F417924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 207 | 347 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_10704529|Ga0207691_107045292 |
| Length | 174 |
| Sequence | MPVSAVASADPNREEPWVRTTIAFLALLALATALPSVAQSPASAPKPVFDEALAKSVGADERGMRAYVLVILKTGPNKVPDGAERDEMFKGHFANIKRLAAEGKLAVAGPLDGVDGWRGLYIFAVPEIDEARKLVASDPVVMKGEMVPEFHKYYGAATLMLVNEAYPRVTKKPM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 3 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 141 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 151 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 194 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 195 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 199 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 202 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 203 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 204 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 206 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 207 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.3 |
| Nodule | 0 |
| Rhizoplane | 2.29 |
| Rhizosphere | 89.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1007520 | 3300003771 | Bacteria | 5638 |
| 2 | Ga0055537_1004370 | 3300003773 | Bacteria | 4055 |
| 3 | Ga0055534_1002719 | 3300003784 | Bacteria | 5958 |
| 4 | Ga0055528_1000387 | 3300003790 | Bacteria | 35861 |
| 5 | Ga0070658_10756447 | 3300005327 | Bacteria | 844 |
| 6 | Ga0070676_10002556 | 3300005328 | Bacteria | 9355 |
| 7 | Ga0070676_10073127 | 3300005328 | Bacteria | 2062 |
| 8 | Ga0070690_100033945 | 3300005330 | Bacteria | 3196 |
| 9 | Ga0070670_100050076 | 3300005331 | Bacteria | 3590 |
| 10 | Ga0070670_100055963 | 3300005331 | Bacteria | 3385 |
| 11 | Ga0070670_100207390 | 3300005331 | Bacteria | 1703 |
| 12 | Ga0070670_100256245 | 3300005331 | Bacteria | 1525 |
| 13 | Ga0070670_100430131 | 3300005331 | Bacteria | 1168 |
| 14 | Ga0070670_101927920 | 3300005331 | Unclassified | 544 |
| 15 | Ga0070677_10024190 | 3300005333 | Bacteria | 2256 |
| 16 | Ga0070677_10048436 | 3300005333 | Bacteria | 1708 |
| 17 | Ga0070677_10062389 | 3300005333 | Bacteria | 1541 |
| 18 | Ga0068869_100010507 | 3300005334 | Bacteria | 6039 |
| 19 | Ga0070666_10000383 | 3300005335 | Bacteria | 27824 |
| 20 | Ga0070666_11402188 | 3300005335 | Bacteria | 522 |
| 21 | Ga0068868_100063306 | 3300005338 | Bacteria | 2934 |
| 22 | Ga0068868_100088808 | 3300005338 | Bacteria | 2488 |
| 23 | Ga0068868_100919094 | 3300005338 | Bacteria | 796 |
| 24 | Ga0070689_101317599 | 3300005340 | Bacteria | 651 |
| 25 | Ga0070687_100003187 | 3300005343 | Bacteria | 6336 |
| 26 | Ga0070668_100009101 | 3300005347 | Bacteria | 7375 |
| 27 | Ga0070668_100053919 | 3300005347 | Bacteria | 3101 |
| 28 | Ga0070669_100004393 | 3300005353 | Bacteria | 10176 |
| 29 | Ga0070669_100024902 | 3300005353 | Bacteria | 4295 |
| 30 | Ga0070669_100105717 | 3300005353 | Bacteria | 2130 |
| 31 | Ga0070669_100106268 | 3300005353 | Bacteria | 2124 |
| 32 | Ga0070669_100426990 | 3300005353 | Bacteria | 1089 |
| 33 | Ga0070675_100013976 | 3300005354 | Bacteria | 6320 |
| 34 | Ga0070675_100610579 | 3300005354 | Bacteria | 990 |
| 35 | Ga0070671_100183888 | 3300005355 | Unclassified | 1770 |
| 36 | Ga0070671_100184625 | 3300005355 | Bacteria | 1766 |
| 37 | Ga0070671_100243842 | 3300005355 | Bacteria | 1526 |
| 38 | Ga0070671_100530126 | 3300005355 | Unclassified | 1014 |
| 39 | Ga0070674_100007593 | 3300005356 | Bacteria | 6403 |
| 40 | Ga0070673_100021066 | 3300005364 | Bacteria | 4716 |
| 41 | Ga0070673_100145742 | 3300005364 | Bacteria | 2001 |
| 42 | Ga0070673_100259837 | 3300005364 | Bacteria | 1517 |
| 43 | Ga0070688_100300553 | 3300005365 | Bacteria | 1160 |
| 44 | Ga0070659_100870797 | 3300005366 | Bacteria | 786 |
| 45 | Ga0070667_100008041 | 3300005367 | Bacteria | 8748 |
| 46 | Ga0070667_100683762 | 3300005367 | Bacteria | 949 |
| 47 | Ga0070667_100816522 | 3300005367 | Bacteria | 866 |
| 48 | Ga0070700_100007731 | 3300005441 | Bacteria | 5821 |
| 49 | Ga0070700_101188373 | 3300005441 | Bacteria | 636 |
| 50 | Ga0070663_100188058 | 3300005455 | Bacteria | 1606 |
| 51 | Ga0070663_100253360 | 3300005455 | Bacteria | 1394 |
| 52 | Ga0070663_100291514 | 3300005455 | Bacteria | 1303 |
| 53 | Ga0070678_100263088 | 3300005456 | Bacteria | 1451 |
| 54 | Ga0070678_101056184 | 3300005456 | Bacteria | 748 |
| 55 | Ga0070662_100011397 | 3300005457 | Bacteria | 5867 |
| 56 | Ga0070662_100020558 | 3300005457 | Bacteria | 4497 |
| 57 | Ga0070662_100524825 | 3300005457 | Bacteria | 990 |
| 58 | Ga0070681_10128994 | 3300005458 | Unclassified | 2461 |
| 59 | Ga0068867_100009094 | 3300005459 | Bacteria | 7010 |
| 60 | Ga0068867_100122153 | 3300005459 | Bacteria | 2014 |
| 61 | Ga0068867_100737795 | 3300005459 | Bacteria | 872 |
| 62 | Ga0068867_100880009 | 3300005459 | Bacteria | 804 |
| 63 | Ga0070679_100061518 | 3300005530 | Bacteria | 3742 |
| 64 | Ga0068853_100000815 | 3300005539 | Bacteria | 21746 |
| 65 | Ga0070672_100000880 | 3300005543 | Bacteria | 17997 |
| 66 | Ga0070672_100018795 | 3300005543 | Bacteria | 5004 |
| 67 | Ga0070672_100045180 | 3300005543 | Bacteria | 3405 |
| 68 | Ga0070672_100069692 | 3300005543 | Bacteria | 2793 |
| 69 | Ga0070672_100226682 | 3300005543 | Bacteria | 1569 |
| 70 | Ga0070672_100388613 | 3300005543 | Bacteria | 1194 |
| 71 | Ga0070672_100895673 | 3300005543 | Bacteria | 784 |
| 72 | Ga0070693_100963062 | 3300005547 | Bacteria | 643 |
| 73 | Ga0070665_100362279 | 3300005548 | Bacteria | 1456 |
| 74 | Ga0068855_100354514 | 3300005563 | Bacteria | 1616 |
| 75 | Ga0070664_100480002 | 3300005564 | Bacteria | 1144 |
| 76 | Ga0070664_100508668 | 3300005564 | Bacteria | 1111 |
| 77 | Ga0068857_100735870 | 3300005577 | Bacteria | 939 |
| 78 | Ga0068854_100301762 | 3300005578 | Bacteria | 1296 |
| 79 | Ga0068854_101325280 | 3300005578 | Bacteria | 649 |
| 80 | Ga0070702_100360973 | 3300005615 | Bacteria | 1027 |
| 81 | Ga0068852_100009536 | 3300005616 | Bacteria | 7214 |
| 82 | Ga0068852_100066624 | 3300005616 | Bacteria | 3145 |
