F417824

General Info

Members Datasets Scaffolds Average Seq Length
349 219 698 130

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10812258|Ga0070685_108122581
Length 147
Sequence MRQTLSKRANCYKENGNDMKYILMMHVPGGPYQIWDWARQDFKAHIDFMQGLNKRLKAAGEFVSVEALTGPDQATAVRAGAHGEPITDGVFPEAKEFLAGYWIVEVETPERAYAIASEASAAPGPGGKPLNMTIEVRQVMSGPPPTE

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 2.29
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 11.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10812258 3300005466 Unclassified 690
2 Ga0065715_10118805 3300005293 Bacteria 2305
3 Ga0065715_10226015 3300005293 Bacteria 1252
4 Ga0070690_100670232 3300005330 Bacteria 794
5 Ga0070670_100213696 3300005331 Bacteria 1677
6 Ga0068869_100456046 3300005334 Unclassified 1060
7 Ga0068869_101676978 3300005334 Bacteria 567
8 Ga0070682_100031872 3300005337 Bacteria 3191
9 Ga0070660_101397577 3300005339 Bacteria 595
10 Ga0070689_100189514 3300005340 Bacteria 1674
11 Ga0070689_100299617 3300005340 Unclassified 1338
12 Ga0070668_100101142 3300005347 Bacteria 2284
13 Ga0070669_100023200 3300005353 Bacteria 4443
14 Ga0070675_100345273 3300005354 Bacteria 1319
15 Ga0070671_100141125 3300005355 Bacteria 2033
16 Ga0070671_100221128 3300005355 Bacteria 1606
17 Ga0070671_100305967 3300005355 Bacteria 1353
18 Ga0070671_100971889 3300005355 Unclassified 743
19 Ga0070674_100316044 3300005356 Bacteria 1250
20 Ga0070674_100704830 3300005356 Bacteria 863
21 Ga0070673_100003529 3300005364 Bacteria 9754
22 Ga0070673_100312622 3300005364 Bacteria 1386
23 Ga0070673_100341893 3300005364 Bacteria 1326
24 Ga0070688_100165974 3300005365 Bacteria 1520
25 Ga0070688_100373771 3300005365 Bacteria 1049
26 Ga0070667_100607910 3300005367 Bacteria 1008
27 Ga0070667_101210602 3300005367 Bacteria 707
28 Ga0070709_10073325 3300005434 Bacteria 2216
29 Ga0070709_11190975 3300005434 Unclassified 612
30 Ga0070709_11733528 3300005434 Bacteria 510
31 Ga0070714_100521973 3300005435 Bacteria 1134
32 Ga0070713_100149747 3300005436 Bacteria 2075
33 Ga0070710_10028592 3300005437 Bacteria 2983
34 Ga0070701_10297132 3300005438 Bacteria 991
35 Ga0070711_100110872 3300005439 Bacteria 2014
36 Ga0070711_101346424 3300005439 Bacteria 620
37 Ga0070700_101039497 3300005441 Bacteria 676
38 Ga0070708_100207325 3300005445 Unclassified 1836
39 Ga0070663_100846927 3300005455 Bacteria 787
40 Ga0070681_10432412 3300005458 Unclassified 1228
41 Ga0068867_100124447 3300005459 Bacteria 1996
42 Ga0068867_100259021 3300005459 Bacteria 1417
43 Ga0068867_100390279 3300005459 Unclassified 1171
44 Ga0070685_10445547 3300005466 Bacteria 906
45 Ga0070699_101632209 3300005518 Unclassified 591
46 Ga0070672_100333645 3300005543 Bacteria 1290
47 Ga0070672_100463234 3300005543 Bacteria 1093
48 Ga0070672_100902435 3300005543 Bacteria 781
49 Ga0070672_101030941 3300005543 Bacteria 730
50 Ga0070686_100120745 3300005544 Bacteria 1799
51 Ga0070686_100252431 3300005544 Bacteria 1289
52 Ga0070686_100420661 3300005544 Bacteria 1021
53 Ga0070695_100875452 3300005545 Bacteria 724
54 Ga0070665_100261416 3300005548 Bacteria 1732
55 Ga0070665_101268490 3300005548 Bacteria 747
56 Ga0070665_102339242 3300005548 Bacteria 537
57 Ga0070704_100521811 3300005549 Unclassified 1034
58 Ga0068857_100769129 3300005577 Bacteria 918
59 Ga0068859_100941013 3300005617 Bacteria 948
