F417835

General Info

Members Datasets Scaffolds Average Seq Length
349 191 698 177

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100077075|Ga0070664_1000770752
Length 212
Sequence VSLEATLPEAETAAVDLPACYYYGVRARSPAERKQNGMILKLKRTPGIFLVGFMGSGKSTVGRVLAEELGWGFADLDEEIEMREGMSINQIFETRGEAGFRQAETAALQQRVRSINAGKPCVIALGGGAFLSEENFDMVFNNGVSVWLDCPFSTVERRVAKFDHRPLARDPEKLRELFAVRRPGYERADYCVPVESDDAAVVAAKILELPLF

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.29
Rhizosphere 98.85
Stem 0
Stem Tuber 0
Unclassified 31.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100077075 3300005564 Bacteria 2866
2 Ga0070658_10289233 3300005327 Unclassified 1396
3 Ga0070683_100004450 3300005329 Bacteria 11555
4 Ga0070683_100195979 3300005329 Bacteria 1918
5 Ga0070683_100265216 3300005329 Bacteria 1634
6 Ga0070683_100306061 3300005329 Bacteria 1512
7 Ga0068869_100675512 3300005334 Unclassified 879
8 Ga0070666_10354728 3300005335 Unclassified 1050
9 Ga0070680_100037182 3300005336 Bacteria 3934
10 Ga0070680_100620678 3300005336 Unclassified 928
11 Ga0070689_100550408 3300005340 Unclassified 994
12 Ga0070689_100554905 3300005340 Unclassified 990
13 Ga0070691_10151122 3300005341 Unclassified 1190
14 Ga0070661_100263488 3300005344 Unclassified 1333
15 Ga0070671_100207258 3300005355 Bacteria 1663
16 Ga0070688_100438286 3300005365 Unclassified 974
17 Ga0070659_100486690 3300005366 Bacteria 1050
18 Ga0070667_100069471 3300005367 Unclassified 2998
19 Ga0070709_10177668 3300005434 Bacteria 1493
20 Ga0070709_10189113 3300005434 Unclassified 1451
21 Ga0070714_100033400 3300005435 Bacteria 4300
22 Ga0070714_100178664 3300005435 Bacteria 1930
23 Ga0070713_100001083 3300005436 Bacteria 17426
24 Ga0070713_100159584 3300005436 Bacteria 2012
25 Ga0070713_100165060 3300005436 Unclassified 1980
26 Ga0070713_100183006 3300005436 Bacteria 1884
27 Ga0070713_100256802 3300005436 Bacteria 1596
28 Ga0070710_10416673 3300005437 Unclassified 904
29 Ga0070711_100175235 3300005439 Bacteria 1638
30 Ga0070678_100080970 3300005456 Bacteria 2460
31 Ga0070681_10004561 3300005458 Bacteria 13214
32 Ga0068867_100093410 3300005459 Unclassified 2286
33 Ga0068867_100125230 3300005459 Bacteria 1990
34 Ga0070706_100451534 3300005467 Unclassified 1196
35 Ga0070706_100683566 3300005467 Bacteria 952
36 Ga0070699_101171742 3300005518 Unclassified 705
37 Ga0070679_100008191 3300005530 Bacteria 9827
38 Ga0070684_100003007 3300005535 Bacteria 12561
39 Ga0070684_100080233 3300005535 Bacteria 2886
40 Ga0070684_100097956 3300005535 Unclassified 2616
41 Ga0068853_100002765 3300005539 Bacteria 13247
42 Ga0068853_100061514 3300005539 Unclassified 3248
43 Ga0068853_100104007 3300005539 Bacteria 2513
44 Ga0070693_100029404 3300005547 Bacteria 2997
45 Ga0070693_100166306 3300005547 Bacteria 1409
46 Ga0070693_100408683 3300005547 Unclassified 943
47 Ga0070665_100405281 3300005548 Unclassified 1372
48 Ga0070665_100931690 3300005548 Unclassified 881
49 Ga0070665_101010785 3300005548 Bacteria 844
50 Ga0068855_100133925 3300005563 Bacteria 2828
51 Ga0070664_100588565 3300005564 Bacteria 1031
52 Ga0068857_100006815 3300005577 Bacteria 9836
53 Ga0068857_100008984 3300005577 Bacteria 8659
54 Ga0068857_100161443 3300005577 Bacteria 2034
55 Ga0068857_100520050 3300005577 Bacteria 1118
56 Ga0068857_100526361 3300005577 Bacteria 1112
57 Ga0068854_100123722 3300005578 Unclassified 1967
58 Ga0068856_100000278 3300005614 Bacteria 55608
