F417827

General Info

Members Datasets Scaffolds Average Seq Length
349 164 698 338

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100191182|Ga0070698_1001911822
Length 342
Sequence MNDQKNQAGQEKEFDPHLAVSHANSGISRRGFLGFAAASVFLAGADGQAARPESRNGIPYRTLGRTREKVSVVGLGGYHLGKQADAQESIRIIRTGLDEGINFLDNCWDYNGGESEIRMGNALRDGYRQKAFLMSKIDGRTKAAATSQINESLRRLQTDHIDLLQFHEVIRENDPDRIFAEGGAMKAVLEAQKSPDIHLKMLATAAKHSFAFDAAQMPLNVMDAHFNSFEKKVLPVLLKNDIGVLGMKPMGDHVILESKTATPVECLHYAMNLPTSVVITGCDSLSILRQALQAARSFKPLGSSEVASLLAKTAKAAEVGQFELYKTSHQFDGTYANPQWLG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
67 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
68 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
98 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.44
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100191182 3300005471 Unclassified 1984
2 Ga0070683_100220082 3300005329 Bacteria 1804
3 Ga0070670_100270146 3300005331 Unclassified 1484
4 Ga0070682_100124806 3300005337 Bacteria 1733
5 Ga0068868_100123418 3300005338 Bacteria 2114
6 Ga0070660_100025009 3300005339 Bacteria 4435
7 Ga0070709_10009290 3300005434 Bacteria 5418
8 Ga0070709_10043845 3300005434 Bacteria 2768
9 Ga0070714_100049489 3300005435 Unclassified 3577
10 Ga0070714_100052942 3300005435 Unclassified 3463
11 Ga0070714_100090587 3300005435 Bacteria 2678
12 Ga0070713_100000574 3300005436 Bacteria 23325
13 Ga0070713_100001487 3300005436 Bacteria 14930
14 Ga0070713_100003566 3300005436 Bacteria 10279
15 Ga0070713_100041460 3300005436 Unclassified 3750
16 Ga0070713_100063918 3300005436 Unclassified 3087
17 Ga0070713_100164892 3300005436 Bacteria 1980
18 Ga0070713_100220306 3300005436 Bacteria 1721
19 Ga0070713_100301547 3300005436 Bacteria 1475
20 Ga0070710_10029361 3300005437 Bacteria 2950
21 Ga0070711_100124710 3300005439 Bacteria 1910
22 Ga0070708_100001273 3300005445 Bacteria 19399
23 Ga0070708_100002311 3300005445 Bacteria 14761
24 Ga0070708_100004717 3300005445 Bacteria 10741
25 Ga0070708_100011118 3300005445 Bacteria 7317
26 Ga0070708_100031297 3300005445 Bacteria 4604
27 Ga0070708_100125765 3300005445 Bacteria 2369
28 Ga0070662_100059482 3300005457 Bacteria 2784
29 Ga0070681_10032533 3300005458 Bacteria 5234
30 Ga0070681_10092550 3300005458 Bacteria 2972
31 Ga0070681_10198328 3300005458 Unclassified 1926
32 Ga0070685_10061769 3300005466 Bacteria 2195
33 Ga0070706_100001330 3300005467 Bacteria 26281
34 Ga0070706_100002168 3300005467 Bacteria 19959
35 Ga0070706_100003797 3300005467 Bacteria 14748
36 Ga0070706_100022374 3300005467 Bacteria 5821
37 Ga0070706_100047770 3300005467 Bacteria 3950
38 Ga0070706_100083279 3300005467 Bacteria 2963
39 Ga0070706_100155935 3300005467 Bacteria 2131
40 Ga0070707_100000674 3300005468 Bacteria 33906
41 Ga0070707_100002934 3300005468 Bacteria 16174
42 Ga0070707_100026821 3300005468 Bacteria 5473
43 Ga0070707_100066321 3300005468 Bacteria 3469
44 Ga0070707_100070217 3300005468 Bacteria 3374
45 Ga0070707_100191595 3300005468 Bacteria 1993
46 Ga0070707_100214490 3300005468 Bacteria 1876
47 Ga0070698_100000607 3300005471 Bacteria 38429
48 Ga0070698_100000725 3300005471 Bacteria 35382
49 Ga0070698_100001504 3300005471 Bacteria 25867
50 Ga0070698_100003545 3300005471 Bacteria 17159
51 Ga0070698_100039555 3300005471 Bacteria 4853
52 Ga0070698_100068972 3300005471 Bacteria 3552
53 Ga0070698_100222485 3300005471 Bacteria 1821