60 Ga0068859_101036105 3300005617 Bacteria 902
61 Ga0068864_100350366 3300005618 Bacteria 1393
62 Ga0068866_10045067 3300005718 Bacteria 2210
63 Ga0068866_10246114 3300005718 Bacteria 1091
64 Ga0068861_100025031 3300005719 Bacteria 4322
65 Ga0068870_10300802 3300005840 Bacteria 1013
66 Ga0068863_100127457 3300005841 Bacteria 2429
67 Ga0068863_100519822 3300005841 Bacteria 1173
68 Ga0068863_100991308 3300005841 Unclassified 843
69 Ga0068858_100309975 3300005842 Bacteria 1507
70 Ga0068858_100340148 3300005842 Bacteria 1436
71 Ga0068860_101029300 3300005843 Bacteria 842
72 Ga0068860_101767124 3300005843 Bacteria 640
73 Ga0068862_100024060 3300005844 Bacteria 5107
74 Ga0068862_100525583 3300005844 Bacteria 1126
75 Ga0070717_10700846 3300006028 Unclassified 920
76 Ga0070717_11851991 3300006028 Unclassified 545
77 Ga0075368_10028992 3300006042 Bacteria 2140
78 Ga0075363_100350143 3300006048 Bacteria 863
79 Ga0075364_10038933 3300006051 Bacteria 3081
80 Ga0075364_10173048 3300006051 Bacteria 1460
81 Ga0070715_10082655 3300006163 Bacteria 1461
82 Ga0070715_10191382 3300006163 Unclassified 1033
83 Ga0070716_100677536 3300006173 Unclassified 785
84 Ga0070712_100021202 3300006175 Bacteria 4263
85 Ga0070712_100534614 3300006175 Bacteria 986
86 Ga0075367_10891205 3300006178 Bacteria 567
87 Ga0097621_100995245 3300006237 Bacteria 784
88 Ga0075370_10043365 3300006353 Bacteria 2542
89 Ga0068871_100439192 3300006358 Unclassified 1168
90 Ga0068871_100937679 3300006358 Bacteria 804
91 Ga0075428_100176821 3300006844 Bacteria 2311
92 Ga0075430_100490703 3300006846 Bacteria 1013
93 Ga0075431_100006444 3300006847 Bacteria 11655
94 Ga0075433_10170629 3300006852 Bacteria 1936
95 Ga0075434_100928952 3300006871 Unclassified 885
96 Ga0075429_100057634 3300006880 Bacteria 3382
97 Ga0075429_100191344 3300006880 Bacteria 1793
98 Ga0075429_100528687 3300006880 Bacteria 1034
99 Ga0075429_101684730 3300006880 Bacteria 551
100 Ga0068865_100266756 3300006881 Bacteria 1358
101 Ga0068865_100283827 3300006881 Bacteria 1319
102 Ga0068865_100434717 3300006881 Unclassified 1082
103 Ga0075436_101465334 3300006914 Bacteria 518
104 Ga0097620_100941014 3300006931 Bacteria 948
105 Ga0097620_101036230 3300006931 Bacteria 902
106 Ga0075435_100186532 3300007076 Bacteria 1754
107 Ga0111539_10032938 3300009094 Bacteria 6292
108 Ga0111539_10152466 3300009094 Bacteria 2705
109 Ga0111539_10191273 3300009094 Bacteria 2388
110 Ga0111539_10489138 3300009094 Bacteria 1433
111 Ga0111539_10809359 3300009094 Bacteria 1090
112 Ga0111539_10917096 3300009094 Bacteria 1019
113 Ga0111539_11705978 3300009094 Bacteria 730
114 Ga0111539_13383523 3300009094 Bacteria 513
115 Ga0114129_10019384 3300009147 Bacteria 9687
116 Ga0114129_10331859 3300009147 Bacteria 2019
117 Ga0114129_10857684 3300009147 Bacteria 1154
118 Ga0105243_12752422 3300009148 Bacteria 532
119 Ga0105242_10157924 3300009176 Bacteria 1982
120 Ga0105242_11693738 3300009176 Bacteria 668
121 Ga0105248_10120538 3300009177 Bacteria 2959
122 Ga0105248_11078732 3300009177 Unclassified 907
123 Ga0105248_11440711 3300009177 Bacteria 779
124 Ga0105248_12493183 3300009177 Bacteria 589
125 Ga0105249_11910867 3300009553 Bacteria 666
126 Ga0105249_12162623 3300009553 Unclassified 629
127 Ga0157369_10158489 3300013105 Bacteria 2390
128 Ga0157378_10170317 3300013297 Bacteria 2042
129 Ga0157378_10286441 3300013297 Bacteria 1590
