F417835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 349 | 191 | 698 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100077075|Ga0070664_1000770752 |
| Length | 212 |
| Sequence | VSLEATLPEAETAAVDLPACYYYGVRARSPAERKQNGMILKLKRTPGIFLVGFMGSGKSTVGRVLAEELGWGFADLDEEIEMREGMSINQIFETRGEAGFRQAETAALQQRVRSINAGKPCVIALGGGAFLSEENFDMVFNNGVSVWLDCPFSTVERRVAKFDHRPLARDPEKLRELFAVRRPGYERADYCVPVESDDAAVVAAKILELPLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 125 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 130 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 98.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070664_100077075 | 3300005564 | Bacteria | 2866 |
| 2 | Ga0070658_10289233 | 3300005327 | Unclassified | 1396 |
| 3 | Ga0070683_100004450 | 3300005329 | Bacteria | 11555 |
| 4 | Ga0070683_100195979 | 3300005329 | Bacteria | 1918 |
| 5 | Ga0070683_100265216 | 3300005329 | Bacteria | 1634 |
| 6 | Ga0070683_100306061 | 3300005329 | Bacteria | 1512 |
| 7 | Ga0068869_100675512 | 3300005334 | Unclassified | 879 |
| 8 | Ga0070666_10354728 | 3300005335 | Unclassified | 1050 |
| 9 | Ga0070680_100037182 | 3300005336 | Bacteria | 3934 |
| 10 | Ga0070680_100620678 | 3300005336 | Unclassified | 928 |
| 11 | Ga0070689_100550408 | 3300005340 | Unclassified | 994 |
| 12 | Ga0070689_100554905 | 3300005340 | Unclassified | 990 |
| 13 | Ga0070691_10151122 | 3300005341 | Unclassified | 1190 |
| 14 | Ga0070661_100263488 | 3300005344 | Unclassified | 1333 |
| 15 | Ga0070671_100207258 | 3300005355 | Bacteria | 1663 |
| 16 | Ga0070688_100438286 | 3300005365 | Unclassified | 974 |
| 17 | Ga0070659_100486690 | 3300005366 | Bacteria | 1050 |
| 18 | Ga0070667_100069471 | 3300005367 | Unclassified | 2998 |
| 19 | Ga0070709_10177668 | 3300005434 | Bacteria | 1493 |
| 20 | Ga0070709_10189113 | 3300005434 | Unclassified | 1451 |
| 21 | Ga0070714_100033400 | 3300005435 | Bacteria | 4300 |
| 22 | Ga0070714_100178664 | 3300005435 | Bacteria | 1930 |
| 23 | Ga0070713_100001083 | 3300005436 | Bacteria | 17426 |
| 24 | Ga0070713_100159584 | 3300005436 | Bacteria | 2012 |
| 25 | Ga0070713_100165060 | 3300005436 | Unclassified | 1980 |
| 26 | Ga0070713_100183006 | 3300005436 | Bacteria | 1884 |
| 27 | Ga0070713_100256802 | 3300005436 | Bacteria | 1596 |
| 28 | Ga0070710_10416673 | 3300005437 | Unclassified | 904 |
| 29 | Ga0070711_100175235 | 3300005439 | Bacteria | 1638 |
| 30 | Ga0070678_100080970 | 3300005456 | Bacteria | 2460 |
| 31 | Ga0070681_10004561 | 3300005458 | Bacteria | 13214 |
| 32 | Ga0068867_100093410 | 3300005459 | Unclassified | 2286 |
| 33 | Ga0068867_100125230 | 3300005459 | Bacteria | 1990 |
| 34 | Ga0070706_100451534 | 3300005467 | Unclassified | 1196 |
| 35 | Ga0070706_100683566 | 3300005467 | Bacteria | 952 |
| 36 | Ga0070699_101171742 | 3300005518 | Unclassified | 705 |
| 37 | Ga0070679_100008191 | 3300005530 | Bacteria | 9827 |
| 38 | Ga0070684_100003007 | 3300005535 | Bacteria | 12561 |
| 39 | Ga0070684_100080233 | 3300005535 | Bacteria | 2886 |
| 40 | Ga0070684_100097956 | 3300005535 | Unclassified | 2616 |
| 41 | Ga0068853_100002765 | 3300005539 | Bacteria | 13247 |
| 42 | Ga0068853_100061514 | 3300005539 | Unclassified | 3248 |
| 43 | Ga0068853_100104007 | 3300005539 | Bacteria | 2513 |
| 44 | Ga0070693_100029404 | 3300005547 | Bacteria | 2997 |
| 45 | Ga0070693_100166306 | 3300005547 | Bacteria | 1409 |
| 46 | Ga0070693_100408683 | 3300005547 | Unclassified | 943 |
| 47 | Ga0070665_100405281 | 3300005548 | Unclassified | 1372 |
| 48 | Ga0070665_100931690 | 3300005548 | Unclassified | 881 |
| 49 | Ga0070665_101010785 | 3300005548 | Bacteria | 844 |
| 50 | Ga0068855_100133925 | 3300005563 | Bacteria | 2828 |
| 51 | Ga0070664_100588565 | 3300005564 | Bacteria | 1031 |
| 52 | Ga0068857_100006815 | 3300005577 | Bacteria | 9836 |
| 53 | Ga0068857_100008984 | 3300005577 | Bacteria | 8659 |
| 54 | Ga0068857_100161443 | 3300005577 | Bacteria | 2034 |
| 55 | Ga0068857_100520050 | 3300005577 | Bacteria | 1118 |
| 56 | Ga0068857_100526361 | 3300005577 | Bacteria | 1112 |
| 57 | Ga0068854_100123722 | 3300005578 | Unclassified | 1967 |
| 58 | Ga0068856_100000278 | 3300005614 | Bacteria | 55608 |
| 59 | Ga0068856_100209977 | 3300005614 | Bacteria | 1962 |
| 60 | Ga0068856_100232433 | 3300005614 | Bacteria | 1859 |
| 61 | Ga0068856_100477756 | 3300005614 | Unclassified | 1267 |
| 62 | Ga0068852_100054239 | 3300005616 | Bacteria | 3455 |