| 83 | Ga0068852_100331352 | 3300005616 | Bacteria | 1481 |
| 84 | Ga0068852_100574438 | 3300005616 | Bacteria | 1130 |
| 85 | Ga0068859_100317087 | 3300005617 | Bacteria | 1653 |
| 86 | Ga0068864_100024738 | 3300005618 | Bacteria | 5052 |
| 87 | Ga0068864_100212888 | 3300005618 | Bacteria | 1780 |
| 88 | Ga0068864_100513877 | 3300005618 | Bacteria | 1154 |
| 89 | Ga0068866_10002302 | 3300005718 | Bacteria | 7911 |
| 90 | Ga0068861_100026625 | 3300005719 | Bacteria | 4206 |
| 91 | Ga0068851_10052792 | 3300005834 | Bacteria | 2067 |
| 92 | Ga0068851_10155020 | 3300005834 | Bacteria | 1254 |
| 93 | Ga0068870_10169352 | 3300005840 | Bacteria | 1302 |
| 94 | Ga0068870_10731064 | 3300005840 | Bacteria | 686 |
| 95 | Ga0068863_100021677 | 3300005841 | Bacteria | 6128 |
| 96 | Ga0068863_101362343 | 3300005841 | Bacteria | 717 |
| 97 | Ga0068858_100021904 | 3300005842 | Bacteria | 5968 |
| 98 | Ga0068858_100794897 | 3300005842 | Bacteria | 923 |
| 99 | Ga0068858_102267914 | 3300005842 | Bacteria | 537 |
| 100 | Ga0068860_100016513 | 3300005843 | Bacteria | 7200 |
| 101 | Ga0068860_101873774 | 3300005843 | Bacteria | 621 |
| 102 | Ga0068862_100009567 | 3300005844 | Bacteria | 8015 |
| 103 | Ga0075365_10904568 | 3300006038 | Bacteria | 622 |
| 104 | Ga0097621_100014845 | 3300006237 | Bacteria | 5843 |
| 105 | Ga0097621_101525555 | 3300006237 | Bacteria | 634 |
| 106 | Ga0075370_10001299 | 3300006353 | Bacteria | 10684 |
| 107 | Ga0068871_100129244 | 3300006358 | Bacteria | 2140 |
| 108 | Ga0068871_100591836 | 3300006358 | Bacteria | 1008 |
| 109 | Ga0075430_100518843 | 3300006846 | Bacteria | 983 |
| 110 | Ga0068865_100021423 | 3300006881 | Bacteria | 4202 |
| 111 | Ga0097620_100317082 | 3300006931 | Bacteria | 1653 |
| 112 | Ga0105250_10000091 | 3300009092 | Bacteria | 80262 |
| 113 | Ga0111539_10125153 | 3300009094 | Bacteria | 3012 |
| 114 | Ga0111539_10795944 | 3300009094 | Bacteria | 1100 |
| 115 | Ga0105245_10043120 | 3300009098 | Bacteria | 4025 |
| 116 | Ga0105243_10004458 | 3300009148 | Bacteria | 11067 |
| 117 | Ga0105242_10003366 | 3300009176 | Bacteria | 12448 |
| 118 | Ga0105242_10752783 | 3300009176 | Bacteria | 959 |
| 119 | Ga0105248_10002726 | 3300009177 | Bacteria | 19624 |
| 120 | Ga0105237_10027841 | 3300009545 | Bacteria | 5759 |
| 121 | Ga0105237_10888603 | 3300009545 | Bacteria | 898 |
| 122 | Ga0105249_10018770 | 3300009553 | Bacteria | 6161 |
| 123 | Ga0105239_10180972 | 3300010375 | Bacteria | 2359 |
| 124 | Ga0157370_11046186 | 3300013104 | Bacteria | 738 |
| 125 | Ga0157369_10279568 | 3300013105 | Bacteria | 1739 |
| 126 | Ga0157374_10207567 | 3300013296 | Bacteria | 1920 |
| 127 | Ga0157378_10382139 | 3300013297 | Bacteria | 1383 |
| 128 | Ga0163162_10005282 | 3300013306 | Bacteria | 12464 |
| 129 | Ga0157375_10006696 | 3300013308 | Bacteria | 10035 |
| 130 | Ga0157375_10106559 | 3300013308 | Bacteria | 2895 |
| 131 | Ga0157375_10598178 | 3300013308 | Bacteria | 1262 |
| 132 | Ga0157375_10998084 | 3300013308 | Bacteria | 977 |
| 133 | Ga0157375_11364429 | 3300013308 | Bacteria | 834 |
| 134 | Ga0157380_10035828 | 3300014326 | Bacteria | 3835 |
| 135 | Ga0157380_10435606 | 3300014326 | Bacteria | 1255 |
| 136 | Ga0157380_11474938 | 3300014326 | Bacteria | 733 |
| 137 | Ga0157380_12316333 | 3300014326 | Bacteria | 602 |
| 138 | Ga0157379_10008418 | 3300014968 | Bacteria | 8966 |
| 139 | Ga0157379_10540063 | 3300014968 | Bacteria | 1084 |
| 140 | Ga0157376_10061113 | 3300014969 | Bacteria | 3166 |
| 141 | Ga0163161_10007699 | 3300017792 | Bacteria | 7450 |
| 142 | Ga0163161_10417682 | 3300017792 | Bacteria | 1079 |
| 143 | Ga0213872_10000023 | 3300021361 | Bacteria | 157443 |
| 144 | Ga0213872_10141062 | 3300021361 | Bacteria | 1057 |
| 145 | Ga0209565_1000722 | 3300025263 | Bacteria | 20001 |
| 146 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 147 | Ga0209675_1000846 | 3300025291 | Bacteria | 20002 |
| 148 | Ga0209564_1001779 | 3300025295 | Bacteria | 19960 |
| 149 | Ga0209256_1000093 | 3300025299 | Bacteria | 209318 |
| 150 | Ga0209051_1009919 | 3300025303 | Bacteria | 4860 |
| 151 | Ga0207697_10110124 | 3300025315 | Bacteria | 1179 |
| 152 | Ga0207656_10107740 | 3300025321 | Bacteria | 1284 |
| 153 | Ga0207656_10111386 | 3300025321 | Bacteria | 1265 |
| 154 | Ga0207696_1001282 | 3300025711 | Bacteria | 14019 |
| 155 | Ga0207682_10002098 | 3300025893 | Bacteria | 9032 |
| 156 | Ga0207682_10022241 | 3300025893 | Bacteria | 2497 |
| 157 | Ga0207642_10003623 | 3300025899 | Bacteria | 4901 |
| 158 | Ga0207642_10132546 | 3300025899 | Bacteria | 1303 |
| 159 | Ga0207688_10218079 | 3300025901 | Bacteria | 1148 |
| 160 | Ga0207680_10002448 | 3300025903 | Bacteria | 8658 |
| 161 | Ga0207680_10664064 | 3300025903 | Bacteria | 747 |
| 162 | Ga0207647_10016181 | 3300025904 | Bacteria | 5092 |
| 163 | Ga0207645_10000390 | 3300025907 | Bacteria | 36191 |
| 164 | Ga0207645_10082253 | 3300025907 | Bacteria | 2064 |
| 165 | Ga0207645_10618115 | 3300025907 | Bacteria | 736 |
| 166 | Ga0207643_10062337 | 3300025908 | Bacteria | 2131 |
| 167 | Ga0207705_10040425 | 3300025909 | Bacteria | 3345 |
| 168 | Ga0207707_10062589 | 3300025912 | Bacteria | 3238 |
| 169 | Ga0207671_10258530 | 3300025914 | Bacteria | 1370 |
| 170 | Ga0207662_10036122 | 3300025918 | Bacteria | 2887 |
| 171 | Ga0207657_10312769 | 3300025919 | Bacteria | 1243 |
| 172 | Ga0207681_10003053 | 3300025923 | Bacteria | 10524 |
| 173 | Ga0207681_10149799 | 3300025923 | Bacteria | 1747 |
| 174 | Ga0207681_10255484 | 3300025923 | Bacteria | 1370 |
| 175 | Ga0207681_10521195 | 3300025923 | Bacteria | 975 |
| 176 | Ga0207694_10623477 | 3300025924 | Bacteria | 908 |
| 177 | Ga0207650_10177637 | 3300025925 | Bacteria | 1695 |
| 178 | Ga0207650_10465725 | 3300025925 | Bacteria | 1053 |
| 179 | Ga0207659_10005549 | 3300025926 | Bacteria | 7655 |
| 180 | Ga0207659_10151244 | 3300025926 | Bacteria | 1813 |
| 181 | Ga0207659_10873057 | 3300025926 | Bacteria | 773 |
| 182 | Ga0207687_10017737 | 3300025927 | Bacteria | 4692 |
| 183 | Ga0207687_11606065 | 3300025927 | Bacteria | 558 |
