F417828

General Info

Members Datasets Scaffolds Average Seq Length
349 178 698 328

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100182302|Ga0070699_1001823022
Length 355
Sequence VAARKEINRLEQAKTVSLAIGQMASYIERRKFLATLGGAAAAWPMAARAQQREKMRRIGVLLPFSSDDAESQARMGAFLQTLALSGWTIGRNVQIDTRWGARDAERIQRYAAELVALAPDVILAHGISTVGPLRQATRTVPIVFPVMNDPVGLGVVDSLARPGGNVTGFIVTEFDFSGKWLELLKQVAPDVTRVAVLRDTAIGTGTSQFAVIKALSPLLRVEVNPVDLRDPSDIEQAVAAFARSLNGGLIATAGSGTARHRDLIIALAARHKLPAVYFERNFVSAGGLISYGPDYVDQYRKAAHYVDRILKGEKPADLPVQAPTKYELVINLKTAKALGLEVPSTVLARADEVIE

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 12.89
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 4.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100182302 3300005518 Bacteria 1863
2 Ga0070690_100023045 3300005330 Bacteria 3815
3 Ga0070670_100090506 3300005331 Bacteria 2629
4 Ga0068869_100207790 3300005334 Unclassified 1546
5 Ga0070682_100080605 3300005337 Bacteria 2105
6 Ga0070691_10026010 3300005341 Bacteria 2726
7 Ga0070661_100069856 3300005344 Bacteria 2582
8 Ga0070668_100364226 3300005347 Bacteria 1227
9 Ga0070675_100108798 3300005354 Bacteria 2341
10 Ga0070674_100040788 3300005356 Bacteria 3142
11 Ga0070659_100281782 3300005366 Bacteria 1383
12 Ga0070709_10368872 3300005434 Bacteria 1065
13 Ga0070711_100468099 3300005439 Bacteria 1034
14 Ga0070700_100031724 3300005441 Bacteria 3169
15 Ga0070694_100115801 3300005444 Unclassified 1916
16 Ga0070708_100128683 3300005445 Bacteria 2342
17 Ga0070663_100053022 3300005455 Bacteria 2894
18 Ga0070678_100034439 3300005456 Bacteria 3527
19 Ga0070678_100287363 3300005456 Bacteria 1393
20 Ga0070662_100041311 3300005457 Bacteria 3289
21 Ga0070681_10013792 3300005458 Bacteria 8045
22 Ga0070706_100258194 3300005467 Bacteria 1627
23 Ga0070698_100029762 3300005471 Bacteria 5666
24 Ga0070698_100099500 3300005471 Bacteria 2881
25 Ga0070698_100143840 3300005471 Bacteria 2335
26 Ga0070699_100008594 3300005518 Bacteria 8850
27 Ga0070699_100017790 3300005518 Bacteria 6103
28 Ga0070699_100035681 3300005518 Bacteria 4298
29 Ga0070684_100061692 3300005535 Unclassified 3282
30 Ga0070697_100021326 3300005536 Bacteria 5132
31 Ga0070697_100170217 3300005536 Bacteria 1843
32 Ga0070697_100266075 3300005536 Bacteria 1469
33 Ga0070697_100384753 3300005536 Bacteria 1215
34 Ga0070672_100082403 3300005543 Bacteria 2581
35 Ga0070686_100045848 3300005544 Bacteria 2755
36 Ga0070695_100032262 3300005545 Bacteria 3274
37 Ga0070664_100013596 3300005564 Bacteria 6631
38 Ga0068857_100219383 3300005577 Unclassified 1737
39 Ga0070702_100019308 3300005615 Bacteria 3552
40 Ga0070702_100039163 3300005615 Bacteria 2643
41 Ga0068861_100419526 3300005719 Bacteria 1192
42 Ga0068870_10125806 3300005840 Bacteria 1482
43 Ga0068863_100050098 3300005841 Bacteria 3960
44 Ga0068860_100116563 3300005843 Bacteria 2556
45 Ga0068862_100150030 3300005844 Bacteria 2074
46 Ga0081455_10015391 3300005937 Bacteria 7436
47 Ga0081455_10031101 3300005937 Bacteria 4835
48 Ga0081455_10034591 3300005937 Bacteria 4526
49 Ga0081455_10043252 3300005937 Bacteria 3943
50 Ga0081455_10048143 3300005937 Bacteria 3686
51 Ga0081455_10064568 3300005937 Bacteria 3065
52 Ga0081455_10080537 3300005937 Bacteria 2669
53 Ga0081455_10102696 3300005937 Bacteria 2291
54 Ga0081455_10110768 3300005937 Bacteria 2182
55 Ga0081455_10116434 3300005937 Bacteria 2114