54 Ga0070699_100000343 3300005518 Bacteria 45107
55 Ga0070699_100009838 3300005518 Bacteria 8278
56 Ga0070699_100032473 3300005518 Bacteria 4508
57 Ga0070699_100046340 3300005518 Bacteria 3762
58 Ga0070699_100080307 3300005518 Bacteria 2842
59 Ga0070699_100131334 3300005518 Bacteria 2207
60 Ga0070699_100133484 3300005518 Bacteria 2189
61 Ga0070679_100016352 3300005530 Bacteria 7153
62 Ga0070679_100024494 3300005530 Bacteria 5913
63 Ga0070679_100260166 3300005530 Unclassified 1691
64 Ga0070679_100422976 3300005530 Bacteria 1277
65 Ga0070697_100000389 3300005536 Bacteria 34237
66 Ga0070697_100000487 3300005536 Bacteria 30200
67 Ga0070697_100003372 3300005536 Bacteria 12287
68 Ga0070697_100034864 3300005536 Bacteria 4059
69 Ga0070697_100076124 3300005536 Bacteria 2759
70 Ga0070697_100303415 3300005536 Unclassified 1373
71 Ga0068853_100125544 3300005539 Bacteria 2292
72 Ga0070686_100142853 3300005544 Bacteria 1668
73 Ga0070695_100001909 3300005545 Bacteria 11786
74 Ga0070695_100034778 3300005545 Bacteria 3162
75 Ga0070696_100002490 3300005546 Bacteria 12208
76 Ga0070696_100045223 3300005546 Bacteria 3050
77 Ga0070704_100011191 3300005549 Bacteria 5489
78 Ga0068855_100183905 3300005563 Unclassified 2362
79 Ga0070664_100552870 3300005564 Bacteria 1064
80 Ga0068859_100498114 3300005617 Bacteria 1313
81 Ga0068864_100170407 3300005618 Bacteria 1985
82 Ga0068858_100236513 3300005842 Bacteria 1732
83 Ga0068860_100154019 3300005843 Bacteria 2215
84 Ga0081540_1089337 3300005983 Bacteria 1360
85 Ga0070717_10000952 3300006028 Bacteria 19283
86 Ga0070717_10009674 3300006028 Bacteria 7257
87 Ga0070717_10015131 3300006028 Bacteria 5951
88 Ga0070717_10016703 3300006028 Bacteria 5697
89 Ga0070717_10037550 3300006028 Unclassified 3934
90 Ga0070717_10086156 3300006028 Unclassified 2644
91 Ga0070717_10242892 3300006028 Unclassified 1589
92 Ga0070717_10402446 3300006028 Bacteria 1230
93 Ga0070717_10411597 3300006028 Bacteria 1216
94 Ga0070717_10466969 3300006028 Bacteria 1139
95 Ga0070715_10009299 3300006163 Unclassified 3460
96 Ga0070716_100000187 3300006173 Bacteria 24361
97 Ga0070716_100001388 3300006173 Bacteria 10743
98 Ga0070716_100026561 3300006173 Bacteria 3102
99 Ga0070716_100045257 3300006173 Bacteria 2470
100 Ga0070716_100071023 3300006173 Bacteria 2046
101 Ga0070716_100079113 3300006173 Bacteria 1957
102 Ga0070716_100195779 3300006173 Bacteria 1339
103 Ga0070712_100000817 3300006175 Bacteria 18486
104 Ga0070712_100005391 3300006175 Bacteria 7916
105 Ga0070712_100026087 3300006175 Unclassified 3889
106 Ga0070712_100092389 3300006175 Unclassified 2219
107 Ga0070712_100132448 3300006175 Bacteria 1891
108 Ga0070712_100162049 3300006175 Bacteria 1728
109 Ga0070712_100320389 3300006175 Bacteria 1260
110 Ga0097621_100007133 3300006237 Bacteria 7966
111 Ga0097621_100127330 3300006237 Bacteria 2164
112 Ga0068871_100146012 3300006358 Bacteria 2014
113 Ga0068871_100178770 3300006358 Bacteria 1822
114 Ga0068871_100224019 3300006358 Bacteria 1630
115 Ga0075433_10165323 3300006852 Bacteria 1969
116 Ga0075434_100000041 3300006871 Bacteria 59536
117 Ga0075434_100002692 3300006871 Bacteria 15693
118 Ga0075434_100036180 3300006871 Bacteria 4884
119 Ga0075434_100094283 3300006871 Bacteria 2998
120 Ga0075436_100041862 3300006914 Bacteria 3160
121 Ga0075436_100052941 3300006914 Bacteria 2802
122 Ga0075436_100106761 3300006914 Bacteria 1953
123 Ga0097620_100498080 3300006931 Bacteria 1313