130 Ga0157378_10298844 3300013297 Bacteria 1557
131 Ga0157378_10837485 3300013297 Bacteria 947
132 Ga0157378_11959871 3300013297 Unclassified 635
133 Ga0163162_10446420 3300013306 Bacteria 1425
134 Ga0157375_10041097 3300013308 Bacteria 4463
135 Ga0157375_10101138 3300013308 Bacteria 2965
136 Ga0157375_12887950 3300013308 Bacteria 574
137 Ga0157375_13727262 3300013308 Bacteria 507
138 Ga0163163_10079871 3300014325 Bacteria 3270
139 Ga0163163_10690671 3300014325 Bacteria 1084
140 Ga0163163_12047499 3300014325 Bacteria 632
141 Ga0157380_10001299 3300014326 Bacteria 16242
142 Ga0157380_10008191 3300014326 Bacteria 7448
143 Ga0157380_10211139 3300014326 Bacteria 1730
144 Ga0157380_10236477 3300014326 Bacteria 1644
145 Ga0157380_10979536 3300014326 Bacteria 877
146 Ga0157380_11352548 3300014326 Bacteria 761
147 Ga0157379_10047907 3300014968 Bacteria 3814
148 Ga0157376_10089916 3300014969 Bacteria 2656
149 Ga0157376_10284089 3300014969 Unclassified 1560
150 Ga0157376_10877120 3300014969 Bacteria 914
151 Ga0163161_10355523 3300017792 Bacteria 1165
152 Ga0163161_10458155 3300017792 Bacteria 1032
153 Ga0163161_11160164 3300017792 Bacteria 666
154 Ga0213872_10006744 3300021361 Bacteria 5719
155 Ga0207653_10125185 3300025885 Bacteria 929
156 Ga0207682_10032730 3300025893 Bacteria 2090
157 Ga0207682_10046883 3300025893 Bacteria 1777
158 Ga0207692_10048884 3300025898 Bacteria 2132
159 Ga0207642_10026193 3300025899 Bacteria 2370
160 Ga0207642_10442565 3300025899 Bacteria 786
161 Ga0207642_11151517 3300025899 Bacteria 502
162 Ga0207688_10041202 3300025901 Bacteria 2568
163 Ga0207680_10102287 3300025903 Bacteria 1843
164 Ga0207680_10886274 3300025903 Bacteria 640
165 Ga0207685_10073778 3300025905 Bacteria 1391
166 Ga0207699_10101250 3300025906 Bacteria 1829
167 Ga0207645_10060945 3300025907 Bacteria 2410
168 Ga0207645_10461459 3300025907 Bacteria 858
169 Ga0207643_10025155 3300025908 Bacteria 3289
170 Ga0207684_10044710 3300025910 Bacteria 3756
171 Ga0207684_10435216 3300025910 Bacteria 1127
172 Ga0207693_10012308 3300025915 Bacteria 6915
173 Ga0207693_10744281 3300025915 Bacteria 757
174 Ga0207663_10021841 3300025916 Bacteria 3650
175 Ga0207681_10005801 3300025923 Bacteria 7576
176 Ga0207681_10230889 3300025923 Bacteria 1436
177 Ga0207650_10153446 3300025925 Bacteria 1819
178 Ga0207659_10057407 3300025926 Bacteria 2791
179 Ga0207659_10139052 3300025926 Bacteria 1883
180 Ga0207659_10278759 3300025926 Bacteria 1366
181 Ga0207700_10576732 3300025928 Bacteria 1000
182 Ga0207664_10910646 3300025929 Unclassified 789
183 Ga0207664_11665826 3300025929 Bacteria 560
184 Ga0207644_10067020 3300025931 Bacteria 2615
185 Ga0207644_10112967 3300025931 Bacteria 2057
186 Ga0207706_10297238 3300025933 Bacteria 1407
187 Ga0207706_10632467 3300025933 Bacteria 918
188 Ga0207706_10825428 3300025933 Bacteria 786
189 Ga0207686_10148450 3300025934 Bacteria 1629
190 Ga0207686_11543963 3300025934 Bacteria 548
191 Ga0207670_10113863 3300025936 Bacteria 1954
192 Ga0207669_10145884 3300025937 Bacteria 1650
193 Ga0207669_10205570 3300025937 Bacteria 1433
194 Ga0207669_10461349 3300025937 Bacteria 1009
195 Ga0207669_11224227 3300025937 Bacteria 636
196 Ga0207704_11052049 3300025938 Bacteria 690
197 Ga0207665_10418927 3300025939 Unclassified 1023
198 Ga0207691_10057551 3300025940 Bacteria 3537