| 184 | Ga0207644_10170221 | 3300025931 | Bacteria | 1700 |
| 185 | Ga0207644_10171198 | 3300025931 | Unclassified | 1695 |
| 186 | Ga0207644_10193461 | 3300025931 | Bacteria | 1600 |
| 187 | Ga0207644_10199996 | 3300025931 | Unclassified | 1576 |
| 188 | Ga0207706_10021208 | 3300025933 | Bacteria | 5837 |
| 189 | Ga0207706_10034489 | 3300025933 | Bacteria | 4502 |
| 190 | Ga0207706_10177582 | 3300025933 | Bacteria | 1871 |
| 191 | Ga0207706_10445608 | 3300025933 | Bacteria | 1120 |
| 192 | Ga0207686_10036777 | 3300025934 | Bacteria | 2950 |
| 193 | Ga0207709_10010315 | 3300025935 | Bacteria | 5146 |
| 194 | Ga0207670_10294887 | 3300025936 | Bacteria | 1268 |
| 195 | Ga0207669_10040385 | 3300025937 | Bacteria | 2706 |
| 196 | Ga0207669_10879049 | 3300025937 | Bacteria | 747 |
| 197 | Ga0207691_10000754 | 3300025940 | Bacteria | 31954 |
| 198 | Ga0207691_10099396 | 3300025940 | Bacteria | 2598 |
| 199 | Ga0207691_10191785 | 3300025940 | Bacteria | 1782 |
| 200 | Ga0207691_10704529 | 3300025940 | Bacteria | 851 |
| 201 | Ga0207711_10069378 | 3300025941 | Bacteria | 3055 |
| 202 | Ga0207711_10518639 | 3300025941 | Bacteria | 1111 |
| 203 | Ga0207689_10004319 | 3300025942 | Bacteria | 12943 |
| 204 | Ga0207679_10138698 | 3300025945 | Bacteria | 1962 |
| 205 | Ga0207679_10256483 | 3300025945 | Bacteria | 1489 |
| 206 | Ga0207679_10880312 | 3300025945 | Bacteria | 819 |
| 207 | Ga0207667_10062567 | 3300025949 | Bacteria | 3891 |
| 208 | Ga0207651_10034239 | 3300025960 | Bacteria | 3287 |
| 209 | Ga0207651_10036296 | 3300025960 | Bacteria | 3216 |
| 210 | Ga0207651_10149016 | 3300025960 | Bacteria | 1818 |
| 211 | Ga0207712_10014950 | 3300025961 | Bacteria | 5000 |
| 212 | Ga0207668_10002995 | 3300025972 | Bacteria | 9900 |
| 213 | Ga0207668_10269975 | 3300025972 | Bacteria | 1390 |
| 214 | Ga0207668_10499480 | 3300025972 | Bacteria | 1046 |
| 215 | Ga0207640_10192421 | 3300025981 | Bacteria | 1539 |
| 216 | Ga0207658_10004261 | 3300025986 | Bacteria | 9965 |
| 217 | Ga0207677_10047843 | 3300026023 | Bacteria | 2875 |
| 218 | Ga0207677_10275495 | 3300026023 | Unclassified | 1378 |
| 219 | Ga0207703_10006227 | 3300026035 | Bacteria | 9550 |
| 220 | Ga0207703_10554709 | 3300026035 | Bacteria | 1084 |
| 221 | Ga0207639_10002409 | 3300026041 | Bacteria | 12560 |
| 222 | Ga0207678_10141745 | 3300026067 | Bacteria | 2051 |
| 223 | Ga0207678_10157195 | 3300026067 | Bacteria | 1941 |
| 224 | Ga0207678_10351765 | 3300026067 | Bacteria | 1271 |
| 225 | Ga0207708_10049010 | 3300026075 | Bacteria | 3216 |
| 226 | Ga0207702_11112371 | 3300026078 | Bacteria | 784 |
| 227 | Ga0207641_10011162 | 3300026088 | Bacteria | 7368 |
| 228 | Ga0207641_10490547 | 3300026088 | Bacteria | 1192 |
| 229 | Ga0207641_10748541 | 3300026088 | Unclassified | 965 |
| 230 | Ga0207641_11018384 | 3300026088 | Bacteria | 825 |
| 231 | Ga0207648_10001878 | 3300026089 | Bacteria | 22968 |
| 232 | Ga0207648_10100996 | 3300026089 | Bacteria | 2528 |
| 233 | Ga0207648_10236780 | 3300026089 | Bacteria | 1625 |
| 234 | Ga0207676_10049625 | 3300026095 | Bacteria | 3266 |
| 235 | Ga0207674_10354177 | 3300026116 | Bacteria | 1419 |
| 236 | Ga0207675_100023619 | 3300026118 | Bacteria | 5720 |
| 237 | Ga0207683_10021024 | 3300026121 | Bacteria | 5585 |
| 238 | Ga0207683_10094897 | 3300026121 | Bacteria | 2659 |
| 239 | Ga0207683_10697017 | 3300026121 | Bacteria | 941 |
| 240 | Ga0207698_10075976 | 3300026142 | Bacteria | 2687 |
| 241 | Ga0207698_10077352 | 3300026142 | Bacteria | 2668 |
| 242 | Ga0207698_10081812 | 3300026142 | Bacteria | 2608 |
| 243 | Ga0268266_10310396 | 3300028379 | Bacteria | 1474 |
| 244 | Ga0268266_10727846 | 3300028379 | Bacteria | 957 |
| 245 | Ga0268265_10027370 | 3300028380 | Bacteria | 4068 |
| 246 | Ga0268264_10007375 | 3300028381 | Bacteria | 9186 |
| 247 | Ga0268264_10123476 | 3300028381 | Bacteria | 2285 |
| 248 | Ga0307509_10645871 | 3300031507 | Bacteria | 727 |
| 249 | Ga0307408_100000488 | 3300031548 | Bacteria | 34667 |
| 250 | Ga0307408_100624654 | 3300031548 | Bacteria | 960 |
| 251 | Ga0307508_10434910 | 3300031616 | Unclassified | 904 |
| 252 | Ga0307514_10001108 | 3300031649 | Bacteria | 37572 |
| 253 | Ga0307516_10005205 | 3300031730 | Bacteria | 15661 |
| 254 | Ga0307405_10188093 | 3300031731 | Bacteria | 1489 |
| 255 | Ga0307416_100086832 | 3300032002 | Bacteria | 2668 |
| 256 | Ga0307416_100194479 | 3300032002 | Bacteria | 1917 |
| 257 | Ga0307416_100363811 | 3300032002 | Bacteria | 1470 |
| 258 | Ga0307416_101561014 | 3300032002 | Bacteria | 766 |
| 259 | Ga0395900_0542792 | 3300037418 | Unclassified | 1108 |
| 260 | Ga0395905_0018536 | 3300037471 | Bacteria | 6605 |
| 261 | Ga0395905_0022963 | 3300037471 | Bacteria | 5895 |
| 262 | Ga0436361_0060434 | 3300039447 | Bacteria | 165633 |
| 263 | Ga0436361_0280984 | 3300039447 | Bacteria | 782 |
| 264 | Ga0436361_0350152 | 3300039447 | Bacteria | 1447 |
| 265 | Ga0436361_0424027 | 3300039447 | Bacteria | 1097 |
| 266 | Ga0436361_1144678 | 3300039447 | Bacteria | 1585 |
| 267 | Ga0451800_0417252 | 3300041459 | Bacteria | 759 |
| 268 | Ga0451807_0290195 | 3300041486 | Bacteria | 775 |
| 269 | Ga0451843_0194517 | 3300041509 | Bacteria | 750 |
| 270 | Ga0451853_1309748 | 3300041512 | Bacteria | 882 |
| 271 | Ga0451577_0164222 | 3300042876 | Bacteria | 2000 |
| 272 | Ga0453684_0149696 | 3300044712 | Bacteria | 2775 |
| 273 | Ga0451576_0088027 | 3300045051 | Bacteria | 3230 |
| 274 | Ga0451576_1258518 | 3300045051 | Bacteria | 772 |
| 275 | Ga0495584_0040274 | 3300046491 | Bacteria | 2359 |
| 276 | Ga0495585_0000501 | 3300046492 | Bacteria | 37082 |
| 277 | Ga0495585_0112915 | 3300046492 | Bacteria | 1443 |
| 278 | Ga0495585_0155074 | 3300046492 | Bacteria | 1192 |
| 279 | Ga0495596_0010942 | 3300046500 | Bacteria | 3930 |
| 280 | Ga0495596_0020926 | 3300046500 | Bacteria | 2674 |
| 281 | Ga0495583_0043409 | 3300046506 | Bacteria | 2093 |
| 282 | Ga0495606_0003529 | 3300046507 | Bacteria | 16533 |
| 283 | Ga0495606_0082376 | 3300046507 | Unclassified | 1997 |