56 Ga0081455_10277154 3300005937 Bacteria 1213
57 Ga0081540_1022497 3300005983 Bacteria 3722
58 Ga0081540_1025875 3300005983 Bacteria 3365
59 Ga0081540_1032449 3300005983 Bacteria 2852
60 Ga0070717_10125837 3300006028 Bacteria 2200
61 Ga0070717_10160930 3300006028 Bacteria 1947
62 Ga0070717_10343867 3300006028 Bacteria 1332
63 Ga0075365_10107566 3300006038 Bacteria 1915
64 Ga0070715_10066648 3300006163 Bacteria 1597
65 Ga0070712_100131050 3300006175 Bacteria 1900
66 Ga0075362_10093244 3300006177 Bacteria 1400
67 Ga0075427_10000333 3300006194 Bacteria 5174
68 Ga0097621_100041652 3300006237 Bacteria 3697
69 Ga0068871_100399921 3300006358 Unclassified 1223
70 Ga0075428_100075955 3300006844 Bacteria 3668
71 Ga0075428_100096664 3300006844 Bacteria 3219
72 Ga0075428_100178910 3300006844 Bacteria 2296
73 Ga0075428_100203938 3300006844 Bacteria 2137
74 Ga0075428_100204248 3300006844 Bacteria 2135
75 Ga0075428_100307042 3300006844 Bacteria 1705
76 Ga0075428_100431747 3300006844 Bacteria 1411
77 Ga0075430_100011935 3300006846 Bacteria 7397
78 Ga0075430_100015663 3300006846 Bacteria 6457
79 Ga0075430_100123574 3300006846 Bacteria 2157
80 Ga0075430_100130462 3300006846 Bacteria 2095
81 Ga0075431_100018566 3300006847 Bacteria 7085
82 Ga0075431_100094114 3300006847 Bacteria 3092
83 Ga0075431_100109133 3300006847 Bacteria 2856
84 Ga0075431_100193280 3300006847 Bacteria 2084
85 Ga0075431_100210256 3300006847 Bacteria 1987
86 Ga0075431_100317779 3300006847 Bacteria 1571
87 Ga0075431_100432149 3300006847 Bacteria 1314
88 Ga0075433_10052179 3300006852 Bacteria 3563
89 Ga0075433_10078080 3300006852 Bacteria 2917
90 Ga0075434_100010847 3300006871 Bacteria 8564
91 Ga0075434_100077842 3300006871 Bacteria 3311
92 Ga0075434_100201585 3300006871 Bacteria 2010
93 Ga0075429_100038893 3300006880 Bacteria 4141
94 Ga0075429_100055812 3300006880 Bacteria 3437
95 Ga0075429_100065577 3300006880 Bacteria 3161
96 Ga0075429_100065989 3300006880 Bacteria 3150
97 Ga0075429_100068328 3300006880 Bacteria 3092
98 Ga0075429_100222133 3300006880 Bacteria 1655
99 Ga0068865_100029617 3300006881 Bacteria 3635
100 Ga0075435_100043298 3300007076 Bacteria 3604
101 Ga0075435_100089088 3300007076 Bacteria 2543
102 Ga0111539_10030403 3300009094 Bacteria 6564
103 Ga0111539_10041106 3300009094 Bacteria 5561
104 Ga0111539_10234287 3300009094 Bacteria 2137
105 Ga0111539_10237519 3300009094 Bacteria 2121
106 Ga0111539_10489952 3300009094 Bacteria 1432
107 Ga0111539_10499981 3300009094 Bacteria 1416
108 Ga0105247_10052410 3300009101 Bacteria 2516
109 Ga0114129_10026506 3300009147 Bacteria 8207
110 Ga0114129_10035986 3300009147 Bacteria 6992
111 Ga0114129_10105635 3300009147 Bacteria 3891
112 Ga0114129_10171685 3300009147 Bacteria 2956
113 Ga0114129_10174990 3300009147 Bacteria 2924
114 Ga0114129_10219611 3300009147 Bacteria 2565
115 Ga0114129_10250845 3300009147 Bacteria 2376
116 Ga0114129_10302969 3300009147 Bacteria 2129
117 Ga0114129_10316026 3300009147 Bacteria 2077
118 Ga0114129_10327753 3300009147 Bacteria 2034
119 Ga0114129_10330189 3300009147 Bacteria 2025
120 Ga0105249_10129270 3300009553 Bacteria 2409
121 Ga0105239_10119027 3300010375 Bacteria 2931
122 Ga0163162_10168484 3300013306 Bacteria 2314
123 Ga0157375_10125151 3300013308 Bacteria 2684
124 Ga0157375_10657828 3300013308 Bacteria 1204
125 Ga0163163_10002301 3300014325 Bacteria 16120