199 Ga0207691_10096972 3300025940 Bacteria 2636
200 Ga0207691_10324538 3300025940 Bacteria 1319
201 Ga0207711_10058292 3300025941 Bacteria 3322
202 Ga0207711_10457880 3300025941 Bacteria 1188
203 Ga0207711_11437249 3300025941 Unclassified 632
204 Ga0207711_11694804 3300025941 Bacteria 575
205 Ga0207679_10219022 3300025945 Bacteria 1601
206 Ga0207651_10038357 3300025960 Bacteria 3148
207 Ga0207651_10069650 3300025960 Bacteria 2485
208 Ga0207651_10950161 3300025960 Bacteria 767
209 Ga0207712_11696137 3300025961 Bacteria 566
210 Ga0207668_10381576 3300025972 Bacteria 1186
211 Ga0207658_10626795 3300025986 Bacteria 968
212 Ga0207703_10841107 3300026035 Bacteria 877
213 Ga0207678_10632000 3300026067 Bacteria 940
214 Ga0207678_10979239 3300026067 Bacteria 748
215 Ga0207708_10742906 3300026075 Bacteria 842
216 Ga0207708_10934398 3300026075 Bacteria 752
217 Ga0207702_11249641 3300026078 Bacteria 737
218 Ga0207641_12427402 3300026088 Bacteria 523
219 Ga0207641_12434406 3300026088 Bacteria 522
220 Ga0207648_10066780 3300026089 Bacteria 3136
221 Ga0207648_10102154 3300026089 Bacteria 2513
222 Ga0207676_10142634 3300026095 Bacteria 2053
223 Ga0207674_10257488 3300026116 Bacteria 1692
224 Ga0207675_100030403 3300026118 Bacteria 5030
225 Ga0207675_101725536 3300026118 Bacteria 646
226 Ga0209813_10023286 3300027866 Bacteria 1760
227 Ga0207428_10237017 3300027907 Bacteria 1364
228 Ga0207428_11026066 3300027907 Bacteria 579
229 Ga0268266_10290435 3300028379 Bacteria 1523
230 Ga0268266_10620879 3300028379 Bacteria 1039
231 Ga0268265_10003920 3300028380 Bacteria 10483
232 Ga0268264_10853812 3300028381 Bacteria 912
233 Ga0268264_10915624 3300028381 Bacteria 881
234 Ga0265338_10019634 3300028800 Bacteria 7154
235 Ga0265760_10010754 3300031090 Bacteria 2614
236 Ga0265760_10023885 3300031090 Bacteria 1778
237 Ga0265332_10325155 3300031238 Unclassified 635
238 Ga0265340_10014869 3300031247 Bacteria 4052
239 Ga0265331_10220619 3300031250 Bacteria 852
240 Ga0265316_11043916 3300031344 Unclassified 568
241 Ga0307408_100073186 3300031548 Bacteria 2539
242 Ga0307408_100087491 3300031548 Bacteria 2344
243 Ga0265313_10061677 3300031595 Bacteria 1754
244 Ga0265314_10093895 3300031711 Bacteria 1946
245 Ga0265342_10270011 3300031712 Bacteria 903
246 Ga0307410_10170925 3300031852 Bacteria 1638
247 Ga0307406_10002570 3300031901 Bacteria 9886
248 Ga0307409_100304969 3300031995 Bacteria 1483
249 Ga0307416_100668725 3300032002 Bacteria 1125
250 Ga0307411_10358219 3300032005 Bacteria 1192
251 Ga0307411_10716943 3300032005 Unclassified 873
252 Ga0307415_101930168 3300032126 Bacteria 574
253 Ga0307507_10616731 3300033179 Bacteria 557
254 Ga0373958_0120912 3300034819 Bacteria 633
255 Ga0373934_0457297 3300035086 Bacteria 535
256 Ga0373923_0422411 3300035111 Bacteria 644
257 Ga0373936_0117305 3300035113 Unclassified 1134
258 Ga0373945_0054353 3300035116 Bacteria 1480
259 Ga0373957_0343117 3300035120 Bacteria 637
260 Ga0373943_0881644 3300035170 Bacteria 534
261 Ga0373955_0484656 3300035172 Unclassified 755
262 Ga0373955_0620402 3300035172 Bacteria 663
263 Ga0373924_0095612 3300035410 Bacteria 1274
264 Ga0373935_0033698 3300035692 Bacteria 3189
265 Ga0373947_0028247 3300035725 Bacteria 3287
266 Ga0373937_1174467 3300036401 Unclassified 716
267 Ga0373925_0148408 3300037068 Bacteria 1839
268 Ga0373925_1214859 3300037068 Bacteria 619