| 284 | Ga0495606_0207215 | 3300046507 | Bacteria | 1113 |
| 285 | Ga0495616_0008827 | 3300046513 | Bacteria | 5932 |
| 286 | Ga0495616_0318940 | 3300046513 | Unclassified | 653 |
| 287 | Ga0495631_0007784 | 3300046518 | Bacteria | 5435 |
| 288 | Ga0495631_0059284 | 3300046518 | Bacteria | 1663 |
| 289 | Ga0495648_0213649 | 3300046524 | Bacteria | 956 |
| 290 | Ga0495663_0060225 | 3300046525 | Bacteria | 1192 |
| 291 | Ga0495642_0002200 | 3300046528 | Bacteria | 7994 |
| 292 | Ga0495642_0013090 | 3300046528 | Bacteria | 3204 |
| 293 | Ga0495642_0067826 | 3300046528 | Bacteria | 1488 |
| 294 | Ga0495642_0084495 | 3300046528 | Bacteria | 1339 |
| 295 | Ga0495609_0010750 | 3300046538 | Bacteria | 4379 |
| 296 | Ga0495609_0080994 | 3300046538 | Bacteria | 1419 |
| 297 | Ga0495633_0107834 | 3300046558 | Unclassified | 1291 |
| 298 | Ga0495633_0277200 | 3300046558 | Bacteria | 763 |
| 299 | Ga0495656_0453906 | 3300046615 | Bacteria | 675 |
| 300 | Ga0495668_0047799 | 3300046616 | Bacteria | 2375 |
| 301 | Ga0495668_0144371 | 3300046616 | Bacteria | 1302 |
| 302 | Ga0495668_0302097 | 3300046616 | Bacteria | 877 |
| 303 | Ga0495661_0035804 | 3300046665 | Bacteria | 3113 |
| 304 | Ga0495670_0170383 | 3300046691 | Bacteria | 1146 |
| 305 | Ga0495671_0029536 | 3300046692 | Bacteria | 2814 |
| 306 | Ga0495671_0133898 | 3300046692 | Bacteria | 1208 |
| 307 | Ga0495649_0038043 | 3300046694 | Bacteria | 2641 |
| 308 | Ga0495589_0019180 | 3300046794 | Bacteria | 3509 |
| 309 | Ga0495660_0007977 | 3300046810 | Bacteria | 6219 |
| 310 | Ga0495660_0042728 | 3300046810 | Bacteria | 2503 |
| 311 | Ga0495676_0148777 | 3300047321 | Bacteria | 1669 |
| 312 | Ga0495683_0049469 | 3300047323 | Bacteria | 2105 |
| 313 | Ga0495687_000115 | 3300047443 | Bacteria | 122883 |
| 314 | Ga0495681_0015958 | 3300047470 | Bacteria | 4235 |
| 315 | Ga0495686_0032740 | 3300047472 | Bacteria | 3362 |
| 316 | Ga0495686_0504999 | 3300047472 | Unclassified | 636 |
| 317 | Ga0495626_0015989 | 3300048091 | Bacteria | 3825 |
| 318 | Ga0496100_0240508 | 3300048903 | Bacteria | 1335 |
| 319 | Ga0496100_0316327 | 3300048903 | Bacteria | 1172 |
| 320 | Ga0496102_0000196 | 3300048905 | Bacteria | 82747 |
| 321 | Ga0496108_0301709 | 3300048911 | Bacteria | 1395 |
| 322 | Ga0496109_1721866 | 3300048912 | Bacteria | 560 |
| 323 | Ga0496114_0248940 | 3300048917 | Bacteria | 1564 |
| 324 | Ga0501304_040737 | 3300049160 | Bacteria | 518 |
| 325 | Ga0495678_000622 | 3300049459 | Bacteria | 32958 |
| 326 | Ga0495678_002745 | 3300049459 | Bacteria | 11549 |
| 327 | Ga0495682_0000578 | 3300049460 | Bacteria | 24806 |
| 328 | Ga0501034_0007048 | 3300049571 | Bacteria | 11989 |
| 329 | Ga0501067_0208677 | 3300049583 | Bacteria | 1088 |
| 330 | Ga0501068_0833844 | 3300049584 | Unclassified | 605 |
| 331 | Ga0501076_1503205 | 3300049592 | Bacteria | 553 |
| 332 | Ga0501257_023704 | 3300049686 | Bacteria | 1456 |
| 333 | Ga0501265_001951 | 3300049762 | Bacteria | 2351 |
| 334 | nmdc:mga07m45_7089_c1 | 3300050496 | Bacteria | 5707 |
| 335 | nmdc:mga08y16_516975_c1 | 3300050511 | Bacteria | 1211 |
| 336 | nmdc:mga08y16_831172_c1 | 3300050511 | Bacteria | 914 |
| 337 | nmdc:mga0a205_386631_c1 | 3300050515 | Bacteria | 1264 |
| 338 | Ga0500578_0036160 | 3300053086 | Bacteria | 3173 |
| 339 | Ga0500644_0003607 | 3300053088 | Bacteria | 3840 |
| 340 | Ga0500594_0177130 | 3300053118 | Unclassified | 694 |
| 341 | Ga0500559_0000422 | 3300053136 | Bacteria | 30315 |
| 342 | Ga0500620_236142 | 3300053155 | Bacteria | 613 |
| 343 | Ga0500622_0000912 | 3300053156 | Bacteria | 25132 |
| 344 | Ga0500645_002335 | 3300053730 | Bacteria | 8541 |
| 345 | Ga0500599_023863 | 3300053736 | Unclassified | 880 |
| 346 | Ga0500587_001651 | 3300053739 | Unclassified | 3171 |
| 347 | Ga0501084_0692997 | 3300054114 | Unclassified | 859 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10141745 | Ga0207678_101417451 | 134 |
| 2 | 3300005458 | Ga0070681_10128994 | Ga0070681_101289943 | 136 |
| 3 | 3300005530 | Ga0070679_100061518 | Ga0070679_1000615182 | 136 |
| 4 | 3300025912 | Ga0207707_10062589 | Ga0207707_100625893 | 136 |
| 5 | 3300053088 | Ga0500644_0003607 | Ga0500644_0003607_778_1200 | 137 |
| 6 | 3300053118 | Ga0500594_0177130 | Ga0500594_0177130_110_532 | 137 |
| 7 | 3300053136 | Ga0500559_0000422 | Ga0500559_0000422_25479_25901 | 137 |
| 8 | 3300053739 | Ga0500587_001651 | Ga0500587_001651_348_770 | 137 |
| 9 | 3300037471 | Ga0395905_0022963 | Ga0395905_0022963_2541_2990 | 138 |
| 10 | 3300046615 | Ga0495656_0453906 | Ga0495656_0453906_235_660 | 138 |
| 11 | 3300048903 | Ga0496100_0240508 | Ga0496100_0240508_22_456 | 139 |
| 12 | 3300032002 | Ga0307416_100086832 | Ga0307416_1000868322 | 141 |
| 13 | 3300049762 | Ga0501265_001951 | Ga0501265_001951_109_615 | 141 |
| 14 | 3300014326 | Ga0157380_12316333 | Ga0157380_123163331 | 142 |
| 15 | 3300037418 | Ga0395900_0542792 | Ga0395900_0542792_90_527 | 142 |
| 16 | 3300041459 | Ga0451800_0417252 | Ga0451800_0417252_180_608 | 142 |
| 17 | 3300041512 | Ga0451853_1309748 | Ga0451853_1309748_391_819 | 142 |
| 18 | 3300046491 | Ga0495584_0040274 | Ga0495584_0040274_1179_1622 | 142 |
| 19 | 3300046492 | Ga0495585_0000501 | Ga0495585_0000501_8648_9091 | 142 |
| 20 | 3300046492 | Ga0495585_0112915 | Ga0495585_0112915_449_892 | 142 |
| 21 | 3300046492 | Ga0495585_0155074 | Ga0495585_0155074_110_553 | 142 |
| 22 | 3300046507 | Ga0495606_0003529 | Ga0495606_0003529_7219_7662 | 142 |
| 23 | 3300046518 | Ga0495631_0059284 | Ga0495631_0059284_534_977 | 142 |
| 24 | 3300046528 | Ga0495642_0002200 | Ga0495642_0002200_4042_4485 | 142 |
| 25 | 3300046528 | Ga0495642_0013090 | Ga0495642_0013090_65_508 | 142 |
| 26 | 3300046528 | Ga0495642_0067826 | Ga0495642_0067826_120_563 | 142 |
| 27 | 3300046538 | Ga0495609_0080994 | Ga0495609_0080994_899_1342 | 142 |
| 28 | 3300046558 | Ga0495633_0107834 | Ga0495633_0107834_339_782 | 142 |
| 29 | 3300046691 | Ga0495670_0170383 | Ga0495670_0170383_522_965 | 142 |
| 30 | 3300046692 | Ga0495671_0029536 | Ga0495671_0029536_497_940 | 142 |