126 Ga0163163_10040898 3300014325 Bacteria 4530
127 Ga0157380_10262328 3300014326 Bacteria 1570
128 Ga0157376_10048857 3300014969 Bacteria 3502
129 Ga0157376_10517816 3300014969 Bacteria 1175
130 Ga0163161_10052681 3300017792 Bacteria 2950
131 Ga0228598_1004051 3300024227 Bacteria 3118
132 Ga0207666_1002292 3300025271 Unclassified 2296
133 Ga0207697_10006790 3300025315 Bacteria 5146
134 Ga0207692_10008013 3300025898 Bacteria 4357
135 Ga0207688_10124220 3300025901 Bacteria 1508
136 Ga0207685_10104797 3300025905 Bacteria 1216
137 Ga0207699_10119383 3300025906 Bacteria 1703
138 Ga0207645_10115692 3300025907 Bacteria 1739
139 Ga0207684_10099390 3300025910 Bacteria 2485
140 Ga0207684_10304337 3300025910 Bacteria 1374
141 Ga0207693_10016195 3300025915 Bacteria 5961
142 Ga0207693_10143497 3300025915 Bacteria 1877
143 Ga0207662_10031939 3300025918 Bacteria 3062
144 Ga0207649_10028580 3300025920 Bacteria 3284
145 Ga0207650_10054428 3300025925 Bacteria 2968
146 Ga0207659_10043613 3300025926 Bacteria 3151
147 Ga0207687_10268831 3300025927 Unclassified 1362
148 Ga0207664_10109497 3300025929 Bacteria 2295
149 Ga0207706_10023924 3300025933 Bacteria 5479
150 Ga0207669_10097526 3300025937 Bacteria 1933
151 Ga0207704_10028594 3300025938 Unclassified 3095
152 Ga0207691_10036354 3300025940 Bacteria 4563
153 Ga0207711_10032094 3300025941 Bacteria 4439
154 Ga0207689_10054305 3300025942 Bacteria 3300
155 Ga0207661_10170310 3300025944 Bacteria 1895
156 Ga0207679_10188036 3300025945 Unclassified 1714
157 Ga0207712_10128689 3300025961 Bacteria 1926
158 Ga0207668_10334914 3300025972 Bacteria 1260
159 Ga0207678_10028884 3300026067 Bacteria 4841
160 Ga0207708_10053654 3300026075 Bacteria 3072
161 Ga0207708_10097287 3300026075 Bacteria 2275
162 Ga0207641_10087522 3300026088 Bacteria 2718
163 Ga0207676_10108364 3300026095 Bacteria 2319
164 Ga0207675_100507842 3300026118 Bacteria 1201
165 Ga0207683_10019017 3300026121 Bacteria 5862
166 Ga0207428_10002492 3300027907 Bacteria 18387
167 Ga0207428_10008269 3300027907 Bacteria 9409
168 Ga0268264_10203945 3300028381 Unclassified 1811
169 Ga0373923_0121902 3300035111 Bacteria 1166
170 Ga0373945_0092568 3300035116 Bacteria 1172
171 Ga0373943_0058629 3300035170 Bacteria 1917
172 Ga0373946_0018847 3300035171 Bacteria 2653
173 Ga0373946_0028341 3300035171 Bacteria 2221
174 Ga0373946_0046603 3300035171 Bacteria 1797
175 Ga0373946_0059548 3300035171 Bacteria 1621
176 Ga0373946_0062114 3300035171 Unclassified 1593
177 Ga0373955_0071304 3300035172 Bacteria 1943
178 Ga0373931_0191871 3300035691 Bacteria 1216
179 Ga0373935_0009533 3300035692 Bacteria 5810
180 Ga0373935_0048428 3300035692 Bacteria 2691
181 Ga0373935_0323758 3300035692 Bacteria 1094
182 Ga0373933_0076330 3300035724 Bacteria 2047
183 Ga0373947_0027949 3300035725 Bacteria 3304
184 Ga0373947_0038437 3300035725 Bacteria 2843
185 Ga0373947_0067882 3300035725 Bacteria 2179
186 Ga0373937_0048331 3300036401 Bacteria 3895
187 Ga0395901_0653802 3300038443 Bacteria 1054
188 Ga0436360_1192974 3300039438 Bacteria 3477
189 Ga0495592_0341906 3300046454 Bacteria 962
190 Ga0495603_0003622 3300046455 Bacteria 9187
191 Ga0495603_0020947 3300046455 Bacteria 3959
192 Ga0495629_0000622 3300046459 Bacteria 28827
193 Ga0495629_0035097 3300046459 Bacteria 3545
194 Ga0495629_0244067 3300046459 Bacteria 1236
195 Ga0495651_0045461 3300046462 Bacteria 3401