124 Ga0075435_100000105 3300007076 Bacteria 45736
125 Ga0075435_100062516 3300007076 Bacteria 3022
126 Ga0099794_10002232 3300007265 Bacteria 7082
127 Ga0099794_10033526 3300007265 Bacteria 2415
128 Ga0099794_10127503 3300007265 Unclassified 1283
129 Ga0105240_10086141 3300009093 Bacteria 3848
130 Ga0105240_10122174 3300009093 Bacteria 3134
131 Ga0105245_10187696 3300009098 Bacteria 1978
132 Ga0105247_10300943 3300009101 Bacteria 1113
133 Ga0114129_10053617 3300009147 Bacteria 5656
134 Ga0114129_10093292 3300009147 Bacteria 4170
135 Ga0105241_10001583 3300009174 Bacteria 17415
136 Ga0105241_10002219 3300009174 Bacteria 14597
137 Ga0105241_10014798 3300009174 Bacteria 5711
138 Ga0105241_10321045 3300009174 Bacteria 1335
139 Ga0105248_10358682 3300009177 Unclassified 1641
140 Ga0105238_10095154 3300009551 Bacteria 2966
141 Ga0105249_10520787 3300009553 Bacteria 1236
142 Ga0099796_10006530 3300010159 Bacteria 2991
143 Ga0105239_10744609 3300010375 Bacteria 1121
144 Ga0157373_10284635 3300013100 Bacteria 1172
145 Ga0157371_10082501 3300013102 Bacteria 2276
146 Ga0157369_10116921 3300013105 Bacteria 2831
147 Ga0157374_10004551 3300013296 Bacteria 11636
148 Ga0157374_10083191 3300013296 Bacteria 3040
149 Ga0157374_10526273 3300013296 Bacteria 1188
150 Ga0157378_10084749 3300013297 Bacteria 2870
151 Ga0163162_10005173 3300013306 Bacteria 12580
152 Ga0163162_10080855 3300013306 Unclassified 3319
153 Ga0163162_10320591 3300013306 Bacteria 1682
154 Ga0163162_10329825 3300013306 Bacteria 1658
155 Ga0157372_10014827 3300013307 Bacteria 8345
156 Ga0157372_10053326 3300013307 Bacteria 4507
157 Ga0157372_10124734 3300013307 Unclassified 2960
158 Ga0157372_10559099 3300013307 Bacteria 1334
159 Ga0163163_10156831 3300014325 Bacteria 2321
160 Ga0157379_10001688 3300014968 Bacteria 18266
161 Ga0157379_10088771 3300014968 Bacteria 2773
162 Ga0157376_10001479 3300014969 Bacteria 15476
163 Ga0157376_10019108 3300014969 Bacteria 5273
164 Ga0182006_1051070 3300015261 Bacteria 1591
165 Ga0224569_100194 3300022732 Bacteria 4944
166 Ga0224571_100523 3300022734 Bacteria 2144
167 Ga0224572_1000296 3300024225 Bacteria 5249
168 Ga0224572_1000629 3300024225 Bacteria 4395
169 Ga0224572_1008759 3300024225 Bacteria 1877
170 Ga0228598_1000055 3300024227 Bacteria 16360
171 Ga0228598_1001002 3300024227 Bacteria 6176
172 Ga0228598_1001224 3300024227 Bacteria 5672
173 Ga0207692_10009383 3300025898 Bacteria 4085
174 Ga0207692_10046896 3300025898 Bacteria 2168
175 Ga0207692_10065859 3300025898 Unclassified 1892
176 Ga0207685_10002418 3300025905 Unclassified 4273
177 Ga0207699_10060396 3300025906 Bacteria 2276
178 Ga0207699_10103960 3300025906 Bacteria 1808
179 Ga0207699_10162372 3300025906 Bacteria 1488
180 Ga0207684_10000081 3300025910 Bacteria 178619
181 Ga0207684_10002892 3300025910 Bacteria 17013
182 Ga0207684_10036795 3300025910 Bacteria 4154
183 Ga0207684_10038763 3300025910 Bacteria 4043
184 Ga0207684_10055744 3300025910 Bacteria 3353
185 Ga0207684_10105675 3300025910 Bacteria 2408
186 Ga0207684_10166306 3300025910 Unclassified 1901
187 Ga0207654_10009872 3300025911 Unclassified 4855
188 Ga0207654_10104753 3300025911 Bacteria 1749
189 Ga0207654_10197055 3300025911 Unclassified 1324
190 Ga0207707_10010569 3300025912 Bacteria 8014
191 Ga0207707_10199618 3300025912 Unclassified 1744
192 Ga0207707_10237883 3300025912 Bacteria 1584