269 Ga0395900_0634040 3300037418 Bacteria 1007
270 Ga0395898_0853222 3300037466 Bacteria 850
271 Ga0395898_1414120 3300037466 Bacteria 623
272 Ga0395905_0951985 3300037471 Bacteria 762
273 Ga0395905_0980413 3300037471 Bacteria 748
274 Ga0436364_0207947 3300037853 Bacteria 1096
275 Ga0436361_0409631 3300039447 Bacteria 16895
276 Ga0466960_0160337 3300044901 Unclassified 1207
277 Ga0495617_111667 3300046452 Bacteria 884
278 Ga0495603_0324781 3300046455 Unclassified 883
279 Ga0495629_0141614 3300046459 Bacteria 1673
280 Ga0495639_0014429 3300046475 Bacteria 3421
281 Ga0495662_0406792 3300046476 Bacteria 668
282 Ga0495596_0369936 3300046500 Bacteria 558
283 Ga0495630_0038196 3300046517 Bacteria 3592
284 Ga0495630_0072720 3300046517 Bacteria 2588
285 Ga0495652_0579293 3300046529 Unclassified 768
286 Ga0495586_0321599 3300046535 Unclassified 887
287 Ga0495645_0187521 3300046543 Bacteria 1412
288 Ga0495622_0249060 3300046557 Unclassified 782
289 Ga0495659_0296727 3300046664 Unclassified 682
290 Ga0495613_0114696 3300046689 Bacteria 1939
291 Ga0495624_0287216 3300046690 Unclassified 993
292 Ga0495674_0045166 3300047319 Bacteria 3912
293 Ga0495676_0346111 3300047321 Unclassified 994
294 Ga0496100_0173976 3300048903 Bacteria 1553
295 Ga0496102_0306177 3300048905 Unclassified 1497
296 Ga0496102_0668475 3300048905 Bacteria 962
297 Ga0496106_0060396 3300048909 Bacteria 2874
298 Ga0496108_1486386 3300048911 Bacteria 564
299 Ga0496109_0317906 3300048912 Bacteria 1469
300 Ga0496110_0517768 3300048913 Bacteria 1085
301 Ga0496112_1026279 3300048915 Bacteria 744
302 Ga0501036_0215947 3300049572 Bacteria 1611
303 Ga0501037_0538525 3300049573 Bacteria 789
304 Ga0501038_0210397 3300049574 Bacteria 1556
305 Ga0501039_0219162 3300049575 Bacteria 1496
306 Ga0501041_0080130 3300049577 Bacteria 2010
307 Ga0501042_0027429 3300049578 Bacteria 4005
308 Ga0501047_0110627 3300049581 Bacteria 2630
309 Ga0501067_0163160 3300049583 Bacteria 1241
310 Ga0501068_0087829 3300049584 Bacteria 1915
311 Ga0501071_0648406 3300049587 Bacteria 812
312 Ga0501075_0042448 3300049591 Bacteria 3410
313 Ga0501076_0020224 3300049592 Bacteria 5094
314 Ga0501076_0025934 3300049592 Bacteria 4538
315 Ga0501081_0629326 3300049743 Bacteria 804
316 Ga0501081_1129379 3300049743 Bacteria 593
317 Ga0501083_0363747 3300049744 Bacteria 941
318 Ga0501263_055868 3300049760 Unclassified 609
319 Ga0501045_0416542 3300049824 Bacteria 999
320 nmdc:mga03n38_313027_c1 3300050490 Bacteria 846
321 nmdc:mga00v17_13588_c1 3300050491 Bacteria 4524
322 nmdc:mga0yw44_135241_c1 3300050492 Bacteria 1599
323 nmdc:mga06z11_82440_c1 3300050494 Bacteria 1729
324 nmdc:mga07m45_11579_c1 3300050496 Bacteria 4638
325 nmdc:mga05p37_112632_c1 3300050507 Bacteria 3346
326 nmdc:mga05p37_1391105_c1 3300050507 Bacteria 707
327 nmdc:mga05p37_27171_c1 3300050507 Bacteria 6966
328 nmdc:mga05p37_899387_c1 3300050507 Bacteria 955
329 nmdc:mga09592_194885_c1 3300050508 Bacteria 1754
330 nmdc:mga09592_277539_c1 3300050508 Bacteria 1453
331 nmdc:mga09592_817431_c1 3300050508 Bacteria 787
332 nmdc:mga09592_924649_c1 3300050508 Bacteria 732
333 nmdc:mga0qj67_1012066_c1 3300050509 Bacteria 652
334 nmdc:mga06r32_25516_c1 3300050510 Bacteria 5498
335 nmdc:mga06r32_548253_c1 3300050510 Bacteria 1130
336 nmdc:mga08y16_11523_c1 3300050511 Bacteria 2621
337 nmdc:mga08y16_34170_c1 3300050511 Bacteria 5341