196 Ga0495653_0062862 3300046463 Bacteria 2804
197 Ga0495582_0021909 3300046473 Bacteria 3496
198 Ga0495639_0169595 3300046475 Bacteria 1059
199 Ga0495662_0093823 3300046476 Bacteria 1465
200 Ga0495662_0097777 3300046476 Bacteria 1435
201 Ga0495664_0000923 3300046477 Bacteria 15150
202 Ga0495664_0166954 3300046477 Bacteria 1335
203 Ga0495594_0021661 3300046499 Bacteria 3432
204 Ga0495594_0271376 3300046499 Bacteria 966
205 Ga0495618_0120071 3300046514 Bacteria 1683
206 Ga0495628_0065465 3300046516 Bacteria 2842
207 Ga0495630_0178816 3300046517 Bacteria 1617
208 Ga0495652_0055862 3300046529 Bacteria 3356
209 Ga0495652_0148283 3300046529 Bacteria 1836
210 Ga0495652_0224731 3300046529 Bacteria 1408
211 Ga0495665_0113704 3300046531 Bacteria 1419
212 Ga0495640_0012513 3300046533 Bacteria 6480
213 Ga0495640_0034790 3300046533 Bacteria 3567
214 Ga0495640_0071487 3300046533 Bacteria 2328
215 Ga0495640_0095357 3300046533 Bacteria 1958
216 Ga0495586_0148756 3300046535 Bacteria 1317
217 Ga0495587_0080904 3300046536 Unclassified 1882
218 Ga0495598_0019295 3300046537 Bacteria 1786
219 Ga0495645_0075255 3300046543 Bacteria 2430
220 Ga0495667_0155060 3300046559 Bacteria 1474
221 Ga0495656_0172216 3300046615 Bacteria 1059
222 Ga0495634_0041052 3300046642 Bacteria 3143
223 Ga0495634_0148158 3300046642 Bacteria 1486
224 Ga0495634_0170138 3300046642 Bacteria 1369
225 Ga0495635_0005631 3300046663 Bacteria 8730
226 Ga0495635_0127222 3300046663 Bacteria 1737
227 Ga0495599_0019483 3300046678 Bacteria 4229
228 Ga0495647_0002572 3300046681 Bacteria 5749
229 Ga0495647_0015438 3300046681 Bacteria 2677
230 Ga0495658_0013228 3300046683 Bacteria 4199
231 Ga0495613_0141564 3300046689 Bacteria 1719
232 Ga0495613_0245105 3300046689 Bacteria 1252
233 Ga0495624_0191106 3300046690 Bacteria 1245
234 Ga0495589_0048725 3300046794 Bacteria 2097
235 Ga0495674_0002005 3300047319 Bacteria 20024
236 Ga0495674_0007416 3300047319 Bacteria 10481
237 Ga0495674_0016485 3300047319 Bacteria 6892
238 Ga0495674_0173504 3300047319 Bacteria 1798
239 Ga0495676_0029522 3300047321 Bacteria 4667
240 Ga0495676_0039305 3300047321 Bacteria 3919
241 Ga0495676_0079185 3300047321 Bacteria 2499
242 Ga0495676_0167422 3300047321 Bacteria 1549
243 Ga0495676_0221585 3300047321 Bacteria 1303
244 Ga0495680_0049416 3300047322 Bacteria 3294
245 Ga0495675_0054992 3300047444 Bacteria 2525
246 Ga0495684_0158372 3300047471 Bacteria 1690
247 Ga0495593_0027168 3300047673 Bacteria 3152
248 Ga0495602_0273196 3300048088 Bacteria 1248
249 Ga0496101_0010511 3300048904 Bacteria 6113
250 Ga0496101_0116720 3300048904 Bacteria 2014
251 Ga0496101_0469395 3300048904 Bacteria 993
252 Ga0496101_0475595 3300048904 Bacteria 986
253 Ga0496102_0072707 3300048905 Bacteria 3161
254 Ga0496102_0414694 3300048905 Bacteria 1265
255 Ga0496104_0016803 3300048907 Bacteria 6650
256 Ga0496104_0170456 3300048907 Bacteria 2087
257 Ga0496104_0361347 3300048907 Bacteria 1364
258 Ga0496104_0450014 3300048907 Bacteria 1199
259 Ga0496105_0043625 3300048908 Bacteria 3699
260 Ga0496105_0335258 3300048908 Bacteria 1210
261 Ga0496105_0389225 3300048908 Bacteria 1108
262 Ga0496106_0046944 3300048909 Unclassified 3248
263 Ga0496106_0142049 3300048909 Bacteria 1889
264 Ga0496106_0235088 3300048909 Bacteria 1464
265 Ga0496107_0043360 3300048910 Bacteria 3232
266 Ga0496107_0046185 3300048910 Bacteria 3134