59 Ga0068856_100209977 3300005614 Bacteria 1962
60 Ga0068856_100232433 3300005614 Bacteria 1859
61 Ga0068856_100477756 3300005614 Unclassified 1267
62 Ga0068852_100054239 3300005616 Bacteria 3455
63 Ga0068852_100266262 3300005616 Bacteria 1647
64 Ga0068859_100043356 3300005617 Unclassified 4521
65 Ga0068859_100215537 3300005617 Unclassified 2007
66 Ga0068864_100673347 3300005618 Bacteria 1009
67 Ga0068864_100969713 3300005618 Unclassified 842
68 Ga0068866_10186106 3300005718 Bacteria 1230
69 Ga0068858_100023203 3300005842 Bacteria 5786
70 Ga0068858_100317464 3300005842 Bacteria 1488
71 Ga0068858_100699903 3300005842 Unclassified 986
72 Ga0068860_100250764 3300005843 Bacteria 1724
73 Ga0068862_100659171 3300005844 Bacteria 1010
74 Ga0070717_10034921 3300006028 Bacteria 4067
75 Ga0070717_10083108 3300006028 Bacteria 2692
76 Ga0070717_10802426 3300006028 Bacteria 856
77 Ga0097621_100112287 3300006237 Bacteria 2304
78 Ga0097621_100166133 3300006237 Bacteria 1900
79 Ga0097621_100220232 3300006237 Bacteria 1654
80 Ga0068871_100284083 3300006358 Unclassified 1448
81 Ga0068871_101691205 3300006358 Unclassified 600
82 Ga0075428_100490728 3300006844 Unclassified 1314
83 Ga0075429_101174201 3300006880 Unclassified 670
84 Ga0068865_100073910 3300006881 Unclassified 2426
85 Ga0068865_100747917 3300006881 Bacteria 839
86 Ga0075436_100001754 3300006914 Bacteria 14845
87 Ga0097620_100043353 3300006931 Unclassified 4521
88 Ga0097620_100215531 3300006931 Unclassified 2007
89 Ga0105240_10004045 3300009093 Bacteria 22559
90 Ga0105240_10009042 3300009093 Bacteria 14148
91 Ga0105240_10010003 3300009093 Bacteria 13362
92 Ga0105240_10010638 3300009093 Bacteria 12919
93 Ga0105240_10047036 3300009093 Bacteria 5461
94 Ga0105240_10493217 3300009093 Unclassified 1363
95 Ga0105240_10838095 3300009093 Bacteria 993
96 Ga0111539_10781506 3300009094 Bacteria 1111
97 Ga0105245_10000418 3300009098 Bacteria 39691
98 Ga0105245_10031656 3300009098 Bacteria 4682
99 Ga0105245_10033827 3300009098 Bacteria 4530
100 Ga0105245_10248960 3300009098 Bacteria 1725
101 Ga0105245_10279505 3300009098 Bacteria 1631
102 Ga0105245_11002829 3300009098 Bacteria 879
103 Ga0105245_11717441 3300009098 Bacteria 680
104 Ga0105247_10652290 3300009101 Bacteria 786
105 Ga0105243_10276426 3300009148 Bacteria 1511
106 Ga0105241_10022540 3300009174 Bacteria 4665
107 Ga0105241_10098942 3300009174 Unclassified 2315
108 Ga0105241_10133753 3300009174 Unclassified 2011
109 Ga0105241_10237529 3300009174 Unclassified 1539
110 Ga0105242_10069437 3300009176 Unclassified 2918
111 Ga0105242_10166537 3300009176 Bacteria 1934
112 Ga0105242_10374300 3300009176 Bacteria 1322
113 Ga0105242_10543614 3300009176 Bacteria 1112
114 Ga0105242_10735955 3300009176 Bacteria 969
115 Ga0105248_10006283 3300009177 Bacteria 13034
116 Ga0105248_10038957 3300009177 Bacteria 5321
117 Ga0105248_10082342 3300009177 Bacteria 3619
118 Ga0105248_10724949 3300009177 Bacteria 1122
119 Ga0105248_10966582 3300009177 Unclassified 962
120 Ga0105237_10006456 3300009545 Bacteria 13002
121 Ga0105237_10006844 3300009545 Bacteria 12565
122 Ga0105237_10015155 3300009545 Bacteria 8032
123 Ga0105237_10154358 3300009545 Unclassified 2292
124 Ga0105237_10165080 3300009545 Unclassified 2213
125 Ga0105238_10004546 3300009551 Bacteria 13728
126 Ga0105238_10005926 3300009551 Bacteria 12112
127 Ga0105238_10009199 3300009551 Bacteria 9887
128 Ga0105238_10053111 3300009551 Bacteria 4073