| 31 | 3300047443 | Ga0495687_000115 | Ga0495687_000115_18040_18492 | 142 |
| 32 | 3300049160 | Ga0501304_040737 | Ga0501304_040737_16_465 | 142 |
| 33 | 3300049592 | Ga0501076_1503205 | Ga0501076_1503205_21_515 | 142 |
| 34 | 3300049686 | Ga0501257_023704 | Ga0501257_023704_510_1016 | 142 |
| 35 | iso_pu_bacteria | 2920107658 | 2920110470 | 142 |
| 36 | 3300005331 | Ga0070670_100430131 | Ga0070670_1004301312 | 143 |
| 37 | 3300005335 | Ga0070666_11402188 | Ga0070666_114021881 | 143 |
| 38 | 3300005353 | Ga0070669_100024902 | Ga0070669_1000249022 | 143 |
| 39 | 3300005367 | Ga0070667_100816522 | Ga0070667_1008165222 | 143 |
| 40 | 3300005459 | Ga0068867_100737795 | Ga0068867_1007377952 | 143 |
| 41 | 3300005543 | Ga0070672_100069692 | Ga0070672_1000696922 | 143 |
| 42 | 3300005618 | Ga0068864_100513877 | Ga0068864_1005138772 | 143 |
| 43 | 3300006358 | Ga0068871_100591836 | Ga0068871_1005918361 | 143 |
| 44 | 3300009094 | Ga0111539_10125153 | Ga0111539_101251536 | 143 |
| 45 | 3300014326 | Ga0157380_11474938 | Ga0157380_114749381 | 143 |
| 46 | 3300025923 | Ga0207681_10149799 | Ga0207681_101497993 | 143 |
| 47 | 3300026089 | Ga0207648_10236780 | Ga0207648_102367802 | 143 |
| 48 | 3300046524 | Ga0495648_0213649 | Ga0495648_0213649_489_938 | 143 |
| 49 | 3300046810 | Ga0495660_0042728 | Ga0495660_0042728_1214_1660 | 143 |
| 50 | 3300047472 | Ga0495686_0032740 | Ga0495686_0032740_641_1087 | 143 |
| 51 | 3300050511 | nmdc:mga08y16_831172_c1 | nmdc:mga08y16_831172_c1_444_896 | 143 |
| 52 | 3300005331 | Ga0070670_100256245 | Ga0070670_1002562452 | 144 |
| 53 | 3300005353 | Ga0070669_100105717 | Ga0070669_1001057172 | 144 |
| 54 | 3300005355 | Ga0070671_100243842 | Ga0070671_1002438423 | 144 |
| 55 | 3300005365 | Ga0070688_100300553 | Ga0070688_1003005532 | 144 |
| 56 | 3300005367 | Ga0070667_100683762 | Ga0070667_1006837622 | 144 |
| 57 | 3300005441 | Ga0070700_101188373 | Ga0070700_1011883731 | 144 |
| 58 | 3300005457 | Ga0070662_100524825 | Ga0070662_1005248252 | 144 |
| 59 | 3300005459 | Ga0068867_100880009 | Ga0068867_1008800091 | 144 |
| 60 | 3300005543 | Ga0070672_100226682 | Ga0070672_1002266822 | 144 |
| 61 | 3300005548 | Ga0070665_100362279 | Ga0070665_1003622792 | 144 |
| 62 | 3300005616 | Ga0068852_100574438 | Ga0068852_1005744383 | 144 |
| 63 | 3300005834 | Ga0068851_10155020 | Ga0068851_101550202 | 144 |
| 64 | 3300005841 | Ga0068863_101362343 | Ga0068863_1013623432 | 144 |
| 65 | 3300005842 | Ga0068858_102267914 | Ga0068858_1022679141 | 144 |
| 66 | 3300005843 | Ga0068860_101873774 | Ga0068860_1018737741 | 144 |
| 67 | 3300013308 | Ga0157375_10598178 | Ga0157375_105981781 | 144 |
| 68 | 3300014326 | Ga0157380_10435606 | Ga0157380_104356062 | 144 |
| 69 | 3300025321 | Ga0207656_10111386 | Ga0207656_101113862 | 144 |
| 70 | 3300025901 | Ga0207688_10218079 | Ga0207688_102180792 | 144 |
| 71 | 3300025907 | Ga0207645_10618115 | Ga0207645_106181151 | 144 |
| 72 | 3300025923 | Ga0207681_10255484 | Ga0207681_102554842 | 144 |
| 73 | 3300025925 | Ga0207650_10177637 | Ga0207650_101776372 | 144 |
| 74 | 3300025933 | Ga0207706_10445608 | Ga0207706_104456082 | 144 |
| 75 | 3300025940 | Ga0207691_10099396 | Ga0207691_100993963 | 144 |
| 76 | 3300025945 | Ga0207679_10880312 | Ga0207679_108803122 | 144 |
| 77 | 3300025972 | Ga0207668_10269975 | Ga0207668_102699752 | 144 |
| 78 | 3300026023 | Ga0207677_10275495 | Ga0207677_102754952 | 144 |
| 79 | 3300026088 | Ga0207641_10748541 | Ga0207641_107485411 | 144 |
| 80 | 3300026142 | Ga0207698_10075976 | Ga0207698_100759764 | 144 |
| 81 | 3300028379 | Ga0268266_10727846 | Ga0268266_107278462 | 144 |
| 82 | 3300028381 | Ga0268264_10123476 | Ga0268264_101234761 | 144 |
| 83 | 3300031731 | Ga0307405_10188093 | Ga0307405_101880932 | 144 |
| 84 | 3300032002 | Ga0307416_100363811 | Ga0307416_1003638112 | 144 |
| 85 | 3300032002 | Ga0307416_101561014 | Ga0307416_1015610141 | 144 |
| 86 | 3300050515 | nmdc:mga0a205_386631_c1 | nmdc:mga0a205_386631_c1_339_794 | 144 |
| 87 | 3300005328 | Ga0070676_10073127 | Ga0070676_100731274 | 145 |
| 88 | 3300005331 | Ga0070670_101927920 | Ga0070670_1019279201 | 145 |
| 89 | 3300005564 | Ga0070664_100480002 | Ga0070664_1004800023 | 145 |
| 90 | 3300009092 | Ga0105250_10000091 | Ga0105250_1000009110 | 145 |
| 91 | 3300021361 | Ga0213872_10141062 | Ga0213872_101410622 | 145 |
| 92 | 3300025711 | Ga0207696_1001282 | Ga0207696_100128211 | 145 |
| 93 | 3300025907 | Ga0207645_10082253 | Ga0207645_100822533 | 145 |
| 94 | 3300025945 | Ga0207679_10138698 | Ga0207679_101386981 | 145 |
| 95 | 3300039447 | Ga0436361_0280984 | Ga0436361_0280984_199_648 | 145 |
| 96 | 3300039447 | Ga0436361_0350152 | Ga0436361_0350152_208_657 | 145 |
| 97 | 3300039447 | Ga0436361_0424027 | Ga0436361_0424027_366_815 | 145 |
| 98 | 3300046528 | Ga0495642_0084495 | Ga0495642_0084495_460_921 | 145 |
| 99 | 3300046538 | Ga0495609_0010750 | Ga0495609_0010750_3336_3797 | 145 |
| 100 | 3300046665 | Ga0495661_0035804 | Ga0495661_0035804_2201_2662 | 145 |
| 101 | 3300021361 | Ga0213872_10000023 | Ga0213872_10000023109 | 146 |
| 102 | 3300041486 | Ga0451807_0290195 | Ga0451807_0290195_199_678 | 146 |
| 103 | 3300041509 | Ga0451843_0194517 | Ga0451843_0194517_67_546 | 146 |
| 104 | 3300046500 | Ga0495596_0020926 | Ga0495596_0020926_286_750 | 146 |
| 105 | 3300046506 | Ga0495583_0043409 | Ga0495583_0043409_1061_1525 | 146 |
| 106 | 3300046507 | Ga0495606_0082376 | Ga0495606_0082376_1487_1951 | 146 |
| 107 | 3300046513 | Ga0495616_0008827 | Ga0495616_0008827_1314_1778 | 146 |
| 108 | 3300046513 | Ga0495616_0318940 | Ga0495616_0318940_80_541 | 146 |
| 109 | 3300046518 | Ga0495631_0007784 | Ga0495631_0007784_4044_4508 | 146 |
| 110 | 3300046616 | Ga0495668_0302097 | Ga0495668_0302097_293_757 | 146 |
| 111 | 3300046692 | Ga0495671_0133898 | Ga0495671_0133898_124_585 | 146 |
| 112 | 3300046694 | Ga0495649_0038043 | Ga0495649_0038043_1008_1472 | 146 |
| 113 | 3300049459 | Ga0495678_000622 | Ga0495678_000622_27386_27850 | 146 |
| 114 | 3300049460 | Ga0495682_0000578 | Ga0495682_0000578_15149_15613 | 146 |