267 Ga0496107_0491967 3300048910 Bacteria 910
268 Ga0496108_0099162 3300048911 Bacteria 2483
269 Ga0496108_0142354 3300048911 Bacteria 2066
270 Ga0496108_0257563 3300048911 Bacteria 1518
271 Ga0496108_0346387 3300048911 Bacteria 1296
272 Ga0496108_0425080 3300048911 Bacteria 1160
273 Ga0496108_0450896 3300048911 Bacteria 1124
274 Ga0496109_0103377 3300048912 Unclassified 2644
275 Ga0496109_0228791 3300048912 Bacteria 1749
276 Ga0496109_0367321 3300048912 Bacteria 1359
277 Ga0496110_0047293 3300048913 Bacteria 3767
278 Ga0496110_0306819 3300048913 Bacteria 1446
279 Ga0496110_0392342 3300048913 Bacteria 1265
280 Ga0496111_0234807 3300048914 Bacteria 1362
281 Ga0496112_0046855 3300048915 Bacteria 4241
282 Ga0496112_0144002 3300048915 Bacteria 2352
283 Ga0496112_0421026 3300048915 Bacteria 1274
284 Ga0496112_0498417 3300048915 Bacteria 1153
285 Ga0496113_0008686 3300048916 Bacteria 6630
286 Ga0496113_0081226 3300048916 Bacteria 2484
287 Ga0496113_0373811 3300048916 Bacteria 1144
288 Ga0496114_0060942 3300048917 Bacteria 3154
289 Ga0496114_0094850 3300048917 Bacteria 2538
290 Ga0496114_0305664 3300048917 Bacteria 1404
291 Ga0496115_0051433 3300048918 Bacteria 3304
292 Ga0496115_0068406 3300048918 Bacteria 2875
293 Ga0496115_0320303 3300048918 Bacteria 1268
294 Ga0501036_0317609 3300049572 Bacteria 1302
295 nmdc:mga00v17_234374_c1 3300050491 Bacteria 1190
296 nmdc:mga0yw44_15832_c1 3300050492 Bacteria 4054
297 nmdc:mga0yw44_64398_c1 3300050492 Bacteria 2256
298 nmdc:mga0k408_28876_c1 3300050493 Bacteria 3154
299 nmdc:mga05p37_113530_c1 3300050507 Bacteria 3331
300 nmdc:mga05p37_114132_c2 3300050507 Bacteria 2569
301 nmdc:mga05p37_189273_c1 3300050507 Bacteria 2500
302 nmdc:mga05p37_260047_c1 3300050507 Bacteria 2078
303 nmdc:mga05p37_261095_c1 3300050507 Bacteria 2073
304 nmdc:mga05p37_26596_c1 3300050507 Bacteria 7036
305 nmdc:mga05p37_267570_c1 3300050507 Bacteria 2043
306 nmdc:mga05p37_29813_c1 3300050507 Bacteria 6658
307 nmdc:mga05p37_362808_c1 3300050507 Bacteria 1703
308 nmdc:mga05p37_444732_c1 3300050507 Bacteria 1502
309 nmdc:mga05p37_459087_c1 3300050507 Bacteria 1472
310 nmdc:mga05p37_574066_c1 3300050507 Bacteria 1279
311 nmdc:mga09592_129317_c1 3300050508 Bacteria 2172
312 nmdc:mga09592_26203_c1 3300050508 Bacteria 4830
313 nmdc:mga09592_272599_c1 3300050508 Bacteria 1468
314 nmdc:mga0qj67_19564_c1 3300050509 Bacteria 5174
315 nmdc:mga0qj67_294596_c1 3300050509 Bacteria 1315
316 nmdc:mga0qj67_40883_c1 3300050509 Bacteria 3645
317 nmdc:mga0qj67_9064_c1 3300050509 Bacteria 7385
318 nmdc:mga06r32_1160_c1 3300050510 Bacteria 23695
319 nmdc:mga06r32_271191_c1 3300050510 Bacteria 1684
320 nmdc:mga06r32_291450_c1 3300050510 Bacteria 1619
321 nmdc:mga06r32_2978_c1 3300050510 Bacteria 15182
322 nmdc:mga06r32_316266_c1 3300050510 Bacteria 1547
323 nmdc:mga06r32_432428_c1 3300050510 Bacteria 1297
324 nmdc:mga06r32_669796_c1 3300050510 Bacteria 1005
325 nmdc:mga08y16_12278_c1 3300050511 Bacteria 9005
326 nmdc:mga08y16_14538_c1 3300050511 Bacteria 8280
327 nmdc:mga08y16_153127_c1 3300050511 Bacteria 2396
328 nmdc:mga08y16_358825_c1 3300050511 Bacteria 1496
329 nmdc:mga08y16_99437_c1 3300050511 Bacteria 3029
330 nmdc:mga0n895_10014_c1 3300050512 Bacteria 8345
331 nmdc:mga0n895_6021_c1 3300050512 Bacteria 10221
332 nmdc:mga0rr50_117763_c1 3300050513 Bacteria 2110
333 nmdc:mga0rr50_5362_c1 3300050513 Bacteria 7641