129 Ga0105238_10382893 3300009551 Unclassified 1398
130 Ga0105238_10466026 3300009551 Bacteria 1261
131 Ga0105249_10052650 3300009553 Unclassified 3718
132 Ga0105239_10001590 3300010375 Bacteria 29996
133 Ga0105239_10056945 3300010375 Bacteria 4287
134 Ga0105239_10204636 3300010375 Bacteria 2212
135 Ga0105239_10394499 3300010375 Bacteria 1566
136 Ga0105239_11353853 3300010375 Unclassified 821
137 Ga0105239_11945195 3300010375 Unclassified 682
138 Ga0105246_10204029 3300011119 Unclassified 1539
139 Ga0105246_10332748 3300011119 Unclassified 1238
140 Ga0157370_10002313 3300013104 Bacteria 23071
141 Ga0157370_10008864 3300013104 Bacteria 10814
142 Ga0157369_10007154 3300013105 Bacteria 12863
143 Ga0157369_10009234 3300013105 Bacteria 11280
144 Ga0157369_10061923 3300013105 Unclassified 4032
145 Ga0157374_10003248 3300013296 Bacteria 13651
146 Ga0157374_10256917 3300013296 Bacteria 1720
147 Ga0157374_10526076 3300013296 Unclassified 1189
148 Ga0157374_11293158 3300013296 Bacteria 751
149 Ga0157378_10021384 3300013297 Bacteria 5689
150 Ga0157378_10068675 3300013297 Unclassified 3178
151 Ga0163162_11107733 3300013306 Unclassified 897
152 Ga0163162_11477823 3300013306 Unclassified 774
153 Ga0157372_10012441 3300013307 Bacteria 9071
154 Ga0157372_10075583 3300013307 Bacteria 3801
155 Ga0157372_10176649 3300013307 Unclassified 2472
156 Ga0157372_10604517 3300013307 Unclassified 1278
157 Ga0157375_10067338 3300013308 Bacteria 3578
158 Ga0157375_10877946 3300013308 Unclassified 1042
159 Ga0163163_10063165 3300014325 Bacteria 3671
160 Ga0163163_10065207 3300014325 Bacteria 3614
161 Ga0163163_10185413 3300014325 Unclassified 2129
162 Ga0163163_10201359 3300014325 Bacteria 2039
163 Ga0157379_10014696 3300014968 Bacteria 6867
164 Ga0157379_10674875 3300014968 Unclassified 969
165 Ga0157376_10289441 3300014969 Unclassified 1546
166 Ga0157376_10435013 3300014969 Bacteria 1276
167 Ga0157376_10549051 3300014969 Bacteria 1143
168 Ga0163161_10607944 3300017792 Unclassified 902
169 Ga0207680_10762619 3300025903 Unclassified 693
170 Ga0207699_10495887 3300025906 Unclassified 881
171 Ga0207699_10997983 3300025906 Bacteria 619
172 Ga0207643_10199735 3300025908 Bacteria 1217
173 Ga0207684_10411448 3300025910 Unclassified 1162
174 Ga0207707_10003949 3300025912 Bacteria 13171
175 Ga0207695_10007263 3300025913 Bacteria 14148
176 Ga0207695_10065951 3300025913 Bacteria 3720
177 Ga0207695_10144865 3300025913 Unclassified 2321
178 Ga0207695_10289211 3300025913 Archaea 1531
179 Ga0207671_10015375 3300025914 Bacteria 5994
180 Ga0207671_10070548 3300025914 Bacteria 2605
181 Ga0207671_10541930 3300025914 Unclassified 928
182 Ga0207663_10101807 3300025916 Bacteria 1931
183 Ga0207663_10682726 3300025916 Unclassified 812
184 Ga0207660_10009134 3300025917 Bacteria 6420
185 Ga0207660_10561268 3300025917 Bacteria 929
186 Ga0207649_10145567 3300025920 Unclassified 1626
187 Ga0207652_10004534 3300025921 Bacteria 11277
188 Ga0207694_10003318 3300025924 Bacteria 12808
189 Ga0207694_10019810 3300025924 Bacteria 5089
190 Ga0207694_10127145 3300025924 Unclassified 2040
191 Ga0207687_10000481 3300025927 Bacteria 26914
192 Ga0207687_10811677 3300025927 Unclassified 798
193 Ga0207687_10829192 3300025927 Bacteria 790
194 Ga0207700_10001628 3300025928 Bacteria 12755
195 Ga0207700_10023208 3300025928 Unclassified 4273
196 Ga0207700_10038656 3300025928 Bacteria 3465
197 Ga0207700_10260563 3300025928 Bacteria 1485