| 63 | Ga0068852_100266262 | 3300005616 | Bacteria | 1647 |
| 64 | Ga0068859_100043356 | 3300005617 | Unclassified | 4521 |
| 65 | Ga0068859_100215537 | 3300005617 | Unclassified | 2007 |
| 66 | Ga0068864_100673347 | 3300005618 | Bacteria | 1009 |
| 67 | Ga0068864_100969713 | 3300005618 | Unclassified | 842 |
| 68 | Ga0068866_10186106 | 3300005718 | Bacteria | 1230 |
| 69 | Ga0068858_100023203 | 3300005842 | Bacteria | 5786 |
| 70 | Ga0068858_100317464 | 3300005842 | Bacteria | 1488 |
| 71 | Ga0068858_100699903 | 3300005842 | Unclassified | 986 |
| 72 | Ga0068860_100250764 | 3300005843 | Bacteria | 1724 |
| 73 | Ga0068862_100659171 | 3300005844 | Bacteria | 1010 |
| 74 | Ga0070717_10034921 | 3300006028 | Bacteria | 4067 |
| 75 | Ga0070717_10083108 | 3300006028 | Bacteria | 2692 |
| 76 | Ga0070717_10802426 | 3300006028 | Bacteria | 856 |
| 77 | Ga0097621_100112287 | 3300006237 | Bacteria | 2304 |
| 78 | Ga0097621_100166133 | 3300006237 | Bacteria | 1900 |
| 79 | Ga0097621_100220232 | 3300006237 | Bacteria | 1654 |
| 80 | Ga0068871_100284083 | 3300006358 | Unclassified | 1448 |
| 81 | Ga0068871_101691205 | 3300006358 | Unclassified | 600 |
| 82 | Ga0075428_100490728 | 3300006844 | Unclassified | 1314 |
| 83 | Ga0075429_101174201 | 3300006880 | Unclassified | 670 |
| 84 | Ga0068865_100073910 | 3300006881 | Unclassified | 2426 |
| 85 | Ga0068865_100747917 | 3300006881 | Bacteria | 839 |
| 86 | Ga0075436_100001754 | 3300006914 | Bacteria | 14845 |
| 87 | Ga0097620_100043353 | 3300006931 | Unclassified | 4521 |
| 88 | Ga0097620_100215531 | 3300006931 | Unclassified | 2007 |
| 89 | Ga0105240_10004045 | 3300009093 | Bacteria | 22559 |
| 90 | Ga0105240_10009042 | 3300009093 | Bacteria | 14148 |
| 91 | Ga0105240_10010003 | 3300009093 | Bacteria | 13362 |
| 92 | Ga0105240_10010638 | 3300009093 | Bacteria | 12919 |
| 93 | Ga0105240_10047036 | 3300009093 | Bacteria | 5461 |
| 94 | Ga0105240_10493217 | 3300009093 | Unclassified | 1363 |
| 95 | Ga0105240_10838095 | 3300009093 | Bacteria | 993 |
| 96 | Ga0111539_10781506 | 3300009094 | Bacteria | 1111 |
| 97 | Ga0105245_10000418 | 3300009098 | Bacteria | 39691 |
| 98 | Ga0105245_10031656 | 3300009098 | Bacteria | 4682 |
| 99 | Ga0105245_10033827 | 3300009098 | Bacteria | 4530 |
| 100 | Ga0105245_10248960 | 3300009098 | Bacteria | 1725 |
| 101 | Ga0105245_10279505 | 3300009098 | Bacteria | 1631 |
| 102 | Ga0105245_11002829 | 3300009098 | Bacteria | 879 |
| 103 | Ga0105245_11717441 | 3300009098 | Bacteria | 680 |
| 104 | Ga0105247_10652290 | 3300009101 | Bacteria | 786 |
| 105 | Ga0105243_10276426 | 3300009148 | Bacteria | 1511 |
| 106 | Ga0105241_10022540 | 3300009174 | Bacteria | 4665 |
| 107 | Ga0105241_10098942 | 3300009174 | Unclassified | 2315 |
| 108 | Ga0105241_10133753 | 3300009174 | Unclassified | 2011 |
| 109 | Ga0105241_10237529 | 3300009174 | Unclassified | 1539 |
| 110 | Ga0105242_10069437 | 3300009176 | Unclassified | 2918 |
| 111 | Ga0105242_10166537 | 3300009176 | Bacteria | 1934 |
| 112 | Ga0105242_10374300 | 3300009176 | Bacteria | 1322 |
| 113 | Ga0105242_10543614 | 3300009176 | Bacteria | 1112 |
| 114 | Ga0105242_10735955 | 3300009176 | Bacteria | 969 |
| 115 | Ga0105248_10006283 | 3300009177 | Bacteria | 13034 |
| 116 | Ga0105248_10038957 | 3300009177 | Bacteria | 5321 |
| 117 | Ga0105248_10082342 | 3300009177 | Bacteria | 3619 |
| 118 | Ga0105248_10724949 | 3300009177 | Bacteria | 1122 |
| 119 | Ga0105248_10966582 | 3300009177 | Unclassified | 962 |
| 120 | Ga0105237_10006456 | 3300009545 | Bacteria | 13002 |
| 121 | Ga0105237_10006844 | 3300009545 | Bacteria | 12565 |
| 122 | Ga0105237_10015155 | 3300009545 | Bacteria | 8032 |
| 123 | Ga0105237_10154358 | 3300009545 | Unclassified | 2292 |
| 124 | Ga0105237_10165080 | 3300009545 | Unclassified | 2213 |
| 125 | Ga0105238_10004546 | 3300009551 | Bacteria | 13728 |
| 126 | Ga0105238_10005926 | 3300009551 | Bacteria | 12112 |
| 127 | Ga0105238_10009199 | 3300009551 | Bacteria | 9887 |
| 128 | Ga0105238_10053111 | 3300009551 | Bacteria | 4073 |
| 129 | Ga0105238_10382893 | 3300009551 | Unclassified | 1398 |
| 130 | Ga0105238_10466026 | 3300009551 | Bacteria | 1261 |
| 131 | Ga0105249_10052650 | 3300009553 | Unclassified | 3718 |
| 132 | Ga0105239_10001590 | 3300010375 | Bacteria | 29996 |
| 133 | Ga0105239_10056945 | 3300010375 | Bacteria | 4287 |
| 134 | Ga0105239_10204636 | 3300010375 | Bacteria | 2212 |
| 135 | Ga0105239_10394499 | 3300010375 | Bacteria | 1566 |