334 nmdc:mga0a205_11766_c1 3300050515 Bacteria 8072
335 nmdc:mga0a205_12268_c1 3300050515 Bacteria 7928
336 Ga0495601_0000469 3300053077 Bacteria 21190
337 Ga0495601_0001259 3300053077 Bacteria 13868
338 Ga0495601_0026652 3300053077 Bacteria 3570
339 Ga0495612_0007389 3300053078 Bacteria 4490
340 Ga0495612_0028672 3300053078 Bacteria 2241
341 Ga0495612_0038220 3300053078 Bacteria 1950
342 Ga0495595_0081683 3300053084 Bacteria 1540
343 Ga0495619_0000275 3300053085 Bacteria 37064
344 Ga0495619_0006783 3300053085 Bacteria 7243
345 Ga0495619_0065311 3300053085 Bacteria 2427
346 Ga0495619_0091219 3300053085 Bacteria 2063
347 Ga0495619_0168614 3300053085 Bacteria 1514
348 Ga0495619_0267190 3300053085 Bacteria 1185
349 Ga0501084_0343431 3300054114 Bacteria 1261
350 Ga0070699_100182302
351 Ga0070690_100023045
352 Ga0070670_100090506
353 Ga0068869_100207790
354 Ga0070682_100080605
355 Ga0070691_10026010
356 Ga0070661_100069856
357 Ga0070668_100364226
358 Ga0070675_100108798
359 Ga0070674_100040788
360 Ga0070659_100281782
361 Ga0070709_10368872
362 Ga0070711_100468099
363 Ga0070700_100031724
364 Ga0070694_100115801
365 Ga0070708_100128683
366 Ga0070663_100053022
367 Ga0070678_100034439
368 Ga0070678_100287363
369 Ga0070662_100041311
370 Ga0070681_10013792
371 Ga0070706_100258194
372 Ga0070698_100029762
373 Ga0070698_100099500
374 Ga0070698_100143840
375 Ga0070699_100008594
376 Ga0070699_100017790
377 Ga0070699_100035681
378 Ga0070684_100061692
379 Ga0070697_100021326
380 Ga0070697_100170217
381 Ga0070697_100266075
382 Ga0070697_100384753
383 Ga0070672_100082403
384 Ga0070686_100045848
385 Ga0070695_100032262
386 Ga0070664_100013596
387 Ga0068857_100219383
388 Ga0070702_100019308
389 Ga0070702_100039163
390 Ga0068861_100419526
391 Ga0068870_10125806
392 Ga0068863_100050098
393 Ga0068860_100116563
394 Ga0068862_100150030
395 Ga0081455_10015391
396 Ga0081455_10031101
397 Ga0081455_10034591
398 Ga0081455_10043252
399 Ga0081455_10048143
400 Ga0081455_10064568
401 Ga0081455_10080537
402 Ga0081455_10102696
403 Ga0081455_10110768
404 Ga0081455_10116434
405 Ga0081455_10277154
406 Ga0081540_1022497
407 Ga0081540_1025875
408 Ga0081540_1032449
409 Ga0070717_10125837
410 Ga0070717_10160930
411 Ga0070717_10343867
412 Ga0075365_10107566
413 Ga0070715_10066648
414 Ga0070712_100131050
415 Ga0075362_10093244
416 Ga0075427_10000333
417 Ga0097621_100041652
418 Ga0068871_100399921
419 Ga0075428_100075955
420 Ga0075428_100096664
421 Ga0075428_100178910
422 Ga0075428_100203938
423 Ga0075428_100204248
424 Ga0075428_100307042
425 Ga0075428_100431747
426 Ga0075430_100011935
427 Ga0075430_100015663
428 Ga0075430_100123574
429 Ga0075430_100130462
430 Ga0075431_100018566
431 Ga0075431_100094114
432 Ga0075431_100109133
433 Ga0075431_100193280
434 Ga0075431_100210256
435 Ga0075431_100317779
436 Ga0075431_100432149
437 Ga0075433_10052179
438 Ga0075433_10078080
439 Ga0075434_100010847
440 Ga0075434_100077842
441 Ga0075434_100201585
442 Ga0075429_100038893
443 Ga0075429_100055812
444 Ga0075429_100065577
445 Ga0075429_100065989
446 Ga0075429_100068328
447 Ga0075429_100222133
448 Ga0068865_100029617
449 Ga0075435_100043298
450 Ga0075435_100089088
451 Ga0111539_10030403
452 Ga0111539_10041106
453 Ga0111539_10234287
454 Ga0111539_10237519
455 Ga0111539_10489952
456 Ga0111539_10499981
457 Ga0105247_10052410