198 Ga0207664_10064978 3300025929 Bacteria 2920
199 Ga0207644_10234243 3300025931 Bacteria 1460
200 Ga0207706_10083473 3300025933 Bacteria 2809
201 Ga0207706_11160243 3300025933 Unclassified 643
202 Ga0207686_10202909 3300025934 Unclassified 1421
203 Ga0207686_10314710 3300025934 Unclassified 1167
204 Ga0207711_10393022 3300025941 Bacteria 1288
205 Ga0207689_10031838 3300025942 Bacteria 4387
206 Ga0207661_10005366 3300025944 Bacteria 9032
207 Ga0207661_10605878 3300025944 Bacteria 1005
208 Ga0207679_10399986 3300025945 Bacteria 1208
209 Ga0207667_10006750 3300025949 Bacteria 13854
210 Ga0207667_10175330 3300025949 Bacteria 2203
211 Ga0207667_11078375 3300025949 Unclassified 787
212 Ga0207712_10051469 3300025961 Unclassified 2881
213 Ga0207677_10294397 3300026023 Unclassified 1338
214 Ga0207677_10321243 3300026023 Unclassified 1286
215 Ga0207703_10243037 3300026035 Unclassified 1619
216 Ga0207703_10311427 3300026035 Bacteria 1439
217 Ga0207639_10539137 3300026041 Bacteria 1070
218 Ga0207702_10065122 3300026078 Bacteria 3121
219 Ga0207702_10279491 3300026078 Bacteria 1578
220 Ga0207702_10393471 3300026078 Bacteria 1335
221 Ga0207641_10423742 3300026088 Bacteria 1282
222 Ga0207648_10029327 3300026089 Unclassified 4879
223 Ga0207648_10051902 3300026089 Bacteria 3585
224 Ga0207676_10368069 3300026095 Bacteria 1334
225 Ga0207674_10000310 3300026116 Bacteria 62057
226 Ga0207674_10001537 3300026116 Bacteria 29727
227 Ga0207674_10150255 3300026116 Bacteria 2287
228 Ga0207698_10014519 3300026142 Bacteria 5240
229 Ga0268266_10301955 3300028379 Bacteria 1494
230 Ga0268266_10383494 3300028379 Bacteria 1326
231 Ga0268266_10760610 3300028379 Unclassified 935
232 Ga0268265_10369025 3300028380 Bacteria 1317
233 Ga0268264_10530090 3300028381 Unclassified 1152
234 Ga0265323_10000517 3300028653 Bacteria 21517
235 Ga0265336_10018601 3300028666 Bacteria 2250
236 Ga0265338_10050627 3300028800 Bacteria 3752
237 Ga0265338_10316457 3300028800 Bacteria 1131
238 Ga0265338_10336211 3300028800 Unclassified 1089
239 Ga0265324_10015667 3300029957 Bacteria 2785
240 Ga0265330_10077939 3300031235 Bacteria 1430
241 Ga0265330_10089236 3300031235 Bacteria 1324
242 Ga0265332_10046750 3300031238 Bacteria 1864
243 Ga0265332_10088090 3300031238 Bacteria 1314
244 Ga0265328_10035137 3300031239 Bacteria 1854
245 Ga0265320_10007880 3300031240 Bacteria 6570
246 Ga0265325_10163451 3300031241 Bacteria 1046
247 Ga0265329_10063274 3300031242 Bacteria 1170
248 Ga0265340_10017968 3300031247 Bacteria 3655
249 Ga0265331_10019884 3300031250 Bacteria 3458
250 Ga0265316_10020802 3300031344 Bacteria 5573
251 Ga0265316_10101680 3300031344 Bacteria 2183
252 Ga0265313_10026697 3300031595 Bacteria 3036
253 Ga0265314_10003636 3300031711 Bacteria 14834
254 Ga0265314_10006108 3300031711 Bacteria 10705
255 Ga0265314_10276894 3300031711 Bacteria 951
256 Ga0265342_10136495 3300031712 Bacteria 1371
257 Ga0373926_0021419 3300035083 Bacteria 2239
258 Ga0373934_0097874 3300035086 Unclassified 1185
259 Ga0373934_0121839 3300035086 Unclassified 1061
260 Ga0373923_0021891 3300035111 Bacteria 2500
261 Ga0373953_0015519 3300035117 Bacteria 2763
262 Ga0373953_0064058 3300035117 Bacteria 1507
263 Ga0373954_0000899 3300035118 Bacteria 11575
264 Ga0373954_0057620 3300035118 Bacteria 1830
265 Ga0373954_0081504 3300035118 Unclassified 1546
266 Ga0373954_0083930 3300035118 Bacteria 1524
267 Ga0373957_0067576 3300035120 Bacteria 1393
268 Ga0373955_0051587 3300035172 Bacteria 2241