| 115 | iso_pu_bacteria | 2643221654 | 2644304253 | 146 |
| 116 | 3300005539 | Ga0068853_100000815 | Ga0068853_1000008153 | 147 |
| 117 | 3300005547 | Ga0070693_100963062 | Ga0070693_1009630621 | 147 |
| 118 | 3300005563 | Ga0068855_100354514 | Ga0068855_1003545143 | 147 |
| 119 | 3300009545 | Ga0105237_10888603 | Ga0105237_108886032 | 147 |
| 120 | 3300010375 | Ga0105239_10180972 | Ga0105239_101809723 | 147 |
| 121 | 3300025303 | Ga0209051_1009919 | Ga0209051_10099196 | 147 |
| 122 | 3300025904 | Ga0207647_10016181 | Ga0207647_100161811 | 147 |
| 123 | 3300025949 | Ga0207667_10062567 | Ga0207667_100625672 | 147 |
| 124 | 3300026041 | Ga0207639_10002409 | Ga0207639_100024093 | 147 |
| 125 | 3300026116 | Ga0207674_10354177 | Ga0207674_103541772 | 147 |
| 126 | 3300031548 | Ga0307408_100000488 | Ga0307408_1000004886 | 147 |
| 127 | 3300046500 | Ga0495596_0010942 | Ga0495596_0010942_3172_3645 | 147 |
| 128 | 3300046525 | Ga0495663_0060225 | Ga0495663_0060225_57_530 | 147 |
| 129 | 3300046616 | Ga0495668_0047799 | Ga0495668_0047799_283_756 | 147 |
| 130 | 3300046616 | Ga0495668_0144371 | Ga0495668_0144371_288_761 | 147 |
| 131 | 3300046794 | Ga0495589_0019180 | Ga0495589_0019180_1810_2283 | 147 |
| 132 | 3300046810 | Ga0495660_0007977 | Ga0495660_0007977_3571_4044 | 147 |
| 133 | 3300047323 | Ga0495683_0049469 | Ga0495683_0049469_1527_2000 | 147 |
| 134 | 3300047470 | Ga0495681_0015958 | Ga0495681_0015958_3262_3735 | 147 |
| 135 | 3300048091 | Ga0495626_0015989 | Ga0495626_0015989_2265_2738 | 147 |
| 136 | 3300049459 | Ga0495678_002745 | Ga0495678_002745_8595_9068 | 147 |
| 137 | 3300049583 | Ga0501067_0208677 | Ga0501067_0208677_275_736 | 147 |
| 138 | 3300005347 | Ga0070668_100009101 | Ga0070668_10000910113 | 148 |
| 139 | 3300005843 | Ga0068860_100016513 | Ga0068860_10001651310 | 148 |
| 140 | 3300006038 | Ga0075365_10904568 | Ga0075365_109045681 | 148 |
| 141 | 3300025972 | Ga0207668_10002995 | Ga0207668_100029958 | 148 |
| 142 | 3300025972 | Ga0207668_10499480 | Ga0207668_104994802 | 148 |
| 143 | 3300026118 | Ga0207675_100023619 | Ga0207675_1000236195 | 148 |
| 144 | 3300031548 | Ga0307408_100624654 | Ga0307408_1006246542 | 148 |
| 145 | 3300032002 | Ga0307416_100194479 | Ga0307416_1001944793 | 148 |
| 146 | 3300039447 | Ga0436361_1144678 | Ga0436361_1144678_323_805 | 148 |
| 147 | 3300044712 | Ga0453684_0149696 | Ga0453684_0149696_877_1350 | 148 |
| 148 | 3300047321 | Ga0495676_0148777 | Ga0495676_0148777_381_851 | 148 |
| 149 | 3300048905 | Ga0496102_0000196 | Ga0496102_0000196_62100_62570 | 148 |
| 150 | 3300048912 | Ga0496109_1721866 | Ga0496109_1721866_71_541 | 148 |
| 151 | 3300049571 | Ga0501034_0007048 | Ga0501034_0007048_6166_6624 | 148 |
| 152 | 3300005327 | Ga0070658_10756447 | Ga0070658_107564471 | 149 |
| 153 | 3300005328 | Ga0070676_10002556 | Ga0070676_1000255611 | 149 |
| 154 | 3300005330 | Ga0070690_100033945 | Ga0070690_1000339452 | 149 |
| 155 | 3300005331 | Ga0070670_100055963 | Ga0070670_1000559636 | 149 |
| 156 | 3300005331 | Ga0070670_100207390 | Ga0070670_1002073902 | 149 |
| 157 | 3300005333 | Ga0070677_10024190 | Ga0070677_100241902 | 149 |
| 158 | 3300005333 | Ga0070677_10048436 | Ga0070677_100484362 | 149 |
| 159 | 3300005333 | Ga0070677_10062389 | Ga0070677_100623891 | 149 |
| 160 | 3300005334 | Ga0068869_100010507 | Ga0068869_1000105074 | 149 |
| 161 | 3300005335 | Ga0070666_10000383 | Ga0070666_1000038343 | 149 |
| 162 | 3300005338 | Ga0068868_100063306 | Ga0068868_1000633064 | 149 |
| 163 | 3300005338 | Ga0068868_100088808 | Ga0068868_1000888084 | 149 |
| 164 | 3300005340 | Ga0070689_101317599 | Ga0070689_1013175991 | 149 |
| 165 | 3300005343 | Ga0070687_100003187 | Ga0070687_1000031874 | 149 |
| 166 | 3300005347 | Ga0070668_100053919 | Ga0070668_1000539194 | 149 |
| 167 | 3300005353 | Ga0070669_100004393 | Ga0070669_10000439312 | 149 |
| 168 | 3300005353 | Ga0070669_100106268 | Ga0070669_1001062684 | 149 |
| 169 | 3300005353 | Ga0070669_100426990 | Ga0070669_1004269902 | 149 |
| 170 | 3300005354 | Ga0070675_100013976 | Ga0070675_10001397610 | 149 |
| 171 | 3300005354 | Ga0070675_100610579 | Ga0070675_1006105792 | 149 |
| 172 | 3300005355 | Ga0070671_100184625 | Ga0070671_1001846252 | 149 |
| 173 | 3300005355 | Ga0070671_100530126 | Ga0070671_1005301262 | 149 |
| 174 | 3300005356 | Ga0070674_100007593 | Ga0070674_1000075937 | 149 |
| 175 | 3300005364 | Ga0070673_100145742 | Ga0070673_1001457423 | 149 |
| 176 | 3300005364 | Ga0070673_100259837 | Ga0070673_1002598372 | 149 |
| 177 | 3300005366 | Ga0070659_100870797 | Ga0070659_1008707972 | 149 |
| 178 | 3300005367 | Ga0070667_100008041 | Ga0070667_1000080419 | 149 |
| 179 | 3300005441 | Ga0070700_100007731 | Ga0070700_1000077313 | 149 |
| 180 | 3300005455 | Ga0070663_100188058 | Ga0070663_1001880584 | 149 |
| 181 | 3300005455 | Ga0070663_100253360 | Ga0070663_1002533602 | 149 |
| 182 | 3300005455 | Ga0070663_100291514 | Ga0070663_1002915142 | 149 |
| 183 | 3300005456 | Ga0070678_100263088 | Ga0070678_1002630882 | 149 |
| 184 | 3300005456 | Ga0070678_101056184 | Ga0070678_1010561842 | 149 |
| 185 | 3300005457 | Ga0070662_100011397 | Ga0070662_1000113973 | 149 |
| 186 | 3300005457 | Ga0070662_100020558 | Ga0070662_1000205582 | 149 |
| 187 | 3300005459 | Ga0068867_100009094 | Ga0068867_1000090949 | 149 |
| 188 | 3300005459 | Ga0068867_100122153 | Ga0068867_1001221532 | 149 |
| 189 | 3300005543 | Ga0070672_100018795 | Ga0070672_1000187957 | 149 |
| 190 | 3300005543 | Ga0070672_100045180 | Ga0070672_1000451806 | 149 |
| 191 | 3300005543 | Ga0070672_100388613 | Ga0070672_1003886132 | 149 |
| 192 | 3300005543 | Ga0070672_100895673 | Ga0070672_1008956731 | 149 |
| 193 | 3300005564 | Ga0070664_100508668 | Ga0070664_1005086682 | 149 |
| 194 | 3300005577 | Ga0068857_100735870 | Ga0068857_1007358702 | 149 |
| 195 | 3300005578 | Ga0068854_100301762 | Ga0068854_1003017621 | 149 |
| 196 | 3300005578 | Ga0068854_101325280 | Ga0068854_1013252801 | 149 |
| 197 | 3300005615 | Ga0070702_100360973 | Ga0070702_1003609732 | 149 |
| 198 | 3300005616 | Ga0068852_100009536 | Ga0068852_1000095367 | 149 |