338 nmdc:mga08y16_555133_c1 3300050511 Bacteria 1162
339 nmdc:mga08y16_569238_c1 3300050511 Bacteria 1145
340 nmdc:mga08y16_69609_c1 3300050511 Bacteria 3668
341 nmdc:mga0n895_149728_c1 3300050512 Bacteria 2363
342 nmdc:mga0rr50_94930_c1 3300050513 Bacteria 2330
343 nmdc:mga0a205_280688_c1 3300050515 Bacteria 1541
344 Ga0495601_0041966 3300053077 Bacteria 2869
345 Ga0500617_030733 3300053124 Bacteria 2400
346 Ga0500588_0007217 3300053146 Bacteria 2553
347 Ga0501084_0173757 3300054114 Bacteria 1818
348 Ga0501084_0210615 3300054114 Bacteria 1640
349 Ga0501082_0092317 3300060353 Bacteria 2615
350 Ga0070685_10812258
351 Ga0065715_10118805
352 Ga0065715_10226015
353 Ga0070690_100670232
354 Ga0070670_100213696
355 Ga0068869_100456046
356 Ga0068869_101676978
357 Ga0070682_100031872
358 Ga0070660_101397577
359 Ga0070689_100189514
360 Ga0070689_100299617
361 Ga0070668_100101142
362 Ga0070669_100023200
363 Ga0070675_100345273
364 Ga0070671_100141125
365 Ga0070671_100221128
366 Ga0070671_100305967
367 Ga0070671_100971889
368 Ga0070674_100316044
369 Ga0070674_100704830
370 Ga0070673_100003529
371 Ga0070673_100312622
372 Ga0070673_100341893
373 Ga0070688_100165974
374 Ga0070688_100373771
375 Ga0070667_100607910
376 Ga0070667_101210602
377 Ga0070709_10073325
378 Ga0070709_11190975
379 Ga0070709_11733528
380 Ga0070714_100521973
381 Ga0070713_100149747
382 Ga0070710_10028592
383 Ga0070701_10297132
384 Ga0070711_100110872
385 Ga0070711_101346424
386 Ga0070700_101039497
387 Ga0070708_100207325
388 Ga0070663_100846927
389 Ga0070681_10432412
390 Ga0068867_100124447
391 Ga0068867_100259021
392 Ga0068867_100390279
393 Ga0070685_10445547
394 Ga0070699_101632209
395 Ga0070672_100333645
396 Ga0070672_100463234
397 Ga0070672_100902435
398 Ga0070672_101030941
399 Ga0070686_100120745
400 Ga0070686_100252431
401 Ga0070686_100420661
402 Ga0070695_100875452
403 Ga0070665_100261416
404 Ga0070665_101268490
405 Ga0070665_102339242
406 Ga0070704_100521811
407 Ga0068857_100769129
408 Ga0068859_100941013
409 Ga0068859_101036105
410 Ga0068864_100350366
411 Ga0068866_10045067
412 Ga0068866_10246114
413 Ga0068861_100025031
414 Ga0068870_10300802
415 Ga0068863_100127457
416 Ga0068863_100519822
417 Ga0068863_100991308
418 Ga0068858_100309975
419 Ga0068858_100340148
420 Ga0068860_101029300
421 Ga0068860_101767124
422 Ga0068862_100024060
423 Ga0068862_100525583
424 Ga0070717_10700846
425 Ga0070717_11851991
426 Ga0075368_10028992
427 Ga0075363_100350143
428 Ga0075364_10038933
429 Ga0075364_10173048
430 Ga0070715_10082655
431 Ga0070715_10191382
432 Ga0070716_100677536
433 Ga0070712_100021202
434 Ga0070712_100534614
435 Ga0075367_10891205
436 Ga0097621_100995245
437 Ga0075370_10043365
438 Ga0068871_100439192
439 Ga0068871_100937679
440 Ga0075428_100176821
441 Ga0075430_100490703
442 Ga0075431_100006444
443 Ga0075433_10170629
444 Ga0075434_100928952
445 Ga0075429_100057634
446 Ga0075429_100191344
447 Ga0075429_100528687
448 Ga0075429_101684730
449 Ga0068865_100266756
450 Ga0068865_100283827
451 Ga0068865_100434717
452 Ga0075436_101465334
453 Ga0097620_100941014
454 Ga0097620_101036230
455 Ga0075435_100186532
456 Ga0111539_10032938
457 Ga0111539_10152466
458 Ga0111539_10191273
459 Ga0111539_10489138
460 Ga0111539_10809359
461 Ga0111539_10917096
462 Ga0111539_11705978
463 Ga0111539_13383523
464 Ga0114129_10019384