193 Ga0207695_10017174 3300025913 Bacteria 8433
194 Ga0207695_10050948 3300025913 Unclassified 4351
195 Ga0207671_10151801 3300025914 Bacteria 1790
196 Ga0207693_10001304 3300025915 Bacteria 22111
197 Ga0207693_10011598 3300025915 Bacteria 7129
198 Ga0207693_10023960 3300025915 Bacteria 4846
199 Ga0207693_10049951 3300025915 Bacteria 3285
200 Ga0207693_10061370 3300025915 Bacteria 2944
201 Ga0207693_10105705 3300025915 Bacteria 2208
202 Ga0207693_10225400 3300025915 Bacteria 1472
203 Ga0207663_10030948 3300025916 Bacteria 3162
204 Ga0207663_10035012 3300025916 Bacteria 3009
205 Ga0207663_10090935 3300025916 Bacteria 2025
206 Ga0207660_10105651 3300025917 Bacteria 2110
207 Ga0207657_10010223 3300025919 Bacteria 9372
208 Ga0207657_10013595 3300025919 Bacteria 7983
209 Ga0207657_10014787 3300025919 Bacteria 7597
210 Ga0207652_10006600 3300025921 Bacteria 9352
211 Ga0207652_10186031 3300025921 Bacteria 1867
212 Ga0207652_10194959 3300025921 Unclassified 1822
213 Ga0207652_10217349 3300025921 Unclassified 1722
214 Ga0207646_10000165 3300025922 Bacteria 89540
215 Ga0207646_10002338 3300025922 Bacteria 22435
216 Ga0207646_10004039 3300025922 Bacteria 16211
217 Ga0207646_10006881 3300025922 Bacteria 11677
218 Ga0207646_10020572 3300025922 Bacteria 6113
219 Ga0207646_10032869 3300025922 Bacteria 4692
220 Ga0207646_10037021 3300025922 Bacteria 4401
221 Ga0207646_10048849 3300025922 Bacteria 3791
222 Ga0207646_10180261 3300025922 Bacteria 1908
223 Ga0207646_10200828 3300025922 Bacteria 1801
224 Ga0207700_10000620 3300025928 Bacteria 20724
225 Ga0207700_10002476 3300025928 Bacteria 10600
226 Ga0207700_10076855 3300025928 Bacteria 2592
227 Ga0207700_10107191 3300025928 Unclassified 2241
228 Ga0207700_10190801 3300025928 Bacteria 1722
229 Ga0207664_10096597 3300025929 Unclassified 2432
230 Ga0207690_10088199 3300025932 Bacteria 2185
231 Ga0207706_10002036 3300025933 Bacteria 19832
232 Ga0207665_10000318 3300025939 Bacteria 33337
233 Ga0207665_10000822 3300025939 Bacteria 21032
234 Ga0207665_10028925 3300025939 Bacteria 3664
235 Ga0207665_10031339 3300025939 Bacteria 3517
236 Ga0207665_10080211 3300025939 Unclassified 2244
237 Ga0207665_10089979 3300025939 Bacteria 2126
238 Ga0207711_10017410 3300025941 Bacteria 5971
239 Ga0207711_10054836 3300025941 Bacteria 3422
240 Ga0207661_10059593 3300025944 Bacteria 3077
241 Ga0207667_10010786 3300025949 Bacteria 10657
242 Ga0207667_10260083 3300025949 Unclassified 1775
243 Ga0207677_10112605 3300026023 Bacteria 2030
244 Ga0207702_10072185 3300026078 Bacteria 2974
245 Ga0207702_10283034 3300026078 Unclassified 1568
246 Ga0207702_10286764 3300026078 Bacteria 1558
247 Ga0207641_10111686 3300026088 Bacteria 2424
248 Ga0207648_10053416 3300026089 Bacteria 3532
249 Ga0209588_1000322 3300027671 Bacteria 12584
250 Ga0209588_1000612 3300027671 Bacteria 9032
251 Ga0209588_1022613 3300027671 Bacteria 1978
252 Ga0209588_1023914 3300027671 Bacteria 1928
253 Ga0265356_1000001 3300028017 Bacteria 47844
254 Ga0265357_1001670 3300028023 Bacteria 1680
255 Ga0265338_10033726 3300028800 Unclassified 4962
256 Ga0265762_1000015 3300030760 Bacteria 19541
257 Ga0265762_1000588 3300030760 Bacteria 6421
258 Ga0265762_1002811 3300030760 Bacteria 3113
259 Ga0265760_10004588 3300031090 Bacteria 3959
260 Ga0265760_10059530 3300031090 Bacteria 1159
261 Ga0265342_10025407 3300031712 Bacteria 3724
262 Ga0307416_100073199 3300032002 Bacteria 2856