458 Ga0114129_10026506
459 Ga0114129_10035986
460 Ga0114129_10105635
461 Ga0114129_10171685
462 Ga0114129_10174990
463 Ga0114129_10219611
464 Ga0114129_10250845
465 Ga0114129_10302969
466 Ga0114129_10316026
467 Ga0114129_10327753
468 Ga0114129_10330189
469 Ga0105249_10129270
470 Ga0105239_10119027
471 Ga0163162_10168484
472 Ga0157375_10125151
473 Ga0157375_10657828
474 Ga0163163_10002301
475 Ga0163163_10040898
476 Ga0157380_10262328
477 Ga0157376_10048857
478 Ga0157376_10517816
479 Ga0163161_10052681
480 Ga0228598_1004051
481 Ga0207666_1002292
482 Ga0207697_10006790
483 Ga0207692_10008013
484 Ga0207688_10124220
485 Ga0207685_10104797
486 Ga0207699_10119383
487 Ga0207645_10115692
488 Ga0207684_10099390
489 Ga0207684_10304337
490 Ga0207693_10016195
491 Ga0207693_10143497
492 Ga0207662_10031939
493 Ga0207649_10028580
494 Ga0207650_10054428
495 Ga0207659_10043613
496 Ga0207687_10268831
497 Ga0207664_10109497
498 Ga0207706_10023924
499 Ga0207669_10097526
500 Ga0207704_10028594
501 Ga0207691_10036354
502 Ga0207711_10032094
503 Ga0207689_10054305
504 Ga0207661_10170310
505 Ga0207679_10188036
506 Ga0207712_10128689
507 Ga0207668_10334914
508 Ga0207678_10028884
509 Ga0207708_10053654
510 Ga0207708_10097287
511 Ga0207641_10087522
512 Ga0207676_10108364
513 Ga0207675_100507842
514 Ga0207683_10019017
515 Ga0207428_10002492
516 Ga0207428_10008269
517 Ga0268264_10203945
518 Ga0373923_0121902
519 Ga0373945_0092568
520 Ga0373943_0058629
521 Ga0373946_0018847
522 Ga0373946_0028341
523 Ga0373946_0046603
524 Ga0373946_0059548
525 Ga0373946_0062114
526 Ga0373955_0071304
527 Ga0373931_0191871
528 Ga0373935_0009533
529 Ga0373935_0048428
530 Ga0373935_0323758
531 Ga0373933_0076330
532 Ga0373947_0027949
533 Ga0373947_0038437
534 Ga0373947_0067882
535 Ga0373937_0048331
536 Ga0395901_0653802
537 Ga0436360_1192974
538 Ga0495592_0341906
539 Ga0495603_0003622
540 Ga0495603_0020947
541 Ga0495629_0000622
542 Ga0495629_0035097
543 Ga0495629_0244067
544 Ga0495651_0045461
545 Ga0495653_0062862
546 Ga0495582_0021909
547 Ga0495639_0169595
548 Ga0495662_0093823
549 Ga0495662_0097777
550 Ga0495664_0000923
551 Ga0495664_0166954
552 Ga0495594_0021661
553 Ga0495594_0271376
554 Ga0495618_0120071
555 Ga0495628_0065465
556 Ga0495630_0178816
557 Ga0495652_0055862
558 Ga0495652_0148283
559 Ga0495652_0224731
560 Ga0495665_0113704
561 Ga0495640_0012513
562 Ga0495640_0034790
563 Ga0495640_0071487
564 Ga0495640_0095357
565 Ga0495586_0148756
566 Ga0495587_0080904
567 Ga0495598_0019295
568 Ga0495645_0075255
569 Ga0495667_0155060
570 Ga0495656_0172216
571 Ga0495634_0041052
572 Ga0495634_0148158
573 Ga0495634_0170138
574 Ga0495635_0005631
575 Ga0495635_0127222
576 Ga0495599_0019483
577 Ga0495647_0002572
578 Ga0495647_0015438
579 Ga0495658_0013228
580 Ga0495613_0141564
581 Ga0495613_0245105
582 Ga0495624_0191106
583 Ga0495589_0048725
584 Ga0495674_0002005
585 Ga0495674_0007416
586 Ga0495674_0016485
587 Ga0495674_0173504
588 Ga0495676_0029522
589 Ga0495676_0039305
590 Ga0495676_0079185
591 Ga0495676_0167422
592 Ga0495676_0221585
593 Ga0495680_0049416
594 Ga0495675_0054992
595 Ga0495684_0158372
596 Ga0495593_0027168
597 Ga0495602_0273196
598 Ga0496101_0010511
599 Ga0496101_0116720
600 Ga0496101_0469395
601 Ga0496101_0475595
602 Ga0496102_0072707
603 Ga0496102_0414694
604 Ga0496104_0016803
605 Ga0496104_0170456
606 Ga0496104_0361347
607 Ga0496104_0450014