| 136 | Ga0105239_11353853 | 3300010375 | Unclassified | 821 |
| 137 | Ga0105239_11945195 | 3300010375 | Unclassified | 682 |
| 138 | Ga0105246_10204029 | 3300011119 | Unclassified | 1539 |
| 139 | Ga0105246_10332748 | 3300011119 | Unclassified | 1238 |
| 140 | Ga0157370_10002313 | 3300013104 | Bacteria | 23071 |
| 141 | Ga0157370_10008864 | 3300013104 | Bacteria | 10814 |
| 142 | Ga0157369_10007154 | 3300013105 | Bacteria | 12863 |
| 143 | Ga0157369_10009234 | 3300013105 | Bacteria | 11280 |
| 144 | Ga0157369_10061923 | 3300013105 | Unclassified | 4032 |
| 145 | Ga0157374_10003248 | 3300013296 | Bacteria | 13651 |
| 146 | Ga0157374_10256917 | 3300013296 | Bacteria | 1720 |
| 147 | Ga0157374_10526076 | 3300013296 | Unclassified | 1189 |
| 148 | Ga0157374_11293158 | 3300013296 | Bacteria | 751 |
| 149 | Ga0157378_10021384 | 3300013297 | Bacteria | 5689 |
| 150 | Ga0157378_10068675 | 3300013297 | Unclassified | 3178 |
| 151 | Ga0163162_11107733 | 3300013306 | Unclassified | 897 |
| 152 | Ga0163162_11477823 | 3300013306 | Unclassified | 774 |
| 153 | Ga0157372_10012441 | 3300013307 | Bacteria | 9071 |
| 154 | Ga0157372_10075583 | 3300013307 | Bacteria | 3801 |
| 155 | Ga0157372_10176649 | 3300013307 | Unclassified | 2472 |
| 156 | Ga0157372_10604517 | 3300013307 | Unclassified | 1278 |
| 157 | Ga0157375_10067338 | 3300013308 | Bacteria | 3578 |
| 158 | Ga0157375_10877946 | 3300013308 | Unclassified | 1042 |
| 159 | Ga0163163_10063165 | 3300014325 | Bacteria | 3671 |
| 160 | Ga0163163_10065207 | 3300014325 | Bacteria | 3614 |
| 161 | Ga0163163_10185413 | 3300014325 | Unclassified | 2129 |
| 162 | Ga0163163_10201359 | 3300014325 | Bacteria | 2039 |
| 163 | Ga0157379_10014696 | 3300014968 | Bacteria | 6867 |
| 164 | Ga0157379_10674875 | 3300014968 | Unclassified | 969 |
| 165 | Ga0157376_10289441 | 3300014969 | Unclassified | 1546 |
| 166 | Ga0157376_10435013 | 3300014969 | Bacteria | 1276 |
| 167 | Ga0157376_10549051 | 3300014969 | Bacteria | 1143 |
| 168 | Ga0163161_10607944 | 3300017792 | Unclassified | 902 |
| 169 | Ga0207680_10762619 | 3300025903 | Unclassified | 693 |
| 170 | Ga0207699_10495887 | 3300025906 | Unclassified | 881 |
| 171 | Ga0207699_10997983 | 3300025906 | Bacteria | 619 |
| 172 | Ga0207643_10199735 | 3300025908 | Bacteria | 1217 |
| 173 | Ga0207684_10411448 | 3300025910 | Unclassified | 1162 |
| 174 | Ga0207707_10003949 | 3300025912 | Bacteria | 13171 |
| 175 | Ga0207695_10007263 | 3300025913 | Bacteria | 14148 |
| 176 | Ga0207695_10065951 | 3300025913 | Bacteria | 3720 |
| 177 | Ga0207695_10144865 | 3300025913 | Unclassified | 2321 |
| 178 | Ga0207695_10289211 | 3300025913 | Archaea | 1531 |
| 179 | Ga0207671_10015375 | 3300025914 | Bacteria | 5994 |
| 180 | Ga0207671_10070548 | 3300025914 | Bacteria | 2605 |
| 181 | Ga0207671_10541930 | 3300025914 | Unclassified | 928 |
| 182 | Ga0207663_10101807 | 3300025916 | Bacteria | 1931 |
| 183 | Ga0207663_10682726 | 3300025916 | Unclassified | 812 |
| 184 | Ga0207660_10009134 | 3300025917 | Bacteria | 6420 |
| 185 | Ga0207660_10561268 | 3300025917 | Bacteria | 929 |
| 186 | Ga0207649_10145567 | 3300025920 | Unclassified | 1626 |
| 187 | Ga0207652_10004534 | 3300025921 | Bacteria | 11277 |
| 188 | Ga0207694_10003318 | 3300025924 | Bacteria | 12808 |
| 189 | Ga0207694_10019810 | 3300025924 | Bacteria | 5089 |
| 190 | Ga0207694_10127145 | 3300025924 | Unclassified | 2040 |
| 191 | Ga0207687_10000481 | 3300025927 | Bacteria | 26914 |
| 192 | Ga0207687_10811677 | 3300025927 | Unclassified | 798 |
| 193 | Ga0207687_10829192 | 3300025927 | Bacteria | 790 |
| 194 | Ga0207700_10001628 | 3300025928 | Bacteria | 12755 |
| 195 | Ga0207700_10023208 | 3300025928 | Unclassified | 4273 |
| 196 | Ga0207700_10038656 | 3300025928 | Bacteria | 3465 |
| 197 | Ga0207700_10260563 | 3300025928 | Bacteria | 1485 |
| 198 | Ga0207664_10064978 | 3300025929 | Bacteria | 2920 |
| 199 | Ga0207644_10234243 | 3300025931 | Bacteria | 1460 |
| 200 | Ga0207706_10083473 | 3300025933 | Bacteria | 2809 |
| 201 | Ga0207706_11160243 | 3300025933 | Unclassified | 643 |
| 202 | Ga0207686_10202909 | 3300025934 | Unclassified | 1421 |
| 203 | Ga0207686_10314710 | 3300025934 | Unclassified | 1167 |
| 204 | Ga0207711_10393022 | 3300025941 | Bacteria | 1288 |
| 205 | Ga0207689_10031838 | 3300025942 | Bacteria | 4387 |
| 206 | Ga0207661_10005366 | 3300025944 | Bacteria | 9032 |
| 207 | Ga0207661_10605878 | 3300025944 | Bacteria | 1005 |
