F417776

General Info

Members Datasets Scaffolds Average Seq Length
349 187 349 302

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10083607|Ga0065704_100836072
Length 354
Sequence MCIPASESGSPASPEVVRERQLFTRRASLAKSPEYTPEDTVVQQTDISHPTSNSMKYAMFSLGFDPAPRLGLLRGDLVLDLKTATARIWPDGPTTLLDLIQRGPDAWARMAEIGSEATSAHSHLAASVRWHAPIPRPTKNVFCLGLNYADHAKESAQARGREMKIPTVPVIFSKAPTTVSGPFDDVAVDRAATQQVDWEVELGVVIGKTGRNIAKADALNQVFGYTVINDLSARDLQQQHIQWFKGKSLDGFCPMGPVVVTADEFGDPQTKRVQLRVNGVTKQDGMTANMIFPVDVIIEWLSKGLTLEAGDIIATGTPEGVGMGRTPQEFLQNGDVVETEVEGIGVLRNRIVDL

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 1.15
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003549 3300003203 Bacteria 7311
2 JGI25406J46586_10007672 3300003203 Bacteria 4907
3 rootH1_10169857 3300003323 Unclassified 2028
4 Ga0065704_10083607 3300005289 Bacteria 3441
5 Ga0070676_10002320 3300005328 Bacteria 9733
6 Ga0070683_100014416 3300005329 Bacteria 6913
7 Ga0070670_100025631 3300005331 Bacteria 5072
8 Ga0070670_100040227 3300005331 Bacteria 4020
9 Ga0070670_100078673 3300005331 Bacteria 2833
10 Ga0068869_100000636 3300005334 Bacteria 19801
11 Ga0068869_100020498 3300005334 Bacteria 4533
12 Ga0068869_100339041 3300005334 Bacteria 1223
13 Ga0068868_100051330 3300005338 Bacteria 3243
14 Ga0068868_100143321 3300005338 Bacteria 1963
15 Ga0070689_100070852 3300005340 Bacteria 2723
16 Ga0070689_100071477 3300005340 Bacteria 2711
17 Ga0070689_100088296 3300005340 Bacteria 2440
18 Ga0070689_100133991 3300005340 Bacteria 1988
19 Ga0070661_100231192 3300005344 Unclassified 1421
20 Ga0070668_100054514 3300005347 Bacteria 3084
21 Ga0070669_100008659 3300005353 Bacteria 7259
22 Ga0070669_100130402 3300005353 Bacteria 1928
23 Ga0070669_100133099 3300005353 Bacteria 1910
24 Ga0070675_100002214 3300005354 Bacteria 14424
25 Ga0070675_100020327 3300005354 Bacteria 5298
26 Ga0070675_100021755 3300005354 Bacteria 5123
27 Ga0070675_100026240 3300005354 Bacteria 4675
28 Ga0070675_100072500 3300005354 Bacteria 2859
29 Ga0070675_100125327 3300005354 Bacteria 2185
30 Ga0070675_100319500 3300005354 Bacteria 1371
31 Ga0070675_100392757 3300005354 Bacteria 1236
32 Ga0070675_100453320 3300005354 Bacteria 1151
33 Ga0070671_100013815 3300005355 Bacteria 6515
34 Ga0070671_100026539 3300005355 Unclassified 4761
35 Ga0070671_100083879 3300005355 Bacteria 2665
36 Ga0070674_100002446 3300005356 Bacteria 10278
37 Ga0070674_100157542 3300005356 Bacteria 1720
38 Ga0070674_100189729 3300005356 Bacteria 1580
39 Ga0070673_100019791 3300005364 Bacteria 4841
40 Ga0070673_100071391 3300005364 Bacteria 2790
41 Ga0070673_100134668 3300005364 Bacteria 2078
42 Ga0070673_100246961 3300005364 Bacteria 1554
43 Ga0070673_100341200 3300005364 Bacteria 1327
44 Ga0070673_100421676 3300005364 Bacteria 1196
45 Ga0070688_100104600 3300005365 Unclassified 1872
46 Ga0070667_100066741 3300005367 Bacteria 3057
47 Ga0070667_100220960 3300005367 Bacteria 1686
48 Ga0070667_100239188 3300005367 Bacteria 1621
49 Ga0070701_10012555 3300005438 Bacteria 3825
50 Ga0070700_100009403 3300005441 Bacteria 5364
51 Ga0070700_100041415 3300005441 Bacteria 2823
52 Ga0070700_100320291 3300005441 Bacteria 1139
53 Ga0070708_100037017 3300005445 Bacteria 4255
54 Ga0070708_100236937 3300005445 Bacteria 1713