465 Ga0114129_10331859
466 Ga0114129_10857684
467 Ga0105243_12752422
468 Ga0105242_10157924
469 Ga0105242_11693738
470 Ga0105248_10120538
471 Ga0105248_11078732
472 Ga0105248_11440711
473 Ga0105248_12493183
474 Ga0105249_11910867
475 Ga0105249_12162623
476 Ga0157369_10158489
477 Ga0157378_10170317
478 Ga0157378_10286441
479 Ga0157378_10298844
480 Ga0157378_10837485
481 Ga0157378_11959871
482 Ga0163162_10446420
483 Ga0157375_10041097
484 Ga0157375_10101138
485 Ga0157375_12887950
486 Ga0157375_13727262
487 Ga0163163_10079871
488 Ga0163163_10690671
489 Ga0163163_12047499
490 Ga0157380_10001299
491 Ga0157380_10008191
492 Ga0157380_10211139
493 Ga0157380_10236477
494 Ga0157380_10979536
495 Ga0157380_11352548
496 Ga0157379_10047907
497 Ga0157376_10089916
498 Ga0157376_10284089
499 Ga0157376_10877120
500 Ga0163161_10355523
501 Ga0163161_10458155
502 Ga0163161_11160164
503 Ga0213872_10006744
504 Ga0207653_10125185
505 Ga0207682_10032730
506 Ga0207682_10046883
507 Ga0207692_10048884
508 Ga0207642_10026193
509 Ga0207642_10442565
510 Ga0207642_11151517
511 Ga0207688_10041202
512 Ga0207680_10102287
513 Ga0207680_10886274
514 Ga0207685_10073778
515 Ga0207699_10101250
516 Ga0207645_10060945
517 Ga0207645_10461459
518 Ga0207643_10025155
519 Ga0207684_10044710
520 Ga0207684_10435216
521 Ga0207693_10012308
522 Ga0207693_10744281
523 Ga0207663_10021841
524 Ga0207681_10005801
525 Ga0207681_10230889
526 Ga0207650_10153446
527 Ga0207659_10057407
528 Ga0207659_10139052
529 Ga0207659_10278759
530 Ga0207700_10576732
531 Ga0207664_10910646
532 Ga0207664_11665826
533 Ga0207644_10067020
534 Ga0207644_10112967
535 Ga0207706_10297238
536 Ga0207706_10632467
537 Ga0207706_10825428
538 Ga0207686_10148450
539 Ga0207686_11543963
540 Ga0207670_10113863
541 Ga0207669_10145884
542 Ga0207669_10205570
543 Ga0207669_10461349
544 Ga0207669_11224227
545 Ga0207704_11052049
546 Ga0207665_10418927
547 Ga0207691_10057551
548 Ga0207691_10096972
549 Ga0207691_10324538
550 Ga0207711_10058292
551 Ga0207711_10457880
552 Ga0207711_11437249
553 Ga0207711_11694804
554 Ga0207679_10219022
555 Ga0207651_10038357
556 Ga0207651_10069650
557 Ga0207651_10950161
558 Ga0207712_11696137
559 Ga0207668_10381576
560 Ga0207658_10626795
561 Ga0207703_10841107
562 Ga0207678_10632000
563 Ga0207678_10979239
564 Ga0207708_10742906
565 Ga0207708_10934398
566 Ga0207702_11249641
567 Ga0207641_12427402
568 Ga0207641_12434406
569 Ga0207648_10066780
570 Ga0207648_10102154
571 Ga0207676_10142634
572 Ga0207674_10257488
573 Ga0207675_100030403
574 Ga0207675_101725536
575 Ga0209813_10023286
576 Ga0207428_10237017
577 Ga0207428_11026066
578 Ga0268266_10290435
579 Ga0268266_10620879
580 Ga0268265_10003920
581 Ga0268264_10853812
582 Ga0268264_10915624
583 Ga0265338_10019634
584 Ga0265760_10010754
585 Ga0265760_10023885
586 Ga0265332_10325155
587 Ga0265340_10014869
588 Ga0265331_10220619
589 Ga0265316_11043916
590 Ga0307408_100073186
591 Ga0307408_100087491
592 Ga0265313_10061677
593 Ga0265314_10093895
594 Ga0265342_10270011
595 Ga0307410_10170925
596 Ga0307406_10002570
597 Ga0307409_100304969
598 Ga0307416_100668725
599 Ga0307411_10358219
600 Ga0307411_10716943
601 Ga0307415_101930168
602 Ga0307507_10616731
603 Ga0373958_0120912
604 Ga0373934_0457297
605 Ga0373923_0422411
606 Ga0373936_0117305
607 Ga0373945_0054353
608 Ga0373957_0343117
609 Ga0373943_0881644