| 208 | Ga0207679_10399986 | 3300025945 | Bacteria | 1208 |
| 209 | Ga0207667_10006750 | 3300025949 | Bacteria | 13854 |
| 210 | Ga0207667_10175330 | 3300025949 | Bacteria | 2203 |
| 211 | Ga0207667_11078375 | 3300025949 | Unclassified | 787 |
| 212 | Ga0207712_10051469 | 3300025961 | Unclassified | 2881 |
| 213 | Ga0207677_10294397 | 3300026023 | Unclassified | 1338 |
| 214 | Ga0207677_10321243 | 3300026023 | Unclassified | 1286 |
| 215 | Ga0207703_10243037 | 3300026035 | Unclassified | 1619 |
| 216 | Ga0207703_10311427 | 3300026035 | Bacteria | 1439 |
| 217 | Ga0207639_10539137 | 3300026041 | Bacteria | 1070 |
| 218 | Ga0207702_10065122 | 3300026078 | Bacteria | 3121 |
| 219 | Ga0207702_10279491 | 3300026078 | Bacteria | 1578 |
| 220 | Ga0207702_10393471 | 3300026078 | Bacteria | 1335 |
| 221 | Ga0207641_10423742 | 3300026088 | Bacteria | 1282 |
| 222 | Ga0207648_10029327 | 3300026089 | Unclassified | 4879 |
| 223 | Ga0207648_10051902 | 3300026089 | Bacteria | 3585 |
| 224 | Ga0207676_10368069 | 3300026095 | Bacteria | 1334 |
| 225 | Ga0207674_10000310 | 3300026116 | Bacteria | 62057 |
| 226 | Ga0207674_10001537 | 3300026116 | Bacteria | 29727 |
| 227 | Ga0207674_10150255 | 3300026116 | Bacteria | 2287 |
| 228 | Ga0207698_10014519 | 3300026142 | Bacteria | 5240 |
| 229 | Ga0268266_10301955 | 3300028379 | Bacteria | 1494 |
| 230 | Ga0268266_10383494 | 3300028379 | Bacteria | 1326 |
| 231 | Ga0268266_10760610 | 3300028379 | Unclassified | 935 |
| 232 | Ga0268265_10369025 | 3300028380 | Bacteria | 1317 |
| 233 | Ga0268264_10530090 | 3300028381 | Unclassified | 1152 |
| 234 | Ga0265323_10000517 | 3300028653 | Bacteria | 21517 |
| 235 | Ga0265336_10018601 | 3300028666 | Bacteria | 2250 |
| 236 | Ga0265338_10050627 | 3300028800 | Bacteria | 3752 |
| 237 | Ga0265338_10316457 | 3300028800 | Bacteria | 1131 |
| 238 | Ga0265338_10336211 | 3300028800 | Unclassified | 1089 |
| 239 | Ga0265324_10015667 | 3300029957 | Bacteria | 2785 |
| 240 | Ga0265330_10077939 | 3300031235 | Bacteria | 1430 |
| 241 | Ga0265330_10089236 | 3300031235 | Bacteria | 1324 |
| 242 | Ga0265332_10046750 | 3300031238 | Bacteria | 1864 |
| 243 | Ga0265332_10088090 | 3300031238 | Bacteria | 1314 |
| 244 | Ga0265328_10035137 | 3300031239 | Bacteria | 1854 |
| 245 | Ga0265320_10007880 | 3300031240 | Bacteria | 6570 |
| 246 | Ga0265325_10163451 | 3300031241 | Bacteria | 1046 |
| 247 | Ga0265329_10063274 | 3300031242 | Bacteria | 1170 |
| 248 | Ga0265340_10017968 | 3300031247 | Bacteria | 3655 |
| 249 | Ga0265331_10019884 | 3300031250 | Bacteria | 3458 |
| 250 | Ga0265316_10020802 | 3300031344 | Bacteria | 5573 |
| 251 | Ga0265316_10101680 | 3300031344 | Bacteria | 2183 |
| 252 | Ga0265313_10026697 | 3300031595 | Bacteria | 3036 |
| 253 | Ga0265314_10003636 | 3300031711 | Bacteria | 14834 |
| 254 | Ga0265314_10006108 | 3300031711 | Bacteria | 10705 |
| 255 | Ga0265314_10276894 | 3300031711 | Bacteria | 951 |
| 256 | Ga0265342_10136495 | 3300031712 | Bacteria | 1371 |
| 257 | Ga0373926_0021419 | 3300035083 | Bacteria | 2239 |
| 258 | Ga0373934_0097874 | 3300035086 | Unclassified | 1185 |
| 259 | Ga0373934_0121839 | 3300035086 | Unclassified | 1061 |
| 260 | Ga0373923_0021891 | 3300035111 | Bacteria | 2500 |
| 261 | Ga0373953_0015519 | 3300035117 | Bacteria | 2763 |
| 262 | Ga0373953_0064058 | 3300035117 | Bacteria | 1507 |
| 263 | Ga0373954_0000899 | 3300035118 | Bacteria | 11575 |
| 264 | Ga0373954_0057620 | 3300035118 | Bacteria | 1830 |
| 265 | Ga0373954_0081504 | 3300035118 | Unclassified | 1546 |
| 266 | Ga0373954_0083930 | 3300035118 | Bacteria | 1524 |
| 267 | Ga0373957_0067576 | 3300035120 | Bacteria | 1393 |
| 268 | Ga0373955_0051587 | 3300035172 | Bacteria | 2241 |
| 269 | Ga0373955_0490141 | 3300035172 | Unclassified | 750 |
| 270 | Ga0373924_0103680 | 3300035410 | Unclassified | 1225 |
| 271 | Ga0373935_0293650 | 3300035692 | Unclassified | 1147 |
| 272 | Ga0373927_0223820 | 3300035695 | Bacteria | 1236 |
| 273 | Ga0373927_0392777 | 3300035695 | Unclassified | 915 |
| 274 | Ga0373933_0012146 | 3300035724 | Bacteria | 4757 |
| 275 | Ga0373933_0188766 | 3300035724 | Bacteria | 1316 |
| 276 | Ga0373933_0247003 | 3300035724 | Bacteria | 1149 |
| 277 | Ga0373947_0127982 | 3300035725 | Bacteria | 1619 |
| 278 | Ga0373937_0003195 | 3300036401 | Bacteria | 13725 |
| 279 | Ga0373937_0009141 | 3300036401 | Bacteria | 8598 |
| 280 | Ga0373937_0010652 | 3300036401 | Bacteria | 8038 |