263 Ga0373956_0053760 3300035119 Bacteria 1814
264 Ga0373931_0061479 3300035691 Bacteria 2025
265 Ga0373925_0369258 3300037068 Bacteria 1167
266 Ga0395898_0000092 3300037466 Bacteria 235647
267 Ga0436365_1002239 3300039437 Bacteria 6800
268 Ga0451577_0095901 3300042876 Unclassified 2648
269 Ga0453683_0005006 3300044673 Bacteria 9310
270 Ga0466961_0216542 3300044693 Bacteria 1181
271 Ga0466963_0062122 3300044694 Bacteria 2499
272 Ga0453684_0038597 3300044712 Bacteria 6524
273 Ga0453684_0048865 3300044712 Bacteria 5586
274 Ga0466971_0000024 3300044719 Bacteria 66749
275 Ga0466957_0041734 3300044842 Bacteria 2774
276 Ga0451576_0054883 3300045051 Bacteria 4170
277 Ga0466958_0223754 3300045836 Bacteria 1201
278 Ga0495603_0026294 3300046455 Bacteria 3517
279 Ga0495629_0030085 3300046459 Bacteria 3850
280 Ga0495580_0000401 3300046472 Bacteria 35524
281 Ga0495580_0015220 3300046472 Bacteria 5814
282 Ga0495580_0023830 3300046472 Bacteria 4489
283 Ga0495580_0083750 3300046472 Bacteria 2222
284 Ga0495582_0028651 3300046473 Bacteria 3056
285 Ga0495639_0013402 3300046475 Bacteria 3539
286 Ga0495662_0010813 3300046476 Bacteria 4464
287 Ga0495662_0030605 3300046476 Bacteria 2599
288 Ga0495664_0027716 3300046477 Bacteria 3304
289 Ga0495594_0009296 3300046499 Bacteria 5077
290 Ga0495618_0002463 3300046514 Bacteria 11877
291 Ga0495630_0048238 3300046517 Bacteria 3186
292 Ga0495666_0137656 3300046526 Bacteria 1139
293 Ga0495652_0060224 3300046529 Bacteria 3209
294 Ga0495640_0064376 3300046533 Bacteria 2479
295 Ga0495586_0002570 3300046535 Bacteria 9821
296 Ga0495645_0027340 3300046543 Bacteria 4144
297 Ga0495635_0155391 3300046663 Bacteria 1557
298 Ga0495635_0254486 3300046663 Bacteria 1183
299 Ga0495599_0071762 3300046678 Bacteria 2161
300 Ga0495647_0087371 3300046681 Bacteria 1273
301 Ga0495658_0008895 3300046683 Bacteria 4993
302 Ga0495613_0030633 3300046689 Bacteria 3996
303 Ga0495581_0015365 3300047315 Bacteria 4446
304 Ga0495674_0005300 3300047319 Bacteria 12367
305 Ga0495674_0015969 3300047319 Bacteria 7009
306 Ga0495674_0374541 3300047319 Bacteria 1153
307 Ga0495676_0032658 3300047321 Bacteria 4391
308 Ga0495675_0205683 3300047444 Bacteria 1197
309 Ga0496100_0052691 3300048903 Bacteria 2647
310 Ga0496101_0079941 3300048904 Bacteria 2414
311 Ga0496102_0007125 3300048905 Bacteria 9549
312 Ga0496102_0065522 3300048905 Bacteria 3330
313 Ga0496103_0009767 3300048906 Bacteria 5681
314 Ga0496104_0006191 3300048907 Bacteria 10508
315 Ga0496104_0013301 3300048907 Bacteria 7420
316 Ga0496106_0025924 3300048909 Unclassified 4361
317 Ga0496106_0026685 3300048909 Bacteria 4302
318 Ga0496108_0131320 3300048911 Bacteria 2153
319 Ga0496112_0018191 3300048915 Bacteria 6614
320 Ga0496112_0139579 3300048915 Bacteria 2393
321 Ga0496112_0367339 3300048915 Unclassified 1380
322 Ga0496112_0374021 3300048915 Unclassified 1366
323 Ga0496114_0066745 3300048917 Bacteria 3017
324 Ga0496114_0318907 3300048917 Bacteria 1373
325 Ga0496115_0008219 3300048918 Bacteria 7710
326 Ga0496115_0095494 3300048918 Bacteria 2433
327 Ga0496115_0147969 3300048918 Bacteria 1939
328 Ga0501033_0019873 3300049570 Bacteria 5076
329 Ga0501034_0046952 3300049571 Unclassified 4362
330 Ga0501046_0073895 3300049580 Bacteria 2645
331 Ga0501047_0052073 3300049581 Unclassified 3956
332 Ga0501035_0003973 3300049822 Bacteria 14094
333 Ga0501044_0031670 3300049823 Bacteria 5565