55 Ga0070663_100008047 3300005455 Bacteria 6465
56 Ga0070678_100131910 3300005456 Unclassified 1986
57 Ga0070678_100216127 3300005456 Bacteria 1591
58 Ga0070678_100396365 3300005456 Bacteria 1198
59 Ga0068867_100006351 3300005459 Bacteria 8356
60 Ga0068867_100027480 3300005459 Bacteria 4090
61 Ga0068867_100170123 3300005459 Bacteria 1725
62 Ga0068867_100402268 3300005459 Bacteria 1155
63 Ga0068867_100466811 3300005459 Bacteria 1079
64 Ga0068867_100537927 3300005459 Bacteria 1010
65 Ga0070685_10068257 3300005466 Bacteria 2100
66 Ga0070707_100372221 3300005468 Bacteria 1388
67 Ga0070698_100106609 3300005471 Bacteria 2770
68 Ga0070698_100563980 3300005471 Bacteria 1078
69 Ga0070699_100323230 3300005518 Bacteria 1387
70 Ga0070672_100011370 3300005543 Bacteria 6207
71 Ga0070672_100045604 3300005543 Bacteria 3392
72 Ga0070696_100306621 3300005546 Bacteria 1218
73 Ga0070664_100164700 3300005564 Bacteria 1964
74 Ga0068857_100102599 3300005577 Bacteria 2568
75 Ga0068856_100698203 3300005614 Bacteria 1035
76 Ga0070702_100032319 3300005615 Bacteria 2871
77 Ga0068859_100341705 3300005617 Bacteria 1591
78 Ga0068859_100602373 3300005617 Bacteria 1192
79 Ga0068859_100771334 3300005617 Unclassified 1050
80 Ga0068864_100034829 3300005618 Bacteria 4284
81 Ga0068864_100075557 3300005618 Bacteria 2942
82 Ga0068864_100087042 3300005618 Bacteria 2750
83 Ga0068866_10001987 3300005718 Bacteria 8525
84 Ga0068861_100306049 3300005719 Bacteria 1378
85 Ga0068863_100011364 3300005841 Bacteria 8621
86 Ga0068863_100091951 3300005841 Bacteria 2878
87 Ga0068858_100040023 3300005842 Bacteria 4346
88 Ga0068858_100094310 3300005842 Bacteria 2788
89 Ga0068858_100185840 3300005842 Bacteria 1963
90 Ga0068858_100194527 3300005842 Bacteria 1916
91 Ga0068858_100205536 3300005842 Bacteria 1863
92 Ga0068860_100144920 3300005843 Bacteria 2285
93 Ga0068860_100257331 3300005843 Bacteria 1701
94 Ga0068862_100053467 3300005844 Bacteria 3457
95 Ga0068862_100204461 3300005844 Bacteria 1782
96 Ga0068862_100210662 3300005844 Bacteria 1756
97 Ga0068862_100243833 3300005844 Bacteria 1635
98 Ga0068862_100548429 3300005844 Bacteria 1104
99 Ga0081539_10000133 3300005985 Bacteria 173855
100 Ga0081539_10073802 3300005985 Bacteria 1819
101 Ga0075432_10022239 3300006058 Bacteria 2168
102 Ga0097621_100044809 3300006237 Bacteria 3570
103 Ga0068871_100002433 3300006358 Bacteria 12726
104 Ga0068871_100023362 3300006358 Bacteria 4781
105 Ga0068871_100113200 3300006358 Bacteria 2285
106 Ga0068871_100177289 3300006358 Bacteria 1830
107 Ga0075428_100004294 3300006844 Bacteria 15696
108 Ga0075428_100206893 3300006844 Bacteria 2121
109 Ga0075430_100001888 3300006846 Bacteria 17166
110 Ga0075430_100070021 3300006846 Bacteria 2942
111 Ga0075431_100006116 3300006847 Bacteria 11940
112 Ga0075431_100009127 3300006847 Bacteria 9944
113 Ga0075434_100002267 3300006871 Bacteria 16831
114 Ga0075434_100013753 3300006871 Bacteria 7717
115 Ga0075434_100489902 3300006871 Bacteria 1250
116 Ga0075429_100398895 3300006880 Bacteria 1205
117 Ga0068865_100003497 3300006881 Bacteria 9418
118 Ga0068865_100157337 3300006881 Bacteria 1730
119 Ga0097620_100341711 3300006931 Bacteria 1591
120 Ga0097620_100602342 3300006931 Bacteria 1192
121 Ga0097620_100771235 3300006931 Unclassified 1050