| 199 | 3300005616 | Ga0068852_100066624 | Ga0068852_1000666244 | 149 |
| 200 | 3300005617 | Ga0068859_100317087 | Ga0068859_1003170872 | 149 |
| 201 | 3300005618 | Ga0068864_100024738 | Ga0068864_1000247382 | 149 |
| 202 | 3300005618 | Ga0068864_100212888 | Ga0068864_1002128882 | 149 |
| 203 | 3300005718 | Ga0068866_10002302 | Ga0068866_100023028 | 149 |
| 204 | 3300005719 | Ga0068861_100026625 | Ga0068861_1000266257 | 149 |
| 205 | 3300005834 | Ga0068851_10052792 | Ga0068851_100527923 | 149 |
| 206 | 3300005840 | Ga0068870_10731064 | Ga0068870_107310642 | 149 |
| 207 | 3300005841 | Ga0068863_100021677 | Ga0068863_1000216779 | 149 |
| 208 | 3300005842 | Ga0068858_100021904 | Ga0068858_1000219042 | 149 |
| 209 | 3300005844 | Ga0068862_100009567 | Ga0068862_1000095677 | 149 |
| 210 | 3300006353 | Ga0075370_10001299 | Ga0075370_100012992 | 149 |
| 211 | 3300006358 | Ga0068871_100129244 | Ga0068871_1001292444 | 149 |
| 212 | 3300006881 | Ga0068865_100021423 | Ga0068865_1000214237 | 149 |
| 213 | 3300006931 | Ga0097620_100317082 | Ga0097620_1003170824 | 149 |
| 214 | 3300009094 | Ga0111539_10795944 | Ga0111539_107959442 | 149 |
| 215 | 3300009098 | Ga0105245_10043120 | Ga0105245_100431204 | 149 |
| 216 | 3300009148 | Ga0105243_10004458 | Ga0105243_100044587 | 149 |
| 217 | 3300009176 | Ga0105242_10003366 | Ga0105242_100033667 | 149 |
| 218 | 3300009176 | Ga0105242_10752783 | Ga0105242_107527831 | 149 |
| 219 | 3300009177 | Ga0105248_10002726 | Ga0105248_1000272631 | 149 |
| 220 | 3300009553 | Ga0105249_10018770 | Ga0105249_1001877011 | 149 |
| 221 | 3300013104 | Ga0157370_11046186 | Ga0157370_110461861 | 149 |
| 222 | 3300013105 | Ga0157369_10279568 | Ga0157369_102795682 | 149 |
| 223 | 3300013296 | Ga0157374_10207567 | Ga0157374_102075673 | 149 |
| 224 | 3300013297 | Ga0157378_10382139 | Ga0157378_103821392 | 149 |
| 225 | 3300013306 | Ga0163162_10005282 | Ga0163162_100052827 | 149 |
| 226 | 3300013308 | Ga0157375_10006696 | Ga0157375_100066969 | 149 |
| 227 | 3300013308 | Ga0157375_10998084 | Ga0157375_109980842 | 149 |
| 228 | 3300013308 | Ga0157375_11364429 | Ga0157375_113644292 | 149 |
| 229 | 3300014326 | Ga0157380_10035828 | Ga0157380_100358284 | 149 |
| 230 | 3300014968 | Ga0157379_10008418 | Ga0157379_100084188 | 149 |
| 231 | 3300014968 | Ga0157379_10540063 | Ga0157379_105400632 | 149 |
| 232 | 3300017792 | Ga0163161_10007699 | Ga0163161_1000769910 | 149 |
| 233 | 3300025315 | Ga0207697_10110124 | Ga0207697_101101243 | 149 |
| 234 | 3300025321 | Ga0207656_10107740 | Ga0207656_101077402 | 149 |
| 235 | 3300025893 | Ga0207682_10002098 | Ga0207682_1000209817 | 149 |
| 236 | 3300025893 | Ga0207682_10022241 | Ga0207682_100222413 | 149 |
| 237 | 3300025899 | Ga0207642_10003623 | Ga0207642_100036237 | 149 |
| 238 | 3300025899 | Ga0207642_10132546 | Ga0207642_101325462 | 149 |
| 239 | 3300025903 | Ga0207680_10002448 | Ga0207680_100024487 | 149 |
| 240 | 3300025903 | Ga0207680_10664064 | Ga0207680_106640642 | 149 |
| 241 | 3300025907 | Ga0207645_10000390 | Ga0207645_1000039015 | 149 |
| 242 | 3300025908 | Ga0207643_10062337 | Ga0207643_100623371 | 149 |
| 243 | 3300025909 | Ga0207705_10040425 | Ga0207705_100404253 | 149 |
| 244 | 3300025918 | Ga0207662_10036122 | Ga0207662_100361224 | 149 |
| 245 | 3300025919 | Ga0207657_10312769 | Ga0207657_103127692 | 149 |
| 246 | 3300025923 | Ga0207681_10003053 | Ga0207681_100030539 | 149 |
| 247 | 3300025923 | Ga0207681_10521195 | Ga0207681_105211951 | 149 |
| 248 | 3300025924 | Ga0207694_10623477 | Ga0207694_106234772 | 149 |
| 249 | 3300025925 | Ga0207650_10465725 | Ga0207650_104657251 | 149 |
| 250 | 3300025926 | Ga0207659_10005549 | Ga0207659_100055497 | 149 |
| 251 | 3300025926 | Ga0207659_10873057 | Ga0207659_108730572 | 149 |
| 252 | 3300025927 | Ga0207687_10017737 | Ga0207687_100177372 | 149 |
| 253 | 3300025927 | Ga0207687_11606065 | Ga0207687_116060651 | 149 |
| 254 | 3300025931 | Ga0207644_10170221 | Ga0207644_101702212 | 149 |
| 255 | 3300025931 | Ga0207644_10193461 | Ga0207644_101934613 | 149 |
| 256 | 3300025931 | Ga0207644_10199996 | Ga0207644_101999962 | 149 |
| 257 | 3300025933 | Ga0207706_10021208 | Ga0207706_100212085 | 149 |
| 258 | 3300025933 | Ga0207706_10034489 | Ga0207706_100344897 | 149 |
| 259 | 3300025933 | Ga0207706_10177582 | Ga0207706_101775822 | 149 |
| 260 | 3300025934 | Ga0207686_10036777 | Ga0207686_100367774 | 149 |
| 261 | 3300025935 | Ga0207709_10010315 | Ga0207709_100103157 | 149 |
| 262 | 3300025936 | Ga0207670_10294887 | Ga0207670_102948872 | 149 |
| 263 | 3300025937 | Ga0207669_10040385 | Ga0207669_100403854 | 149 |
| 264 | 3300025937 | Ga0207669_10879049 | Ga0207669_108790491 | 149 |
| 265 | 3300025940 | Ga0207691_10191785 | Ga0207691_101917852 | 149 |
| 266 | 3300025941 | Ga0207711_10069378 | Ga0207711_100693784 | 149 |
| 267 | 3300025941 | Ga0207711_10518639 | Ga0207711_105186392 | 149 |
| 268 | 3300025942 | Ga0207689_10004319 | Ga0207689_1000431912 | 149 |
| 269 | 3300025945 | Ga0207679_10256483 | Ga0207679_102564832 | 149 |
| 270 | 3300025960 | Ga0207651_10036296 | Ga0207651_100362962 | 149 |
| 271 | 3300025960 | Ga0207651_10149016 | Ga0207651_101490163 | 149 |
| 272 | 3300025961 | Ga0207712_10014950 | Ga0207712_100149507 | 149 |
| 273 | 3300025981 | Ga0207640_10192421 | Ga0207640_101924212 | 149 |
| 274 | 3300025986 | Ga0207658_10004261 | Ga0207658_100042619 | 149 |
| 275 | 3300026023 | Ga0207677_10047843 | Ga0207677_100478434 | 149 |
| 276 | 3300026035 | Ga0207703_10006227 | Ga0207703_100062279 | 149 |
| 277 | 3300026067 | Ga0207678_10157195 | Ga0207678_101571952 | 149 |
| 278 | 3300026067 | Ga0207678_10351765 | Ga0207678_103517652 | 149 |
| 279 | 3300026075 | Ga0207708_10049010 | Ga0207708_100490107 | 149 |
| 280 | 3300026078 | Ga0207702_11112371 | Ga0207702_111123712 | 149 |
| 281 | 3300026088 | Ga0207641_10011162 | Ga0207641_100111629 | 149 |
| 282 | 3300026088 | Ga0207641_10490547 | Ga0207641_104905472 | 149 |
| 283 | 3300026089 | Ga0207648_10001878 | Ga0207648_100018787 | 149 |
| 284 | 3300026089 | Ga0207648_10100996 | Ga0207648_101009964 | 149 |