334 nmdc:mga0n895_1037_c1 3300050512 Bacteria 20212
335 nmdc:mga0n895_33778_c1 3300050512 Bacteria 4917
336 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
337 nmdc:mga0n895_74312_c1 3300050512 Bacteria 3376
338 nmdc:mga0rr50_192278_c1 3300050513 Bacteria 1673
339 nmdc:mga0rr50_421_c1 3300050513 Bacteria 22898
340 nmdc:mga08x19_1461_c1 3300050514 Bacteria 14622
341 nmdc:mga08x19_170055_c1 3300050514 Bacteria 1484
342 nmdc:mga0a205_151576_c1 3300050515 Bacteria 2218
343 nmdc:mga0a205_30978_c1 3300050515 Bacteria 5123
344 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
345 nmdc:mga0a205_46462_c1 3300050515 Bacteria 4187
346 nmdc:mga0a205_7555_c1 3300050515 Bacteria 9850
347 Ga0495619_0049662 3300053085 Bacteria 2767
348 Ga0587073_0030802 3300059492 Bacteria 1106
349 Ga0466962_0000031 3300061719 Bacteria 68489
350 Ga0070698_100191182
351 Ga0070683_100220082
352 Ga0070670_100270146
353 Ga0070682_100124806
354 Ga0068868_100123418
355 Ga0070660_100025009
356 Ga0070709_10009290
357 Ga0070709_10043845
358 Ga0070714_100049489
359 Ga0070714_100052942
360 Ga0070714_100090587
361 Ga0070713_100000574
362 Ga0070713_100001487
363 Ga0070713_100003566
364 Ga0070713_100041460
365 Ga0070713_100063918
366 Ga0070713_100164892
367 Ga0070713_100220306
368 Ga0070713_100301547
369 Ga0070710_10029361
370 Ga0070711_100124710
371 Ga0070708_100001273
372 Ga0070708_100002311
373 Ga0070708_100004717
374 Ga0070708_100011118
375 Ga0070708_100031297
376 Ga0070708_100125765
377 Ga0070662_100059482
378 Ga0070681_10032533
379 Ga0070681_10092550
380 Ga0070681_10198328
381 Ga0070685_10061769
382 Ga0070706_100001330
383 Ga0070706_100002168
384 Ga0070706_100003797
385 Ga0070706_100022374
386 Ga0070706_100047770
387 Ga0070706_100083279
388 Ga0070706_100155935
389 Ga0070707_100000674
390 Ga0070707_100002934
391 Ga0070707_100026821
392 Ga0070707_100066321
393 Ga0070707_100070217
394 Ga0070707_100191595
395 Ga0070707_100214490
396 Ga0070698_100000607
397 Ga0070698_100000725
398 Ga0070698_100001504
399 Ga0070698_100003545
400 Ga0070698_100039555
401 Ga0070698_100068972
402 Ga0070698_100222485
403 Ga0070699_100000343
404 Ga0070699_100009838
405 Ga0070699_100032473
406 Ga0070699_100046340
407 Ga0070699_100080307
408 Ga0070699_100131334
409 Ga0070699_100133484
410 Ga0070679_100016352
411 Ga0070679_100024494
412 Ga0070679_100260166
413 Ga0070679_100422976
414 Ga0070697_100000389
415 Ga0070697_100000487
416 Ga0070697_100003372
417 Ga0070697_100034864
418 Ga0070697_100076124
419 Ga0070697_100303415
420 Ga0068853_100125544
421 Ga0070686_100142853
422 Ga0070695_100001909
423 Ga0070695_100034778
424 Ga0070696_100002490
425 Ga0070696_100045223
426 Ga0070704_100011191
427 Ga0068855_100183905
428 Ga0070664_100552870
429 Ga0068859_100498114
430 Ga0068864_100170407
431 Ga0068858_100236513
432 Ga0068860_100154019
433 Ga0081540_1089337
434 Ga0070717_10000952
435 Ga0070717_10009674
436 Ga0070717_10015131
437 Ga0070717_10016703
438 Ga0070717_10037550
439 Ga0070717_10086156
440 Ga0070717_10242892
441 Ga0070717_10402446
442 Ga0070717_10411597
443 Ga0070717_10466969
444 Ga0070715_10009299
445 Ga0070716_100000187
446 Ga0070716_100001388
447 Ga0070716_100026561
448 Ga0070716_100045257
449 Ga0070716_100071023
450 Ga0070716_100079113
451 Ga0070716_100195779
452 Ga0070712_100000817
453 Ga0070712_100005391
454 Ga0070712_100026087
455 Ga0070712_100092389
456 Ga0070712_100132448
457 Ga0070712_100162049