269 Ga0373955_0490141 3300035172 Unclassified 750
270 Ga0373924_0103680 3300035410 Unclassified 1225
271 Ga0373935_0293650 3300035692 Unclassified 1147
272 Ga0373927_0223820 3300035695 Bacteria 1236
273 Ga0373927_0392777 3300035695 Unclassified 915
274 Ga0373933_0012146 3300035724 Bacteria 4757
275 Ga0373933_0188766 3300035724 Bacteria 1316
276 Ga0373933_0247003 3300035724 Bacteria 1149
277 Ga0373947_0127982 3300035725 Bacteria 1619
278 Ga0373937_0003195 3300036401 Bacteria 13725
279 Ga0373937_0009141 3300036401 Bacteria 8598
280 Ga0373937_0010652 3300036401 Bacteria 8038
281 Ga0373937_0039217 3300036401 Bacteria 4317
282 Ga0373937_0127124 3300036401 Bacteria 2379
283 Ga0373937_0219927 3300036401 Bacteria 1788
284 Ga0373937_0322065 3300036401 Bacteria 1463
285 Ga0373937_0328147 3300036401 Bacteria 1448
286 Ga0373937_0441042 3300036401 Unclassified 1236
287 Ga0373925_0016833 3300037068 Bacteria 5294
288 Ga0373925_0022523 3300037068 Bacteria 4596
289 Ga0436364_0781748 3300037853 Bacteria 6414
290 Ga0436365_0769526 3300039437 Unclassified 2636
291 Ga0451576_0194250 3300045051 Unclassified 2120
292 Ga0466967_0071188 3300045976 Bacteria 3113
293 Ga0495592_0214575 3300046454 Unclassified 1290
294 Ga0495629_0213892 3300046459 Bacteria 1331
295 Ga0495580_0012076 3300046472 Bacteria 6647
296 Ga0495608_0029412 3300046511 Bacteria 3727
297 Ga0495628_0308093 3300046516 Unclassified 1171
298 Ga0495652_0336404 3300046529 Unclassified 1086
299 Ga0495587_0024199 3300046536 Bacteria 3725
300 Ga0495587_0214702 3300046536 Unclassified 1086
301 Ga0495645_0074990 3300046543 Bacteria 2435
302 Ga0495667_0248196 3300046559 Bacteria 1133
303 Ga0495667_0472061 3300046559 Unclassified 787
304 Ga0495599_0031548 3300046678 Bacteria 3326
305 Ga0495599_0373474 3300046678 Unclassified 852
306 Ga0495623_0084676 3300046679 Bacteria 1956
307 Ga0495669_0217577 3300046684 Unclassified 915
308 Ga0495613_0202170 3300046689 Bacteria 1400
309 Ga0495581_0302059 3300047315 Bacteria 935
310 Ga0495674_0076276 3300047319 Bacteria 2884
311 Ga0495674_0397289 3300047319 Unclassified 1113
312 Ga0495675_0221447 3300047444 Unclassified 1145
313 Ga0495684_0117163 3300047471 Unclassified 2008
314 Ga0495684_0334352 3300047471 Bacteria 1080
315 Ga0495684_0526158 3300047471 Unclassified 809
316 Ga0495602_0015223 3300048088 Bacteria 7771
317 Ga0496102_0283773 3300048905 Unclassified 1561
318 Ga0501031_0017758 3300049568 Bacteria 4626
319 Ga0501032_0001345 3300049569 Bacteria 19544
320 Ga0501033_0019792 3300049570 Bacteria 5087
321 Ga0501034_0042851 3300049571 Bacteria 4581
322 Ga0501036_0019652 3300049572 Bacteria 5671
323 Ga0501037_0039703 3300049573 Bacteria 3464
324 Ga0501038_0000328 3300049574 Bacteria 40959
325 Ga0501042_0417204 3300049578 Unclassified 973
326 Ga0501043_0133606 3300049579 Bacteria 1944
327 Ga0501046_0000813 3300049580 Bacteria 30391
328 Ga0501048_0386707 3300049582 Bacteria 999
329 Ga0501067_0020365 3300049583 Bacteria 3670
330 Ga0501068_0001928 3300049584 Bacteria 11027
331 Ga0501069_0000739 3300049585 Bacteria 15248
332 Ga0501070_0346824 3300049586 Unclassified 1205
333 Ga0501072_0001411 3300049588 Bacteria 18061
334 Ga0501073_0069763 3300049589 Bacteria 2448
335 Ga0501074_0162395 3300049590 Unclassified 1595
336 Ga0501077_0003511 3300049593 Bacteria 9410
337 Ga0501250_024526 3300049680 Bacteria 804
338 Ga0501079_0016072 3300049741 Bacteria 5718
339 Ga0501080_0000436 3300049742 Bacteria 32293