608 Ga0496105_0043625
609 Ga0496105_0335258
610 Ga0496105_0389225
611 Ga0496106_0046944
612 Ga0496106_0142049
613 Ga0496106_0235088
614 Ga0496107_0043360
615 Ga0496107_0046185
616 Ga0496107_0491967
617 Ga0496108_0099162
618 Ga0496108_0142354
619 Ga0496108_0257563
620 Ga0496108_0346387
621 Ga0496108_0425080
622 Ga0496108_0450896
623 Ga0496109_0103377
624 Ga0496109_0228791
625 Ga0496109_0367321
626 Ga0496110_0047293
627 Ga0496110_0306819
628 Ga0496110_0392342
629 Ga0496111_0234807
630 Ga0496112_0046855
631 Ga0496112_0144002
632 Ga0496112_0421026
633 Ga0496112_0498417
634 Ga0496113_0008686
635 Ga0496113_0081226
636 Ga0496113_0373811
637 Ga0496114_0060942
638 Ga0496114_0094850
639 Ga0496114_0305664
640 Ga0496115_0051433
641 Ga0496115_0068406
642 Ga0496115_0320303
643 Ga0501036_0317609
644 nmdc:mga00v17_234374_c1
645 nmdc:mga0yw44_15832_c1
646 nmdc:mga0yw44_64398_c1
647 nmdc:mga0k408_28876_c1
648 nmdc:mga05p37_113530_c1
649 nmdc:mga05p37_114132_c2
650 nmdc:mga05p37_189273_c1
651 nmdc:mga05p37_260047_c1
652 nmdc:mga05p37_261095_c1
653 nmdc:mga05p37_26596_c1
654 nmdc:mga05p37_267570_c1
655 nmdc:mga05p37_29813_c1
656 nmdc:mga05p37_362808_c1
657 nmdc:mga05p37_444732_c1
658 nmdc:mga05p37_459087_c1
659 nmdc:mga05p37_574066_c1
660 nmdc:mga09592_129317_c1
661 nmdc:mga09592_26203_c1
662 nmdc:mga09592_272599_c1
663 nmdc:mga0qj67_19564_c1
664 nmdc:mga0qj67_294596_c1
665 nmdc:mga0qj67_40883_c1
666 nmdc:mga0qj67_9064_c1
667 nmdc:mga06r32_1160_c1
668 nmdc:mga06r32_271191_c1
669 nmdc:mga06r32_291450_c1
670 nmdc:mga06r32_2978_c1
671 nmdc:mga06r32_316266_c1
672 nmdc:mga06r32_432428_c1
673 nmdc:mga06r32_669796_c1
674 nmdc:mga08y16_12278_c1
675 nmdc:mga08y16_14538_c1
676 nmdc:mga08y16_153127_c1
677 nmdc:mga08y16_358825_c1
678 nmdc:mga08y16_99437_c1
679 nmdc:mga0n895_10014_c1
680 nmdc:mga0n895_6021_c1
681 nmdc:mga0rr50_117763_c1
682 nmdc:mga0rr50_5362_c1
683 nmdc:mga0a205_11766_c1
684 nmdc:mga0a205_12268_c1
685 Ga0495601_0000469
686 Ga0495601_0001259
687 Ga0495601_0026652
688 Ga0495612_0007389
689 Ga0495612_0028672
690 Ga0495612_0038220
691 Ga0495595_0081683
692 Ga0495619_0000275
693 Ga0495619_0006783
694 Ga0495619_0065311
695 Ga0495619_0091219
696 Ga0495619_0168614
697 Ga0495619_0267190
698 Ga0501084_0343431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

57

354

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9028 37 334
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8943 37 334
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.885 35 333
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8831 39 334
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8795 35 333
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.952 35 305 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9459 35 305 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8948 158 334 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8775 158 334 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8702 158 333 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.9698 157 335
AF-A0A7Y0XAS6-F1-model_v4 ABC transporter substrate-binding protein 0.9693 84 151
AF-A0A1C3W1M1-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9634 36 335
AF-A0A537NR15-F1-model_v4 ABC transporter substrate-binding protein 0.9625 196 335
AF-A0A537QMJ9-F1-model_v4 ABC transporter substrate-binding protein 0.9585 49 335

Map