458 Ga0070712_100320389
459 Ga0097621_100007133
460 Ga0097621_100127330
461 Ga0068871_100146012
462 Ga0068871_100178770
463 Ga0068871_100224019
464 Ga0075433_10165323
465 Ga0075434_100000041
466 Ga0075434_100002692
467 Ga0075434_100036180
468 Ga0075434_100094283
469 Ga0075436_100041862
470 Ga0075436_100052941
471 Ga0075436_100106761
472 Ga0097620_100498080
473 Ga0075435_100000105
474 Ga0075435_100062516
475 Ga0099794_10002232
476 Ga0099794_10033526
477 Ga0099794_10127503
478 Ga0105240_10086141
479 Ga0105240_10122174
480 Ga0105245_10187696
481 Ga0105247_10300943
482 Ga0114129_10053617
483 Ga0114129_10093292
484 Ga0105241_10001583
485 Ga0105241_10002219
486 Ga0105241_10014798
487 Ga0105241_10321045
488 Ga0105248_10358682
489 Ga0105238_10095154
490 Ga0105249_10520787
491 Ga0099796_10006530
492 Ga0105239_10744609
493 Ga0157373_10284635
494 Ga0157371_10082501
495 Ga0157369_10116921
496 Ga0157374_10004551
497 Ga0157374_10083191
498 Ga0157374_10526273
499 Ga0157378_10084749
500 Ga0163162_10005173
501 Ga0163162_10080855
502 Ga0163162_10320591
503 Ga0163162_10329825
504 Ga0157372_10014827
505 Ga0157372_10053326
506 Ga0157372_10124734
507 Ga0157372_10559099
508 Ga0163163_10156831
509 Ga0157379_10001688
510 Ga0157379_10088771
511 Ga0157376_10001479
512 Ga0157376_10019108
513 Ga0182006_1051070
514 Ga0224569_100194
515 Ga0224571_100523
516 Ga0224572_1000296
517 Ga0224572_1000629
518 Ga0224572_1008759
519 Ga0228598_1000055
520 Ga0228598_1001002
521 Ga0228598_1001224
522 Ga0207692_10009383
523 Ga0207692_10046896
524 Ga0207692_10065859
525 Ga0207685_10002418
526 Ga0207699_10060396
527 Ga0207699_10103960
528 Ga0207699_10162372
529 Ga0207684_10000081
530 Ga0207684_10002892
531 Ga0207684_10036795
532 Ga0207684_10038763
533 Ga0207684_10055744
534 Ga0207684_10105675
535 Ga0207684_10166306
536 Ga0207654_10009872
537 Ga0207654_10104753
538 Ga0207654_10197055
539 Ga0207707_10010569
540 Ga0207707_10199618
541 Ga0207707_10237883
542 Ga0207695_10017174
543 Ga0207695_10050948
544 Ga0207671_10151801
545 Ga0207693_10001304
546 Ga0207693_10011598
547 Ga0207693_10023960
548 Ga0207693_10049951
549 Ga0207693_10061370
550 Ga0207693_10105705
551 Ga0207693_10225400
552 Ga0207663_10030948
553 Ga0207663_10035012
554 Ga0207663_10090935
555 Ga0207660_10105651
556 Ga0207657_10010223
557 Ga0207657_10013595
558 Ga0207657_10014787
559 Ga0207652_10006600
560 Ga0207652_10186031
561 Ga0207652_10194959
562 Ga0207652_10217349
563 Ga0207646_10000165
564 Ga0207646_10002338
565 Ga0207646_10004039
566 Ga0207646_10006881
567 Ga0207646_10020572
568 Ga0207646_10032869
569 Ga0207646_10037021
570 Ga0207646_10048849
571 Ga0207646_10180261
572 Ga0207646_10200828
573 Ga0207700_10000620
574 Ga0207700_10002476
575 Ga0207700_10076855
576 Ga0207700_10107191
577 Ga0207700_10190801
578 Ga0207664_10096597
579 Ga0207690_10088199
580 Ga0207706_10002036
581 Ga0207665_10000318
582 Ga0207665_10000822
583 Ga0207665_10028925
584 Ga0207665_10031339
585 Ga0207665_10080211
586 Ga0207665_10089979
587 Ga0207711_10017410
588 Ga0207711_10054836
589 Ga0207661_10059593
590 Ga0207667_10010786
591 Ga0207667_10260083
592 Ga0207677_10112605
593 Ga0207702_10072185
594 Ga0207702_10283034
595 Ga0207702_10286764
596 Ga0207641_10111686
597 Ga0207648_10053416
598 Ga0209588_1000322
599 Ga0209588_1000612
600 Ga0209588_1022613
601 Ga0209588_1023914
602 Ga0265356_1000001
603 Ga0265357_1001670
604 Ga0265338_10033726
605 Ga0265762_1000015