610 Ga0373955_0484656
611 Ga0373955_0620402
612 Ga0373924_0095612
613 Ga0373935_0033698
614 Ga0373947_0028247
615 Ga0373937_1174467
616 Ga0373925_0148408
617 Ga0373925_1214859
618 Ga0395900_0634040
619 Ga0395898_0853222
620 Ga0395898_1414120
621 Ga0395905_0951985
622 Ga0395905_0980413
623 Ga0436364_0207947
624 Ga0436361_0409631
625 Ga0466960_0160337
626 Ga0495617_111667
627 Ga0495603_0324781
628 Ga0495629_0141614
629 Ga0495639_0014429
630 Ga0495662_0406792
631 Ga0495596_0369936
632 Ga0495630_0038196
633 Ga0495630_0072720
634 Ga0495652_0579293
635 Ga0495586_0321599
636 Ga0495645_0187521
637 Ga0495622_0249060
638 Ga0495659_0296727
639 Ga0495613_0114696
640 Ga0495624_0287216
641 Ga0495674_0045166
642 Ga0495676_0346111
643 Ga0496100_0173976
644 Ga0496102_0306177
645 Ga0496102_0668475
646 Ga0496106_0060396
647 Ga0496108_1486386
648 Ga0496109_0317906
649 Ga0496110_0517768
650 Ga0496112_1026279
651 Ga0501036_0215947
652 Ga0501037_0538525
653 Ga0501038_0210397
654 Ga0501039_0219162
655 Ga0501041_0080130
656 Ga0501042_0027429
657 Ga0501047_0110627
658 Ga0501067_0163160
659 Ga0501068_0087829
660 Ga0501071_0648406
661 Ga0501075_0042448
662 Ga0501076_0020224
663 Ga0501076_0025934
664 Ga0501081_0629326
665 Ga0501081_1129379
666 Ga0501083_0363747
667 Ga0501263_055868
668 Ga0501045_0416542
669 nmdc:mga03n38_313027_c1
670 nmdc:mga00v17_13588_c1
671 nmdc:mga0yw44_135241_c1
672 nmdc:mga06z11_82440_c1
673 nmdc:mga07m45_11579_c1
674 nmdc:mga05p37_112632_c1
675 nmdc:mga05p37_1391105_c1
676 nmdc:mga05p37_27171_c1
677 nmdc:mga05p37_899387_c1
678 nmdc:mga09592_194885_c1
679 nmdc:mga09592_277539_c1
680 nmdc:mga09592_817431_c1
681 nmdc:mga09592_924649_c1
682 nmdc:mga0qj67_1012066_c1
683 nmdc:mga06r32_25516_c1
684 nmdc:mga06r32_548253_c1
685 nmdc:mga08y16_11523_c1
686 nmdc:mga08y16_34170_c1
687 nmdc:mga08y16_555133_c1
688 nmdc:mga08y16_569238_c1
689 nmdc:mga08y16_69609_c1
690 nmdc:mga0n895_149728_c1
691 nmdc:mga0rr50_94930_c1
692 nmdc:mga0a205_280688_c1
693 Ga0495601_0041966
694 Ga0500617_030733
695 Ga0500588_0007217
696 Ga0501084_0173757
697 Ga0501084_0210615
698 Ga0501082_0092317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

19

124

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8489 1 124
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7799 1 124
6vsa-assembly1.cif.gz_V single particle reconstruction of hemq from geobacillus based on data acquired in the presence of substantial aberrations 0.6847 2 98
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.6086 1 125
6qta-assembly1.cif.gz_A crystal structure of rea1-midas/rsa4-ubl complex from chaetomium thermophilum 0.6009 53 70
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8489 1 124 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7799 1 124 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7285 1 126 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.689 1 126 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.652 2 126 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A2U3KA91-F1-model_v4 DGPF domain protein 0.9463 1 130
AF-A0A5N6A6R5-F1-model_v4 Uncharacterized protein 0.9403 5 127
AF-A0A562UYE9-F1-model_v4 YCII-related domain-containing protein 0.9371 5 127
AF-A0A7X0HA82-F1-model_v4 YCII-related domain-containing protein 0.937 1 126
AF-A0A150PCA2-F1-model_v4 YCII-related domain-containing protein 0.9326 1 108

Map