340 Ga0501081_0240147 3300049743 Unclassified 1321
341 Ga0501083_0022818 3300049744 Bacteria 4341
342 Ga0501044_0130841 3300049823 Bacteria 2503
343 nmdc:mga0n895_1068867_c1 3300050512 Unclassified 785
344 nmdc:mga0n895_1652165_c1 3300050512 Bacteria 604
345 nmdc:mga08x19_328_c2 3300050514 Bacteria 25356
346 Ga0495601_0119613 3300053077 Bacteria 1710
347 Ga0500568_0001618 3300053139 Bacteria 14215
348 Ga0501084_0006884 3300054114 Bacteria 9358
349 Ga0501082_0014366 3300060353 Bacteria 6812
350 Ga0070664_100077075
351 Ga0070658_10289233
352 Ga0070683_100004450
353 Ga0070683_100195979
354 Ga0070683_100265216
355 Ga0070683_100306061
356 Ga0068869_100675512
357 Ga0070666_10354728
358 Ga0070680_100037182
359 Ga0070680_100620678
360 Ga0070689_100550408
361 Ga0070689_100554905
362 Ga0070691_10151122
363 Ga0070661_100263488
364 Ga0070671_100207258
365 Ga0070688_100438286
366 Ga0070659_100486690
367 Ga0070667_100069471
368 Ga0070709_10177668
369 Ga0070709_10189113
370 Ga0070714_100033400
371 Ga0070714_100178664
372 Ga0070713_100001083
373 Ga0070713_100159584
374 Ga0070713_100165060
375 Ga0070713_100183006
376 Ga0070713_100256802
377 Ga0070710_10416673
378 Ga0070711_100175235
379 Ga0070678_100080970
380 Ga0070681_10004561
381 Ga0068867_100093410
382 Ga0068867_100125230
383 Ga0070706_100451534
384 Ga0070706_100683566
385 Ga0070699_101171742
386 Ga0070679_100008191
387 Ga0070684_100003007
388 Ga0070684_100080233
389 Ga0070684_100097956
390 Ga0068853_100002765
391 Ga0068853_100061514
392 Ga0068853_100104007
393 Ga0070693_100029404
394 Ga0070693_100166306
395 Ga0070693_100408683
396 Ga0070665_100405281
397 Ga0070665_100931690
398 Ga0070665_101010785
399 Ga0068855_100133925
400 Ga0070664_100588565
401 Ga0068857_100006815
402 Ga0068857_100008984
403 Ga0068857_100161443
404 Ga0068857_100520050
405 Ga0068857_100526361
406 Ga0068854_100123722
407 Ga0068856_100000278
408 Ga0068856_100209977
409 Ga0068856_100232433
410 Ga0068856_100477756
411 Ga0068852_100054239
412 Ga0068852_100266262
413 Ga0068859_100043356
414 Ga0068859_100215537
415 Ga0068864_100673347
416 Ga0068864_100969713
417 Ga0068866_10186106
418 Ga0068858_100023203
419 Ga0068858_100317464
420 Ga0068858_100699903
421 Ga0068860_100250764
422 Ga0068862_100659171
423 Ga0070717_10034921
424 Ga0070717_10083108
425 Ga0070717_10802426
426 Ga0097621_100112287
427 Ga0097621_100166133
428 Ga0097621_100220232
429 Ga0068871_100284083
430 Ga0068871_101691205
431 Ga0075428_100490728
432 Ga0075429_101174201
433 Ga0068865_100073910
434 Ga0068865_100747917
435 Ga0075436_100001754
436 Ga0097620_100043353
437 Ga0097620_100215531
438 Ga0105240_10004045
439 Ga0105240_10009042
440 Ga0105240_10010003
441 Ga0105240_10010638
442 Ga0105240_10047036
443 Ga0105240_10493217
444 Ga0105240_10838095
445 Ga0111539_10781506
446 Ga0105245_10000418
447 Ga0105245_10031656
448 Ga0105245_10033827
449 Ga0105245_10248960
450 Ga0105245_10279505
451 Ga0105245_11002829
452 Ga0105245_11717441
453 Ga0105247_10652290
454 Ga0105243_10276426
455 Ga0105241_10022540
456 Ga0105241_10098942
457 Ga0105241_10133753
458 Ga0105241_10237529
459 Ga0105242_10069437
460 Ga0105242_10166537
461 Ga0105242_10374300
462 Ga0105242_10543614
463 Ga0105242_10735955
464 Ga0105248_10006283
465 Ga0105248_10038957
466 Ga0105248_10082342
467 Ga0105248_10724949
468 Ga0105248_10966582
469 Ga0105237_10006456
470 Ga0105237_10006844
471 Ga0105237_10015155
472 Ga0105237_10154358