| 281 | Ga0373937_0039217 | 3300036401 | Bacteria | 4317 |
| 282 | Ga0373937_0127124 | 3300036401 | Bacteria | 2379 |
| 283 | Ga0373937_0219927 | 3300036401 | Bacteria | 1788 |
| 284 | Ga0373937_0322065 | 3300036401 | Bacteria | 1463 |
| 285 | Ga0373937_0328147 | 3300036401 | Bacteria | 1448 |
| 286 | Ga0373937_0441042 | 3300036401 | Unclassified | 1236 |
| 287 | Ga0373925_0016833 | 3300037068 | Bacteria | 5294 |
| 288 | Ga0373925_0022523 | 3300037068 | Bacteria | 4596 |
| 289 | Ga0436364_0781748 | 3300037853 | Bacteria | 6414 |
| 290 | Ga0436365_0769526 | 3300039437 | Unclassified | 2636 |
| 291 | Ga0451576_0194250 | 3300045051 | Unclassified | 2120 |
| 292 | Ga0466967_0071188 | 3300045976 | Bacteria | 3113 |
| 293 | Ga0495592_0214575 | 3300046454 | Unclassified | 1290 |
| 294 | Ga0495629_0213892 | 3300046459 | Bacteria | 1331 |
| 295 | Ga0495580_0012076 | 3300046472 | Bacteria | 6647 |
| 296 | Ga0495608_0029412 | 3300046511 | Bacteria | 3727 |
| 297 | Ga0495628_0308093 | 3300046516 | Unclassified | 1171 |
| 298 | Ga0495652_0336404 | 3300046529 | Unclassified | 1086 |
| 299 | Ga0495587_0024199 | 3300046536 | Bacteria | 3725 |
| 300 | Ga0495587_0214702 | 3300046536 | Unclassified | 1086 |
| 301 | Ga0495645_0074990 | 3300046543 | Bacteria | 2435 |
| 302 | Ga0495667_0248196 | 3300046559 | Bacteria | 1133 |
| 303 | Ga0495667_0472061 | 3300046559 | Unclassified | 787 |
| 304 | Ga0495599_0031548 | 3300046678 | Bacteria | 3326 |
| 305 | Ga0495599_0373474 | 3300046678 | Unclassified | 852 |
| 306 | Ga0495623_0084676 | 3300046679 | Bacteria | 1956 |
| 307 | Ga0495669_0217577 | 3300046684 | Unclassified | 915 |
| 308 | Ga0495613_0202170 | 3300046689 | Bacteria | 1400 |
| 309 | Ga0495581_0302059 | 3300047315 | Bacteria | 935 |
| 310 | Ga0495674_0076276 | 3300047319 | Bacteria | 2884 |
| 311 | Ga0495674_0397289 | 3300047319 | Unclassified | 1113 |
| 312 | Ga0495675_0221447 | 3300047444 | Unclassified | 1145 |
| 313 | Ga0495684_0117163 | 3300047471 | Unclassified | 2008 |
| 314 | Ga0495684_0334352 | 3300047471 | Bacteria | 1080 |
| 315 | Ga0495684_0526158 | 3300047471 | Unclassified | 809 |
| 316 | Ga0495602_0015223 | 3300048088 | Bacteria | 7771 |
| 317 | Ga0496102_0283773 | 3300048905 | Unclassified | 1561 |
| 318 | Ga0501031_0017758 | 3300049568 | Bacteria | 4626 |
| 319 | Ga0501032_0001345 | 3300049569 | Bacteria | 19544 |
| 320 | Ga0501033_0019792 | 3300049570 | Bacteria | 5087 |
| 321 | Ga0501034_0042851 | 3300049571 | Bacteria | 4581 |
| 322 | Ga0501036_0019652 | 3300049572 | Bacteria | 5671 |
| 323 | Ga0501037_0039703 | 3300049573 | Bacteria | 3464 |
| 324 | Ga0501038_0000328 | 3300049574 | Bacteria | 40959 |
| 325 | Ga0501042_0417204 | 3300049578 | Unclassified | 973 |
| 326 | Ga0501043_0133606 | 3300049579 | Bacteria | 1944 |
| 327 | Ga0501046_0000813 | 3300049580 | Bacteria | 30391 |
| 328 | Ga0501048_0386707 | 3300049582 | Bacteria | 999 |
| 329 | Ga0501067_0020365 | 3300049583 | Bacteria | 3670 |
| 330 | Ga0501068_0001928 | 3300049584 | Bacteria | 11027 |
| 331 | Ga0501069_0000739 | 3300049585 | Bacteria | 15248 |
| 332 | Ga0501070_0346824 | 3300049586 | Unclassified | 1205 |
| 333 | Ga0501072_0001411 | 3300049588 | Bacteria | 18061 |
| 334 | Ga0501073_0069763 | 3300049589 | Bacteria | 2448 |
| 335 | Ga0501074_0162395 | 3300049590 | Unclassified | 1595 |
| 336 | Ga0501077_0003511 | 3300049593 | Bacteria | 9410 |
| 337 | Ga0501250_024526 | 3300049680 | Bacteria | 804 |
| 338 | Ga0501079_0016072 | 3300049741 | Bacteria | 5718 |
| 339 | Ga0501080_0000436 | 3300049742 | Bacteria | 32293 |
| 340 | Ga0501081_0240147 | 3300049743 | Unclassified | 1321 |
| 341 | Ga0501083_0022818 | 3300049744 | Bacteria | 4341 |
| 342 | Ga0501044_0130841 | 3300049823 | Bacteria | 2503 |
| 343 | nmdc:mga0n895_1068867_c1 | 3300050512 | Unclassified | 785 |
| 344 | nmdc:mga0n895_1652165_c1 | 3300050512 | Bacteria | 604 |
| 345 | nmdc:mga08x19_328_c2 | 3300050514 | Bacteria | 25356 |
| 346 | Ga0495601_0119613 | 3300053077 | Bacteria | 1710 |
| 347 | Ga0500568_0001618 | 3300053139 | Bacteria | 14215 |
| 348 | Ga0501084_0006884 | 3300054114 | Bacteria | 9358 |
| 349 | Ga0501082_0014366 | 3300060353 | Bacteria | 6812 |
| 350 | Ga0070664_100077075 | |||
| 351 | Ga0070658_10289233 | |||
| 352 | Ga0070683_100004450 | |||
| 353 | Ga0070683_100195979 | |||
| 354 | Ga0070683_100265216 | |||
| 355 | Ga0070683_100306061 | |||
| 356 | Ga0068869_100675512 | |||
| 357 | Ga0070666_10354728 | |||