| 285 | 3300026095 | Ga0207676_10049625 | Ga0207676_100496252 | 149 |
| 286 | 3300026121 | Ga0207683_10094897 | Ga0207683_100948975 | 149 |
| 287 | 3300026121 | Ga0207683_10697017 | Ga0207683_106970172 | 149 |
| 288 | 3300026142 | Ga0207698_10077352 | Ga0207698_100773523 | 149 |
| 289 | 3300026142 | Ga0207698_10081812 | Ga0207698_100818124 | 149 |
| 290 | 3300028379 | Ga0268266_10310396 | Ga0268266_103103963 | 149 |
| 291 | 3300028380 | Ga0268265_10027370 | Ga0268265_100273707 | 149 |
| 292 | 3300028381 | Ga0268264_10007375 | Ga0268264_1000737513 | 149 |
| 293 | 3300046558 | Ga0495633_0277200 | Ga0495633_0277200_20_493 | 149 |
| 294 | 3300048903 | Ga0496100_0316327 | Ga0496100_0316327_518_991 | 149 |
| 295 | 3300048911 | Ga0496108_0301709 | Ga0496108_0301709_217_690 | 149 |
| 296 | 3300048917 | Ga0496114_0248940 | Ga0496114_0248940_714_1187 | 149 |
| 297 | 3300050496 | nmdc:mga07m45_7089_c1 | nmdc:mga07m45_7089_c1_5134_5619 | 149 |
| 298 | 3300050511 | nmdc:mga08y16_516975_c1 | nmdc:mga08y16_516975_c1_624_1097 | 149 |
| 299 | 3300005331 | Ga0070670_100050076 | Ga0070670_1000500763 | 150 |
| 300 | 3300005338 | Ga0068868_100919094 | Ga0068868_1009190942 | 150 |
| 301 | 3300005355 | Ga0070671_100183888 | Ga0070671_1001838883 | 150 |
| 302 | 3300005364 | Ga0070673_100021066 | Ga0070673_1000210663 | 150 |
| 303 | 3300005543 | Ga0070672_100000880 | Ga0070672_1000008809 | 150 |
| 304 | 3300005616 | Ga0068852_100331352 | Ga0068852_1003313522 | 150 |
| 305 | 3300005840 | Ga0068870_10169352 | Ga0068870_101693521 | 150 |
| 306 | 3300005842 | Ga0068858_100794897 | Ga0068858_1007948972 | 150 |
| 307 | 3300006237 | Ga0097621_100014845 | Ga0097621_1000148453 | 150 |
| 308 | 3300006237 | Ga0097621_101525555 | Ga0097621_1015255551 | 150 |
| 309 | 3300006846 | Ga0075430_100518843 | Ga0075430_1005188432 | 150 |
| 310 | 3300009545 | Ga0105237_10027841 | Ga0105237_100278412 | 150 |
| 311 | 3300013308 | Ga0157375_10106559 | Ga0157375_101065592 | 150 |
| 312 | 3300014969 | Ga0157376_10061113 | Ga0157376_100611134 | 150 |
| 313 | 3300017792 | Ga0163161_10417682 | Ga0163161_104176822 | 150 |
| 314 | 3300025914 | Ga0207671_10258530 | Ga0207671_102585302 | 150 |
| 315 | 3300025926 | Ga0207659_10151244 | Ga0207659_101512442 | 150 |
| 316 | 3300025931 | Ga0207644_10171198 | Ga0207644_101711982 | 150 |
| 317 | 3300025940 | Ga0207691_10000754 | Ga0207691_100007544 | 150 |
| 318 | 3300025940 | Ga0207691_10704529 | Ga0207691_107045292 | 150 |
| 319 | 3300025960 | Ga0207651_10034239 | Ga0207651_100342394 | 150 |
| 320 | 3300026035 | Ga0207703_10554709 | Ga0207703_105547091 | 150 |
| 321 | 3300026088 | Ga0207641_11018384 | Ga0207641_110183842 | 150 |
| 322 | 3300026121 | Ga0207683_10021024 | Ga0207683_100210245 | 150 |
| 323 | 3300031507 | Ga0307509_10645871 | Ga0307509_106458711 | 150 |
| 324 | 3300031616 | Ga0307508_10434910 | Ga0307508_104349101 | 150 |
| 325 | 3300031649 | Ga0307514_10001108 | Ga0307514_1000110823 | 150 |
| 326 | 3300037471 | Ga0395905_0018536 | Ga0395905_0018536_3593_4087 | 150 |
| 327 | 3300045051 | Ga0451576_1258518 | Ga0451576_1258518_16_507 | 150 |
| 328 | 3300046507 | Ga0495606_0207215 | Ga0495606_0207215_551_1027 | 150 |
| 329 | 3300047472 | Ga0495686_0504999 | Ga0495686_0504999_29_502 | 150 |
| 330 | 3300053086 | Ga0500578_0036160 | Ga0500578_0036160_502_978 | 150 |
| 331 | 3300053155 | Ga0500620_236142 | Ga0500620_236142_50_526 | 150 |
| 332 | 3300053156 | Ga0500622_0000912 | Ga0500622_0000912_24207_24680 | 150 |
| 333 | 3300053730 | Ga0500645_002335 | Ga0500645_002335_5738_6214 | 150 |
| 334 | 3300053736 | Ga0500599_023863 | Ga0500599_023863_177_650 | 150 |
| 335 | 3300031730 | Ga0307516_10005205 | Ga0307516_100052059 | 151 |
| 336 | 3300039447 | Ga0436361_0060434 | Ga0436361_0060434_59639_60145 | 151 |
| 337 | 3300042876 | Ga0451577_0164222 | Ga0451577_0164222_221_700 | 151 |
| 338 | 3300045051 | Ga0451576_0088027 | Ga0451576_0088027_850_1329 | 151 |
| 339 | 3300049584 | Ga0501068_0833844 | Ga0501068_0833844_75_560 | 151 |
| 340 | 3300054114 | Ga0501084_0692997 | Ga0501084_0692997_351_836 | 151 |
| 341 | 3300003771 | Ga0055526_1007520 | Ga0055526_10075207 | 152 |
| 342 | 3300003773 | Ga0055537_1004370 | Ga0055537_10043704 | 152 |
| 343 | 3300003784 | Ga0055534_1002719 | Ga0055534_10027198 | 152 |
| 344 | 3300003790 | Ga0055528_1000387 | Ga0055528_100038726 | 152 |
| 345 | 3300025263 | Ga0209565_1000722 | Ga0209565_100072224 | 152 |
| 346 | 3300025273 | Ga0209673_1000019 | Ga0209673_1000019385 | 152 |
| 347 | 3300025291 | Ga0209675_1000846 | Ga0209675_100084624 | 152 |
| 348 | 3300025295 | Ga0209564_1001779 | Ga0209564_10017794 | 152 |
| 349 | 3300025299 | Ga0209256_1000093 | Ga0209256_100009324 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.8467 | 45 | 129 |
| 3znj-assembly3.cif.gz_9 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.8466 | 45 | 129 |
| 3zo7-assembly1.cif.gz_F | crystal structure of clcfe27a with substrate | 0.8447 | 45 | 129 |
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.832 | 45 | 129 |
| 3znu-assembly1.cif.gz_I | crystal structure of clcf in crystal form 2 | 0.8288 | 45 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.831 | 45 | 129 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7967 | 44 | 129 | 3.30.70.1060 |
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7877 | 45 | 129 | 3.30.70.1060 |
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7212 | 45 | 129 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7021 | 44 | 129 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8H2P9-F1-model_v4 | deleted | 0.991 | 19 | 150 |
|
| AF-A0A0Q6W0F4-F1-model_v4 | YCII-related domain-containing protein | 0.9875 | 22 | 150 |
|
| AF-A0A844AWU8-F1-model_v4 | YCII-related domain-containing protein | 0.9866 | 15 | 150 |
|
| AF-A0A2G8TIH0-F1-model_v4 | YCII-related domain-containing protein | 0.9829 | 23 | 151 |
|
| AF-A0A643FE06-F1-model_v4 | YCII-related domain-containing protein | 0.9824 | 19 | 152 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar