157375_113644292 149
229 3300014326 Ga0157380_10035828 Ga0157380_100358284 149
230 3300014968 Ga0157379_10008418 Ga0157379_100084188 149
231 3300014968 Ga0157379_10540063 Ga0157379_105400632 149
232 3300017792 Ga0163161_10007699 Ga0163161_1000769910 149
233 3300025315 Ga0207697_10110124 Ga0207697_101101243 149
234 3300025321 Ga0207656_10107740 Ga0207656_101077402 149
235 3300025893 Ga0207682_10002098 Ga0207682_1000209817 149
236 3300025893 Ga0207682_10022241 Ga0207682_100222413 149
237 3300025899 Ga0207642_10003623 Ga0207642_100036237 149
238 3300025899 Ga0207642_10132546 Ga0207642_101325462 149
239 3300025903 Ga0207680_10002448 Ga0207680_100024487 149
240 3300025903 Ga0207680_10664064 Ga0207680_106640642 149
241 3300025907 Ga0207645_10000390 Ga0207645_1000039015 149
242 3300025908 Ga0207643_10062337 Ga0207643_100623371 149
243 3300025909 Ga0207705_10040425 Ga0207705_100404253 149
244 3300025918 Ga0207662_10036122 Ga0207662_100361224 149
245 3300025919 Ga0207657_10312769 Ga0207657_103127692 149
246 3300025923 Ga0207681_10003053 Ga0207681_100030539 149
247 3300025923 Ga0207681_10521195 Ga0207681_105211951 149
248 3300025924 Ga0207694_10623477 Ga0207694_106234772 149
249 3300025925 Ga0207650_10465725 Ga0207650_104657251 149
250 3300025926 Ga0207659_10005549 Ga0207659_100055497 149
251 3300025926 Ga0207659_10873057 Ga0207659_108730572 149
252 3300025927 Ga0207687_10017737 Ga0207687_100177372 149
253 3300025927 Ga0207687_11606065 Ga0207687_116060651 149
254 3300025931 Ga0207644_10170221 Ga0207644_101702212 149
255 3300025931 Ga0207644_10193461 Ga0207644_101934613 149
256 3300025931 Ga0207644_10199996 Ga0207644_101999962 149
257 3300025933 Ga0207706_10021208 Ga0207706_100212085 149
258 3300025933 Ga0207706_10034489 Ga0207706_100344897 149
259 3300025933 Ga0207706_10177582 Ga0207706_101775822 149
260 3300025934 Ga0207686_10036777 Ga0207686_100367774 149
261 3300025935 Ga0207709_10010315 Ga0207709_100103157 149
262 3300025936 Ga0207670_10294887 Ga0207670_102948872 149
263 3300025937 Ga0207669_10040385 Ga0207669_100403854 149
264 3300025937 Ga0207669_10879049 Ga0207669_108790491 149
265 3300025940 Ga0207691_10191785 Ga0207691_101917852 149
266 3300025941 Ga0207711_10069378 Ga0207711_100693784 149
267 3300025941 Ga0207711_10518639 Ga0207711_105186392 149
268 3300025942 Ga0207689_10004319 Ga0207689_1000431912 149
269 3300025945 Ga0207679_10256483 Ga0207679_102564832 149
270 3300025960 Ga0207651_10036296 Ga0207651_100362962 149
271 3300025960 Ga0207651_10149016 Ga0207651_101490163 149
272 3300025961 Ga0207712_10014950 Ga0207712_100149507 149
273 3300025981 Ga0207640_10192421 Ga0207640_101924212 149
274 3300025986 Ga0207658_10004261 Ga0207658_100042619 149
275 3300026023 Ga0207677_10047843 Ga0207677_100478434 149
276 3300026035 Ga0207703_10006227 Ga0207703_100062279 149
277 3300026067 Ga0207678_10157195 Ga0207678_101571952 149
278 3300026067 Ga0207678_10351765 Ga0207678_103517652 149
279 3300026075 Ga0207708_10049010 Ga0207708_100490107 149
280 3300026078 Ga0207702_11112371 Ga0207702_111123712 149
281 3300026088 Ga0207641_10011162 Ga0207641_100111629 149
282 3300026088 Ga0207641_10490547 Ga0207641_104905472 149
283 3300026089 Ga0207648_10001878 Ga0207648_100018787 149
284 3300026089 Ga0207648_10100996 Ga0207648_101009964 149
285 3300026095 Ga0207676_10049625 Ga0207676_100496252 149
286 3300026121 Ga0207683_10094897 Ga0207683_100948975 149
287 3300026121 Ga0207683_10697017 Ga0207683_106970172 149
288 3300026142 Ga0207698_10077352 Ga0207698_100773523 149
289 3300026142 Ga0207698_10081812 Ga0207698_100818124 149
290 3300028379 Ga0268266_10310396 Ga0268266_103103963 149
291 3300028380 Ga0268265_10027370 Ga0268265_100273707 149
292 3300028381 Ga0268264_10007375 Ga0268264_1000737513 149
293 3300046558 Ga0495633_0277200 Ga0495633_0277200_20_493 149
294 3300048903 Ga0496100_0316327 Ga0496100_0316327_518_991 149
295 3300048911 Ga0496108_0301709 Ga0496108_0301709_217_690 149
296 3300048917 Ga0496114_0248940 Ga0496114_0248940_714_1187 149
297 3300050496 nmdc:mga07m45_7089_c1 nmdc:mga07m45_7089_c1_5134_5619 149
298 3300050511 nmdc:mga08y16_516975_c1 nmdc:mga08y16_516975_c1_624_1097 149
299 3300005331 Ga0070670_100050076 Ga0070670_1000500763 150