| 358 | Ga0070680_100037182 | |||
| 359 | Ga0070680_100620678 | |||
| 360 | Ga0070689_100550408 | |||
| 361 | Ga0070689_100554905 | |||
| 362 | Ga0070691_10151122 | |||
| 363 | Ga0070661_100263488 | |||
| 364 | Ga0070671_100207258 | |||
| 365 | Ga0070688_100438286 | |||
| 366 | Ga0070659_100486690 | |||
| 367 | Ga0070667_100069471 | |||
| 368 | Ga0070709_10177668 | |||
| 369 | Ga0070709_10189113 | |||
| 370 | Ga0070714_100033400 | |||
| 371 | Ga0070714_100178664 | |||
| 372 | Ga0070713_100001083 | |||
| 373 | Ga0070713_100159584 | |||
| 374 | Ga0070713_100165060 | |||
| 375 | Ga0070713_100183006 | |||
| 376 | Ga0070713_100256802 | |||
| 377 | Ga0070710_10416673 | |||
| 378 | Ga0070711_100175235 | |||
| 379 | Ga0070678_100080970 | |||
| 380 | Ga0070681_10004561 | |||
| 381 | Ga0068867_100093410 | |||
| 382 | Ga0068867_100125230 | |||
| 383 | Ga0070706_100451534 | |||
| 384 | Ga0070706_100683566 | |||
| 385 | Ga0070699_101171742 | |||
| 386 | Ga0070679_100008191 | |||
| 387 | Ga0070684_100003007 | |||
| 388 | Ga0070684_100080233 | |||
| 389 | Ga0070684_100097956 | |||
| 390 | Ga0068853_100002765 | |||
| 391 | Ga0068853_100061514 | |||
| 392 | Ga0068853_100104007 | |||
| 393 | Ga0070693_100029404 | |||
| 394 | Ga0070693_100166306 | |||
| 395 | Ga0070693_100408683 | |||
| 396 | Ga0070665_100405281 | |||
| 397 | Ga0070665_100931690 | |||
| 398 | Ga0070665_101010785 | |||
| 399 | Ga0068855_100133925 | |||
| 400 | Ga0070664_100588565 | |||
| 401 | Ga0068857_100006815 | |||
| 402 | Ga0068857_100008984 | |||
| 403 | Ga0068857_100161443 | |||
| 404 | Ga0068857_100520050 | |||
| 405 | Ga0068857_100526361 | |||
| 406 | Ga0068854_100123722 | |||
| 407 | Ga0068856_100000278 | |||
| 408 | Ga0068856_100209977 | |||
| 409 | Ga0068856_100232433 | |||
| 410 | Ga0068856_100477756 | |||
| 411 | Ga0068852_100054239 | |||
| 412 | Ga0068852_100266262 | |||
| 413 | Ga0068859_100043356 | |||
| 414 | Ga0068859_100215537 | |||
| 415 | Ga0068864_100673347 | |||
| 416 | Ga0068864_100969713 | |||
| 417 | Ga0068866_10186106 | |||
| 418 | Ga0068858_100023203 | |||
| 419 | Ga0068858_100317464 | |||
| 420 | Ga0068858_100699903 | |||
| 421 | Ga0068860_100250764 | |||
| 422 | Ga0068862_100659171 | |||
| 423 | Ga0070717_10034921 | |||
| 424 | Ga0070717_10083108 | |||
| 425 | Ga0070717_10802426 | |||
| 426 | Ga0097621_100112287 | |||
| 427 | Ga0097621_100166133 | |||
| 428 | Ga0097621_100220232 | |||
| 429 | Ga0068871_100284083 | |||
| 430 | Ga0068871_101691205 | |||
| 431 | Ga0075428_100490728 | |||
| 432 | Ga0075429_101174201 | |||
| 433 | Ga0068865_100073910 | |||
| 434 | Ga0068865_100747917 | |||
| 435 | Ga0075436_100001754 | |||
| 436 | Ga0097620_100043353 | |||
| 437 | Ga0097620_100215531 | |||
| 438 | Ga0105240_10004045 | |||
| 439 | Ga0105240_10009042 | |||
| 440 | Ga0105240_10010003 | |||
| 441 | Ga0105240_10010638 | |||
| 442 | Ga0105240_10047036 | |||
| 443 | Ga0105240_10493217 | |||
| 444 | Ga0105240_10838095 | |||
| 445 | Ga0111539_10781506 | |||
| 446 | Ga0105245_10000418 | |||
| 447 | Ga0105245_10031656 | |||
| 448 | Ga0105245_10033827 | |||
| 449 | Ga0105245_10248960 | |||
| 450 | Ga0105245_10279505 | |||
| 451 | Ga0105245_11002829 | |||
| 452 | Ga0105245_11717441 | |||
| 453 | Ga0105247_10652290 | |||
| 454 | Ga0105243_10276426 | |||
| 455 | Ga0105241_10022540 | |||
| 456 | Ga0105241_10098942 | |||
| 457 | Ga0105241_10133753 | |||
| 458 | Ga0105241_10237529 | |||
| 459 | Ga0105242_10069437 | |||
| 460 | Ga0105242_10166537 | |||
| 461 | Ga0105242_10374300 | |||
| 462 | Ga0105242_10543614 | |||
| 463 | Ga0105242_10735955 | |||
| 464 | Ga0105248_10006283 | |||
| 465 | Ga0105248_10038957 | |||
| 466 | Ga0105248_10082342 | |||
| 467 | Ga0105248_10724949 | |||
| 468 | Ga0105248_10966582 | |||
| 469 | Ga0105237_10006456 | |||
| 470 | Ga0105237_10006844 | |||
| 471 | Ga0105237_10015155 | |||
| 472 | Ga0105237_10154358 | |||
| 473 | Ga0105237_10165080 | |||
| 474 | Ga0105238_10004546 | |||
| 475 | Ga0105238_10005926 | |||
| 476 | Ga0105238_10009199 | |||
| 477 | Ga0105238_10053111 | |||
| 478 | Ga0105238_10382893 | |||
| 479 | Ga0105238_10466026 | |||
| 480 | Ga0105249_10052650 | |||
| 481 | Ga0105239_10001590 | |||
| 482 | Ga0105239_10056945 | |||
| 483 | Ga0105239_10204636 | |||
| 484 | Ga0105239_10394499 | |||
| 485 | Ga0105239_11353853 | |||
| 486 | Ga0105239_11945195 | |||
| 487 | Ga0105246_10204029 | |||
| 488 | Ga0105246_10332748 | |||
| 489 | Ga0157370_10002313 | |||