122 Ga0075435_100022855 3300007076 Bacteria 4828
123 Ga0111539_10002454 3300009094 Bacteria 24635
124 Ga0111539_10119705 3300009094 Bacteria 3085
125 Ga0111539_10144534 3300009094 Bacteria 2784
126 Ga0105245_10231008 3300009098 Bacteria 1789
127 Ga0105245_10315595 3300009098 Unclassified 1538
128 Ga0105247_10034709 3300009101 Bacteria 3072
129 Ga0114129_10035772 3300009147 Bacteria 7014
130 Ga0114129_10064405 3300009147 Bacteria 5115
131 Ga0114129_10232499 3300009147 Bacteria 2482
132 Ga0105243_10013712 3300009148 Bacteria 6131
133 Ga0105242_10014788 3300009176 Bacteria 6043
134 Ga0105242_10390633 3300009176 Bacteria 1296
135 Ga0105248_10073859 3300009177 Bacteria 3833
136 Ga0105248_10089919 3300009177 Bacteria 3457
137 Ga0105248_10347682 3300009177 Unclassified 1669
138 Ga0105238_10018756 3300009551 Bacteria 7045
139 Ga0105249_10002175 3300009553 Bacteria 16984
140 Ga0105246_10061826 3300011119 Bacteria 2607
141 Ga0105246_10278394 3300011119 Bacteria 1341
142 Ga0105246_10427430 3300011119 Bacteria 1107
143 Ga0157374_10236760 3300013296 Bacteria 1794
144 Ga0157378_10005152 3300013297 Bacteria 11475
145 Ga0157375_10277646 3300013308 Bacteria 1838
146 Ga0157375_10294553 3300013308 Bacteria 1786
147 Ga0157375_10545738 3300013308 Bacteria 1321
148 Ga0163163_10010402 3300014325 Bacteria 8365
149 Ga0163163_10029715 3300014325 Bacteria 5260
150 Ga0163163_10200937 3300014325 Bacteria 2041
151 Ga0157380_10003751 3300014326 Bacteria 10451
152 Ga0157380_10003997 3300014326 Bacteria 10179
153 Ga0157380_10065936 3300014326 Bacteria 2912
154 Ga0157380_10083289 3300014326 Bacteria 2620
155 Ga0157380_10537801 3300014326 Bacteria 1143
156 Ga0157379_10011611 3300014968 Bacteria 7691
157 Ga0157379_10062893 3300014968 Bacteria 3319
158 Ga0157376_10038229 3300014969 Bacteria 3903
159 Ga0157376_10088031 3300014969 Bacteria 2681
160 Ga0163161_10229176 3300017792 Bacteria 1441
161 Ga0213873_10022417 3300021358 Bacteria 1495
162 Ga0213874_10006072 3300021377 Bacteria 2842
163 Ga0213874_10022262 3300021377 Bacteria 1756
164 Ga0213874_10034328 3300021377 Bacteria 1484
165 Ga0207697_10002977 3300025315 Bacteria 8550
166 Ga0207682_10004751 3300025893 Bacteria 5635
167 Ga0207682_10033736 3300025893 Bacteria 2061
168 Ga0207642_10015889 3300025899 Bacteria 2820
169 Ga0207688_10006362 3300025901 Bacteria 6431
170 Ga0207680_10065152 3300025903 Bacteria 2236
171 Ga0207680_10436238 3300025903 Bacteria 929
172 Ga0207699_10229548 3300025906 Bacteria 1271
173 Ga0207645_10002246 3300025907 Bacteria 15364
174 Ga0207645_10008417 3300025907 Bacteria 7196
175 Ga0207645_10143511 3300025907 Bacteria 1556
176 Ga0207643_10003472 3300025908 Bacteria 8482
177 Ga0207643_10018291 3300025908 Bacteria 3838
178 Ga0207643_10022591 3300025908 Bacteria 3464
179 Ga0207643_10060131 3300025908 Bacteria 2169
180 Ga0207681_10068393 3300025923 Bacteria 2467
181 Ga0207681_10138337 3300025923 Bacteria 1810
182 Ga0207650_10061870 3300025925 Bacteria 2795
183 Ga0207650_10233575 3300025925 Bacteria 1484
184 Ga0207659_10000116 3300025926 Bacteria 46654
185 Ga0207659_10004973 3300025926 Bacteria 8056
186 Ga0207659_10006385 3300025926 Bacteria 7220
187 Ga0207659_10013335 3300025926 Bacteria 5260
188 Ga0207659_10022847 3300025926 Bacteria 4169