473 Ga0105237_10165080
474 Ga0105238_10004546
475 Ga0105238_10005926
476 Ga0105238_10009199
477 Ga0105238_10053111
478 Ga0105238_10382893
479 Ga0105238_10466026
480 Ga0105249_10052650
481 Ga0105239_10001590
482 Ga0105239_10056945
483 Ga0105239_10204636
484 Ga0105239_10394499
485 Ga0105239_11353853
486 Ga0105239_11945195
487 Ga0105246_10204029
488 Ga0105246_10332748
489 Ga0157370_10002313
490 Ga0157370_10008864
491 Ga0157369_10007154
492 Ga0157369_10009234
493 Ga0157369_10061923
494 Ga0157374_10003248
495 Ga0157374_10256917
496 Ga0157374_10526076
497 Ga0157374_11293158
498 Ga0157378_10021384
499 Ga0157378_10068675
500 Ga0163162_11107733
501 Ga0163162_11477823
502 Ga0157372_10012441
503 Ga0157372_10075583
504 Ga0157372_10176649
505 Ga0157372_10604517
506 Ga0157375_10067338
507 Ga0157375_10877946
508 Ga0163163_10063165
509 Ga0163163_10065207
510 Ga0163163_10185413
511 Ga0163163_10201359
512 Ga0157379_10014696
513 Ga0157379_10674875
514 Ga0157376_10289441
515 Ga0157376_10435013
516 Ga0157376_10549051
517 Ga0163161_10607944
518 Ga0207680_10762619
519 Ga0207699_10495887
520 Ga0207699_10997983
521 Ga0207643_10199735
522 Ga0207684_10411448
523 Ga0207707_10003949
524 Ga0207695_10007263
525 Ga0207695_10065951
526 Ga0207695_10144865
527 Ga0207695_10289211
528 Ga0207671_10015375
529 Ga0207671_10070548
530 Ga0207671_10541930
531 Ga0207663_10101807
532 Ga0207663_10682726
533 Ga0207660_10009134
534 Ga0207660_10561268
535 Ga0207649_10145567
536 Ga0207652_10004534
537 Ga0207694_10003318
538 Ga0207694_10019810
539 Ga0207694_10127145
540 Ga0207687_10000481
541 Ga0207687_10811677
542 Ga0207687_10829192
543 Ga0207700_10001628
544 Ga0207700_10023208
545 Ga0207700_10038656
546 Ga0207700_10260563
547 Ga0207664_10064978
548 Ga0207644_10234243
549 Ga0207706_10083473
550 Ga0207706_11160243
551 Ga0207686_10202909
552 Ga0207686_10314710
553 Ga0207711_10393022
554 Ga0207689_10031838
555 Ga0207661_10005366
556 Ga0207661_10605878
557 Ga0207679_10399986
558 Ga0207667_10006750
559 Ga0207667_10175330
560 Ga0207667_11078375
561 Ga0207712_10051469
562 Ga0207677_10294397
563 Ga0207677_10321243
564 Ga0207703_10243037
565 Ga0207703_10311427
566 Ga0207639_10539137
567 Ga0207702_10065122
568 Ga0207702_10279491
569 Ga0207702_10393471
570 Ga0207641_10423742
571 Ga0207648_10029327
572 Ga0207648_10051902
573 Ga0207676_10368069
574 Ga0207674_10000310
575 Ga0207674_10001537
576 Ga0207674_10150255
577 Ga0207698_10014519
578 Ga0268266_10301955
579 Ga0268266_10383494
580 Ga0268266_10760610
581 Ga0268265_10369025
582 Ga0268264_10530090
583 Ga0265323_10000517
584 Ga0265336_10018601
585 Ga0265338_10050627
586 Ga0265338_10316457
587 Ga0265338_10336211
588 Ga0265324_10015667
589 Ga0265330_10077939
590 Ga0265330_10089236
591 Ga0265332_10046750
592 Ga0265332_10088090
593 Ga0265328_10035137
594 Ga0265320_10007880
595 Ga0265325_10163451
596 Ga0265329_10063274
597 Ga0265340_10017968
598 Ga0265331_10019884
599 Ga0265316_10020802
600 Ga0265316_10101680
601 Ga0265313_10026697
602 Ga0265314_10003636
603 Ga0265314_10006108
604 Ga0265314_10276894
605 Ga0265342_10136495
606 Ga0373926_0021419
607 Ga0373934_0097874
608 Ga0373934_0121839
609 Ga0373923_0021891
610 Ga0373953_0015519
611 Ga0373953_0064058
612 Ga0373954_0000899
613 Ga0373954_0057620
614 Ga0373954_0081504
615 Ga0373954_0083930
616 Ga0373957_0067576
617 Ga0373955_0051587
618 Ga0373955_0490141
619 Ga0373924_0103680
620 Ga0373935_0293650
621 Ga0373927_0223820
622 Ga0373927_0392777