| 490 | Ga0157370_10008864 | |||
| 491 | Ga0157369_10007154 | |||
| 492 | Ga0157369_10009234 | |||
| 493 | Ga0157369_10061923 | |||
| 494 | Ga0157374_10003248 | |||
| 495 | Ga0157374_10256917 | |||
| 496 | Ga0157374_10526076 | |||
| 497 | Ga0157374_11293158 | |||
| 498 | Ga0157378_10021384 | |||
| 499 | Ga0157378_10068675 | |||
| 500 | Ga0163162_11107733 | |||
| 501 | Ga0163162_11477823 | |||
| 502 | Ga0157372_10012441 | |||
| 503 | Ga0157372_10075583 | |||
| 504 | Ga0157372_10176649 | |||
| 505 | Ga0157372_10604517 | |||
| 506 | Ga0157375_10067338 | |||
| 507 | Ga0157375_10877946 | |||
| 508 | Ga0163163_10063165 | |||
| 509 | Ga0163163_10065207 | |||
| 510 | Ga0163163_10185413 | |||
| 511 | Ga0163163_10201359 | |||
| 512 | Ga0157379_10014696 | |||
| 513 | Ga0157379_10674875 | |||
| 514 | Ga0157376_10289441 | |||
| 515 | Ga0157376_10435013 | |||
| 516 | Ga0157376_10549051 | |||
| 517 | Ga0163161_10607944 | |||
| 518 | Ga0207680_10762619 | |||
| 519 | Ga0207699_10495887 | |||
| 520 | Ga0207699_10997983 | |||
| 521 | Ga0207643_10199735 | |||
| 522 | Ga0207684_10411448 | |||
| 523 | Ga0207707_10003949 | |||
| 524 | Ga0207695_10007263 | |||
| 525 | Ga0207695_10065951 | |||
| 526 | Ga0207695_10144865 | |||
| 527 | Ga0207695_10289211 | |||
| 528 | Ga0207671_10015375 | |||
| 529 | Ga0207671_10070548 | |||
| 530 | Ga0207671_10541930 | |||
| 531 | Ga0207663_10101807 | |||
| 532 | Ga0207663_10682726 | |||
| 533 | Ga0207660_10009134 | |||
| 534 | Ga0207660_10561268 | |||
| 535 | Ga0207649_10145567 | |||
| 536 | Ga0207652_10004534 | |||
| 537 | Ga0207694_10003318 | |||
| 538 | Ga0207694_10019810 | |||
| 539 | Ga0207694_10127145 | |||
| 540 | Ga0207687_10000481 | |||
| 541 | Ga0207687_10811677 | |||
| 542 | Ga0207687_10829192 | |||
| 543 | Ga0207700_10001628 | |||
| 544 | Ga0207700_10023208 | |||
| 545 | Ga0207700_10038656 | |||
| 546 | Ga0207700_10260563 | |||
| 547 | Ga0207664_10064978 | |||
| 548 | Ga0207644_10234243 | |||
| 549 | Ga0207706_10083473 | |||
| 550 | Ga0207706_11160243 | |||
| 551 | Ga0207686_10202909 | |||
| 552 | Ga0207686_10314710 | |||
| 553 | Ga0207711_10393022 | |||
| 554 | Ga0207689_10031838 | |||
| 555 | Ga0207661_10005366 | |||
| 556 | Ga0207661_10605878 | |||
| 557 | Ga0207679_10399986 | |||
| 558 | Ga0207667_10006750 | |||
| 559 | Ga0207667_10175330 | |||
| 560 | Ga0207667_11078375 | |||
| 561 | Ga0207712_10051469 | |||
| 562 | Ga0207677_10294397 | |||
| 563 | Ga0207677_10321243 | |||
| 564 | Ga0207703_10243037 | |||
| 565 | Ga0207703_10311427 | |||
| 566 | Ga0207639_10539137 | |||
| 567 | Ga0207702_10065122 | |||
| 568 | Ga0207702_10279491 | |||
| 569 | Ga0207702_10393471 | |||
| 570 | Ga0207641_10423742 | |||
| 571 | Ga0207648_10029327 | |||
| 572 | Ga0207648_10051902 | |||
| 573 | Ga0207676_10368069 | |||
| 574 | Ga0207674_10000310 | |||
| 575 | Ga0207674_10001537 | |||
| 576 | Ga0207674_10150255 | |||
| 577 | Ga0207698_10014519 | |||
| 578 | Ga0268266_10301955 | |||
| 579 | Ga0268266_10383494 | |||
| 580 | Ga0268266_10760610 | |||
| 581 | Ga0268265_10369025 | |||
| 582 | Ga0268264_10530090 | |||
| 583 | Ga0265323_10000517 | |||
| 584 | Ga0265336_10018601 | |||
| 585 | Ga0265338_10050627 | |||
| 586 | Ga0265338_10316457 | |||
| 587 | Ga0265338_10336211 | |||
| 588 | Ga0265324_10015667 | |||
| 589 | Ga0265330_10077939 | |||
| 590 | Ga0265330_10089236 | |||
| 591 | Ga0265332_10046750 | |||
| 592 | Ga0265332_10088090 | |||
| 593 | Ga0265328_10035137 | |||
| 594 | Ga0265320_10007880 | |||
| 595 | Ga0265325_10163451 | |||
| 596 | Ga0265329_10063274 | |||
| 597 | Ga0265340_10017968 | |||
| 598 | Ga0265331_10019884 | |||
| 599 | Ga0265316_10020802 | |||
| 600 | Ga0265316_10101680 | |||
| 601 | Ga0265313_10026697 | |||
| 602 | Ga0265314_10003636 | |||
| 603 | Ga0265314_10006108 | |||
| 604 | Ga0265314_10276894 | |||
| 605 | Ga0265342_10136495 | |||
| 606 | Ga0373926_0021419 | |||
| 607 | Ga0373934_0097874 | |||
| 608 | Ga0373934_0121839 | |||
| 609 | Ga0373923_0021891 | |||
| 610 | Ga0373953_0015519 | |||
| 611 | Ga0373953_0064058 | |||
| 612 | Ga0373954_0000899 | |||
| 613 | Ga0373954_0057620 | |||
| 614 | Ga0373954_0081504 | |||
| 615 | Ga0373954_0083930 | |||
| 616 | Ga0373957_0067576 | |||
| 617 | Ga0373955_0051587 | |||
| 618 | Ga0373955_0490141 | |||
| 619 | Ga0373924_0103680 | |||
| 620 | Ga0373935_0293650 | |||
| 621 | Ga0373927_0223820 | |||
| 622 | Ga0373927_0392777 | |||
| 623 | Ga0373933_0012146 | |||
| 624 | Ga0373933_0188766 | |||