300 3300005338 Ga0068868_100919094 Ga0068868_1009190942 150
301 3300005355 Ga0070671_100183888 Ga0070671_1001838883 150
302 3300005364 Ga0070673_100021066 Ga0070673_1000210663 150
303 3300005543 Ga0070672_100000880 Ga0070672_1000008809 150
304 3300005616 Ga0068852_100331352 Ga0068852_1003313522 150
305 3300005840 Ga0068870_10169352 Ga0068870_101693521 150
306 3300005842 Ga0068858_100794897 Ga0068858_1007948972 150
307 3300006237 Ga0097621_100014845 Ga0097621_1000148453 150
308 3300006237 Ga0097621_101525555 Ga0097621_1015255551 150
309 3300006846 Ga0075430_100518843 Ga0075430_1005188432 150
310 3300009545 Ga0105237_10027841 Ga0105237_100278412 150
311 3300013308 Ga0157375_10106559 Ga0157375_101065592 150
312 3300014969 Ga0157376_10061113 Ga0157376_100611134 150
313 3300017792 Ga0163161_10417682 Ga0163161_104176822 150
314 3300025914 Ga0207671_10258530 Ga0207671_102585302 150
315 3300025926 Ga0207659_10151244 Ga0207659_101512442 150
316 3300025931 Ga0207644_10171198 Ga0207644_101711982 150
317 3300025940 Ga0207691_10000754 Ga0207691_100007544 150
318 3300025940 Ga0207691_10704529 Ga0207691_107045292 150
319 3300025960 Ga0207651_10034239 Ga0207651_100342394 150
320 3300026035 Ga0207703_10554709 Ga0207703_105547091 150
321 3300026088 Ga0207641_11018384 Ga0207641_110183842 150
322 3300026121 Ga0207683_10021024 Ga0207683_100210245 150
323 3300031507 Ga0307509_10645871 Ga0307509_106458711 150
324 3300031616 Ga0307508_10434910 Ga0307508_104349101 150
325 3300031649 Ga0307514_10001108 Ga0307514_1000110823 150
326 3300037471 Ga0395905_0018536 Ga0395905_0018536_3593_4087 150
327 3300045051 Ga0451576_1258518 Ga0451576_1258518_16_507 150
328 3300046507 Ga0495606_0207215 Ga0495606_0207215_551_1027 150
329 3300047472 Ga0495686_0504999 Ga0495686_0504999_29_502 150
330 3300053086 Ga0500578_0036160 Ga0500578_0036160_502_978 150
331 3300053155 Ga0500620_236142 Ga0500620_236142_50_526 150
332 3300053156 Ga0500622_0000912 Ga0500622_0000912_24207_24680 150
333 3300053730 Ga0500645_002335 Ga0500645_002335_5738_6214 150
334 3300053736 Ga0500599_023863 Ga0500599_023863_177_650 150
335 3300031730 Ga0307516_10005205 Ga0307516_100052059 151
336 3300039447 Ga0436361_0060434 Ga0436361_0060434_59639_60145 151
337 3300042876 Ga0451577_0164222 Ga0451577_0164222_221_700 151
338 3300045051 Ga0451576_0088027 Ga0451576_0088027_850_1329 151
339 3300049584 Ga0501068_0833844 Ga0501068_0833844_75_560 151
340 3300054114 Ga0501084_0692997 Ga0501084_0692997_351_836 151
341 3300003771 Ga0055526_1007520 Ga0055526_10075207 152
342 3300003773 Ga0055537_1004370 Ga0055537_10043704 152
343 3300003784 Ga0055534_1002719 Ga0055534_10027198 152
344 3300003790 Ga0055528_1000387 Ga0055528_100038726 152
345 3300025263 Ga0209565_1000722 Ga0209565_100072224 152
346 3300025273 Ga0209673_1000019 Ga0209673_1000019385 152
347 3300025291 Ga0209675_1000846 Ga0209675_100084624 152
348 3300025295 Ga0209564_1001779 Ga0209564_10017794 152
349 3300025299 Ga0209256_1000093 Ga0209256_100009324 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

66

148

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.8467 45 129
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.8466 45 129
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.8447 45 129
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.832 45 129
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.8288 45 129
ID Description Score Start End Superfamily
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.831 45 129 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7967 44 129 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7877 45 129 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7212 45 129 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7021 44 129 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2S8H2P9-F1-model_v4 deleted 0.991 19 150
AF-A0A0Q6W0F4-F1-model_v4 YCII-related domain-containing protein 0.9875 22 150
AF-A0A844AWU8-F1-model_v4 YCII-related domain-containing protein 0.9866 15 150
AF-A0A2G8TIH0-F1-model_v4 YCII-related domain-containing protein 0.9829 23 151
AF-A0A643FE06-F1-model_v4 YCII-related domain-containing protein 0.9824 19 152

Feature Viewer

pLDDT pTM Quality
90.55 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map