606 Ga0265762_1000588
607 Ga0265762_1002811
608 Ga0265760_10004588
609 Ga0265760_10059530
610 Ga0265342_10025407
611 Ga0307416_100073199
612 Ga0373956_0053760
613 Ga0373931_0061479
614 Ga0373925_0369258
615 Ga0395898_0000092
616 Ga0436365_1002239
617 Ga0451577_0095901
618 Ga0453683_0005006
619 Ga0466961_0216542
620 Ga0466963_0062122
621 Ga0453684_0038597
622 Ga0453684_0048865
623 Ga0466971_0000024
624 Ga0466957_0041734
625 Ga0451576_0054883
626 Ga0466958_0223754
627 Ga0495603_0026294
628 Ga0495629_0030085
629 Ga0495580_0000401
630 Ga0495580_0015220
631 Ga0495580_0023830
632 Ga0495580_0083750
633 Ga0495582_0028651
634 Ga0495639_0013402
635 Ga0495662_0010813
636 Ga0495662_0030605
637 Ga0495664_0027716
638 Ga0495594_0009296
639 Ga0495618_0002463
640 Ga0495630_0048238
641 Ga0495666_0137656
642 Ga0495652_0060224
643 Ga0495640_0064376
644 Ga0495586_0002570
645 Ga0495645_0027340
646 Ga0495635_0155391
647 Ga0495635_0254486
648 Ga0495599_0071762
649 Ga0495647_0087371
650 Ga0495658_0008895
651 Ga0495613_0030633
652 Ga0495581_0015365
653 Ga0495674_0005300
654 Ga0495674_0015969
655 Ga0495674_0374541
656 Ga0495676_0032658
657 Ga0495675_0205683
658 Ga0496100_0052691
659 Ga0496101_0079941
660 Ga0496102_0007125
661 Ga0496102_0065522
662 Ga0496103_0009767
663 Ga0496104_0006191
664 Ga0496104_0013301
665 Ga0496106_0025924
666 Ga0496106_0026685
667 Ga0496108_0131320
668 Ga0496112_0018191
669 Ga0496112_0139579
670 Ga0496112_0367339
671 Ga0496112_0374021
672 Ga0496114_0066745
673 Ga0496114_0318907
674 Ga0496115_0008219
675 Ga0496115_0095494
676 Ga0496115_0147969
677 Ga0501033_0019873
678 Ga0501034_0046952
679 Ga0501046_0073895
680 Ga0501047_0052073
681 Ga0501035_0003973
682 Ga0501044_0031670
683 nmdc:mga0n895_1037_c1
684 nmdc:mga0n895_33778_c1
685 nmdc:mga0n895_47_c1
686 nmdc:mga0n895_74312_c1
687 nmdc:mga0rr50_192278_c1
688 nmdc:mga0rr50_421_c1
689 nmdc:mga08x19_1461_c1
690 nmdc:mga08x19_170055_c1
691 nmdc:mga0a205_151576_c1
692 nmdc:mga0a205_30978_c1
693 nmdc:mga0a205_378_c1
694 nmdc:mga0a205_46462_c1
695 nmdc:mga0a205_7555_c1
696 Ga0495619_0049662
697 Ga0587073_0030802
698 Ga0466962_0000031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

72

264

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exb-assembly2.cif.gz_F putative aldo-keto reductase from pseudomona aeruginosa 0.8667 41 291
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8636 41 291
4exb-assembly1.cif.gz_B putative aldo-keto reductase from pseudomona aeruginosa 0.8545 41 291
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8517 41 291
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8515 41 291
ID Description Score Start End Superfamily
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.903 39 147 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8544 41 120 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8527 41 147 3.20.20.100
af_Q2QQV2_1_312_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8468 41 312 3.20.20.100
4exaF00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8373 41 291 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3N5Z7V0-F1-model_v4 Aldo/keto reductase 0.9962 39 148
AF-A0A150R877-F1-model_v4 Aldo/keto reductase 0.9928 39 335
AF-A0A4P2R1Z1-F1-model_v4 Aldo/keto reductase 0.9923 39 335
AF-A0A2V9L913-F1-model_v4 Aldo/keto reductase 0.9919 39 336
AF-K2ASJ7-F1-model_v4 Oxidoreductase-related protein 0.9912 41 213

Map