| 625 | Ga0373933_0247003 | |||
| 626 | Ga0373947_0127982 | |||
| 627 | Ga0373937_0003195 | |||
| 628 | Ga0373937_0009141 | |||
| 629 | Ga0373937_0010652 | |||
| 630 | Ga0373937_0039217 | |||
| 631 | Ga0373937_0127124 | |||
| 632 | Ga0373937_0219927 | |||
| 633 | Ga0373937_0322065 | |||
| 634 | Ga0373937_0328147 | |||
| 635 | Ga0373937_0441042 | |||
| 636 | Ga0373925_0016833 | |||
| 637 | Ga0373925_0022523 | |||
| 638 | Ga0436364_0781748 | |||
| 639 | Ga0436365_0769526 | |||
| 640 | Ga0451576_0194250 | |||
| 641 | Ga0466967_0071188 | |||
| 642 | Ga0495592_0214575 | |||
| 643 | Ga0495629_0213892 | |||
| 644 | Ga0495580_0012076 | |||
| 645 | Ga0495608_0029412 | |||
| 646 | Ga0495628_0308093 | |||
| 647 | Ga0495652_0336404 | |||
| 648 | Ga0495587_0024199 | |||
| 649 | Ga0495587_0214702 | |||
| 650 | Ga0495645_0074990 | |||
| 651 | Ga0495667_0248196 | |||
| 652 | Ga0495667_0472061 | |||
| 653 | Ga0495599_0031548 | |||
| 654 | Ga0495599_0373474 | |||
| 655 | Ga0495623_0084676 | |||
| 656 | Ga0495669_0217577 | |||
| 657 | Ga0495613_0202170 | |||
| 658 | Ga0495581_0302059 | |||
| 659 | Ga0495674_0076276 | |||
| 660 | Ga0495674_0397289 | |||
| 661 | Ga0495675_0221447 | |||
| 662 | Ga0495684_0117163 | |||
| 663 | Ga0495684_0334352 | |||
| 664 | Ga0495684_0526158 | |||
| 665 | Ga0495602_0015223 | |||
| 666 | Ga0496102_0283773 | |||
| 667 | Ga0501031_0017758 | |||
| 668 | Ga0501032_0001345 | |||
| 669 | Ga0501033_0019792 | |||
| 670 | Ga0501034_0042851 | |||
| 671 | Ga0501036_0019652 | |||
| 672 | Ga0501037_0039703 | |||
| 673 | Ga0501038_0000328 | |||
| 674 | Ga0501042_0417204 | |||
| 675 | Ga0501043_0133606 | |||
| 676 | Ga0501046_0000813 | |||
| 677 | Ga0501048_0386707 | |||
| 678 | Ga0501067_0020365 | |||
| 679 | Ga0501068_0001928 | |||
| 680 | Ga0501069_0000739 | |||
| 681 | Ga0501070_0346824 | |||
| 682 | Ga0501072_0001411 | |||
| 683 | Ga0501073_0069763 | |||
| 684 | Ga0501074_0162395 | |||
| 685 | Ga0501077_0003511 | |||
| 686 | Ga0501250_024526 | |||
| 687 | Ga0501079_0016072 | |||
| 688 | Ga0501080_0000436 | |||
| 689 | Ga0501081_0240147 | |||
| 690 | Ga0501083_0022818 | |||
| 691 | Ga0501044_0130841 | |||
| 692 | nmdc:mga0n895_1068867_c1 | |||
| 693 | nmdc:mga0n895_1652165_c1 | |||
| 694 | nmdc:mga08x19_328_c2 | |||
| 695 | Ga0495601_0119613 | |||
| 696 | Ga0500568_0001618 | |||
| 697 | Ga0501084_0006884 | |||
| 698 | Ga0501082_0014366 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kag-assembly2.cif.gz_B | crystal structure of the escherichia coli shikimate kinase i (arok) | 0.9295 | 9 | 174 |
| 2pt5-assembly4.cif.gz_D | crystal structure of shikimate kinase (aq_2177) from aquifex aeolicus vf5 | 0.9215 | 10 | 174 |
| 4y0a-assembly1.cif.gz_A | shikimate kinase from acinetobacter baumannii in complex with shikimate | 0.9192 | 8 | 174 |
| 1u8a-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis shikimate kinase in complex with shikimate and adp at 2.15 angstrom resolution | 0.9097 | 11 | 174 |
| 2iyz-assembly1.cif.gz_A | shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp | 0.908 | 11 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4y0aA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9192 | 8 | 174 | 3.40.50.300 |
| 3n2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9057 | 9 | 174 | 3.40.50.300 |
| 1kagA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9055 | 9 | 174 | 3.40.50.300 |
| af_P0A6E1_1_171_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8985 | 8 | 174 | 3.40.50.300 |
| af_Q2FY32_1_173_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8934 | 9 | 174 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N9MCB0-F1-model_v4 | Shikimate kinase (SK) (EC 2.7.1.71) | 0.9683 | 3 | 179 |
GO:0000287
GO:0004765 GO:0005524 GO:0005737 GO:0008652 GO:0009073 GO:0009423 GO:0016020 GO:0016491 |
| AF-A0A349H2A1-F1-model_v4 | Shikimate kinase (EC 2.7.1.71) | 0.968 | 8 | 122 |
GO:0004765
GO:0005524 GO:0005829 GO:0008652 GO:0009073 |
| AF-A0A7X2PHS0-F1-model_v4 | Shikimate kinase (SK) (EC 2.7.1.71) | 0.9632 | 9 | 175 |
GO:0000287
GO:0004765 GO:0005524 GO:0005829 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A2E1W088-F1-model_v4 | Shikimate kinase (SK) (EC 2.7.1.71) | 0.9609 | 8 | 174 |
GO:0000287
GO:0004765 GO:0005524 GO:0005829 GO:0008652 GO:0009073 GO:0009423 |
| AF-A0A522PRW0-F1-model_v4 | Shikimate kinase (SK) (EC 2.7.1.71) | 0.9543 | 7 | 179 |
GO:0000287
GO:0004765 GO:0005524 GO:0005829 GO:0008652 GO:0009073 GO:0009423 |