623 Ga0373933_0012146
624 Ga0373933_0188766
625 Ga0373933_0247003
626 Ga0373947_0127982
627 Ga0373937_0003195
628 Ga0373937_0009141
629 Ga0373937_0010652
630 Ga0373937_0039217
631 Ga0373937_0127124
632 Ga0373937_0219927
633 Ga0373937_0322065
634 Ga0373937_0328147
635 Ga0373937_0441042
636 Ga0373925_0016833
637 Ga0373925_0022523
638 Ga0436364_0781748
639 Ga0436365_0769526
640 Ga0451576_0194250
641 Ga0466967_0071188
642 Ga0495592_0214575
643 Ga0495629_0213892
644 Ga0495580_0012076
645 Ga0495608_0029412
646 Ga0495628_0308093
647 Ga0495652_0336404
648 Ga0495587_0024199
649 Ga0495587_0214702
650 Ga0495645_0074990
651 Ga0495667_0248196
652 Ga0495667_0472061
653 Ga0495599_0031548
654 Ga0495599_0373474
655 Ga0495623_0084676
656 Ga0495669_0217577
657 Ga0495613_0202170
658 Ga0495581_0302059
659 Ga0495674_0076276
660 Ga0495674_0397289
661 Ga0495675_0221447
662 Ga0495684_0117163
663 Ga0495684_0334352
664 Ga0495684_0526158
665 Ga0495602_0015223
666 Ga0496102_0283773
667 Ga0501031_0017758
668 Ga0501032_0001345
669 Ga0501033_0019792
670 Ga0501034_0042851
671 Ga0501036_0019652
672 Ga0501037_0039703
673 Ga0501038_0000328
674 Ga0501042_0417204
675 Ga0501043_0133606
676 Ga0501046_0000813
677 Ga0501048_0386707
678 Ga0501067_0020365
679 Ga0501068_0001928
680 Ga0501069_0000739
681 Ga0501070_0346824
682 Ga0501072_0001411
683 Ga0501073_0069763
684 Ga0501074_0162395
685 Ga0501077_0003511
686 Ga0501250_024526
687 Ga0501079_0016072
688 Ga0501080_0000436
689 Ga0501081_0240147
690 Ga0501083_0022818
691 Ga0501044_0130841
692 nmdc:mga0n895_1068867_c1
693 nmdc:mga0n895_1652165_c1
694 nmdc:mga08x19_328_c2
695 Ga0495601_0119613
696 Ga0500568_0001618
697 Ga0501084_0006884
698 Ga0501082_0014366

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13238

AAA_18

AAA domain

48

176

0.92

PF01202

SKI

Shikimate kinase

54

210

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.9295 9 174
2pt5-assembly4.cif.gz_D crystal structure of shikimate kinase (aq_2177) from aquifex aeolicus vf5 0.9215 10 174
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.9192 8 174
1u8a-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution 0.9097 11 174
2iyz-assembly1.cif.gz_A shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp 0.908 11 174
ID Description Score Start End Superfamily
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9192 8 174 3.40.50.300
3n2eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9057 9 174 3.40.50.300
1kagA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 9 174 3.40.50.300
af_P0A6E1_1_171_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8985 8 174 3.40.50.300
af_Q2FY32_1_173_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8934 9 174 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N9MCB0-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9683 3 179 GO:0000287
GO:0004765
GO:0005524
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0016020
GO:0016491
AF-A0A349H2A1-F1-model_v4 Shikimate kinase (EC 2.7.1.71) 0.968 8 122 GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
AF-A0A7X2PHS0-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9632 9 175 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A2E1W088-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9609 8 174 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A522PRW0-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9543 7 179 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map