189 Ga0207659_10111952 3300025926 Bacteria 2076
190 Ga0207706_10042151 3300025933 Bacteria 4045
191 Ga0207686_10020936 3300025934 Bacteria 3744
192 Ga0207709_10019504 3300025935 Bacteria 3815
193 Ga0207670_10011859 3300025936 Bacteria 5075
194 Ga0207670_10082135 3300025936 Bacteria 2258
195 Ga0207669_10001682 3300025937 Bacteria 9406
196 Ga0207669_10031054 3300025937 Bacteria 2979
197 Ga0207669_10142258 3300025937 Bacteria 1667
198 Ga0207704_10024999 3300025938 Bacteria 3252
199 Ga0207691_10028705 3300025940 Bacteria 5206
200 Ga0207691_10047283 3300025940 Bacteria 3948
201 Ga0207691_10123725 3300025940 Bacteria 2289
202 Ga0207711_10054660 3300025941 Bacteria 3427
203 Ga0207711_10109588 3300025941 Bacteria 2454
204 Ga0207711_10519712 3300025941 Bacteria 1110
205 Ga0207689_10008126 3300025942 Bacteria 9153
206 Ga0207689_10106166 3300025942 Bacteria 2307
207 Ga0207661_10052842 3300025944 Bacteria 3248
208 Ga0207661_10129092 3300025944 Bacteria 2163
209 Ga0207679_10045357 3300025945 Bacteria 3178
210 Ga0207651_10029303 3300025960 Bacteria 3486
211 Ga0207651_10109329 3300025960 Bacteria 2071
212 Ga0207651_10182465 3300025960 Bacteria 1666
213 Ga0207658_10249693 3300025986 Bacteria 1507
214 Ga0207658_10284670 3300025986 Bacteria 1418
215 Ga0207703_10039720 3300026035 Bacteria 3762
216 Ga0207703_10072553 3300026035 Bacteria 2846
217 Ga0207703_10094484 3300026035 Bacteria 2521
218 Ga0207703_10225506 3300026035 Bacteria 1677
219 Ga0207678_10015698 3300026067 Bacteria 6655
220 Ga0207678_10077130 3300026067 Bacteria 2854
221 Ga0207708_10026855 3300026075 Bacteria 4358
222 Ga0207708_10060464 3300026075 Bacteria 2892
223 Ga0207708_10382937 3300026075 Bacteria 1160
224 Ga0207708_10482945 3300026075 Bacteria 1036
225 Ga0207641_10042754 3300026088 Bacteria 3802
226 Ga0207648_10003093 3300026089 Bacteria 17578
227 Ga0207648_10165951 3300026089 Bacteria 1951
228 Ga0207648_10380701 3300026089 Bacteria 1276
229 Ga0207648_10396561 3300026089 Unclassified 1250
230 Ga0207676_10062478 3300026095 Bacteria 2954
231 Ga0207674_10126586 3300026116 Bacteria 2520
232 Ga0207674_10428609 3300026116 Bacteria 1278
233 Ga0207675_100017706 3300026118 Bacteria 6647
234 Ga0207675_100039464 3300026118 Bacteria 4406
235 Ga0207675_100047554 3300026118 Bacteria 4005
236 Ga0207675_100180177 3300026118 Bacteria 2023
237 Ga0207675_100224892 3300026118 Bacteria 1809
238 Ga0207683_10029975 3300026121 Bacteria 4713
239 Ga0207683_10046846 3300026121 Bacteria 3785
240 Ga0207683_10202299 3300026121 Bacteria 1806
241 Ga0207683_10300102 3300026121 Bacteria 1470
242 Ga0207428_10002055 3300027907 Bacteria 20307
243 Ga0207428_10010695 3300027907 Bacteria 8184
244 Ga0207428_10244767 3300027907 Bacteria 1339
245 Ga0268265_10010661 3300028380 Bacteria 6207
246 Ga0268265_10063693 3300028380 Bacteria 2838
247 Ga0268265_10191602 3300028380 Bacteria 1766
248 Ga0268264_10024489 3300028381 Bacteria 4928
249 Ga0268264_10351387 3300028381 Bacteria 1403
250 Ga0265338_10111587 3300028800 Unclassified 2201
251 Ga0307413_10154132 3300031824 Bacteria 1605
252 Ga0373943_0002797 3300035170 Bacteria 7930
253 Ga0373924_0022818 3300035410 Bacteria 2449
254 Ga0395899_0002889 3300037312 Bacteria 13801
255 Ga0395900_0006837 3300037418 Bacteria 11833
256 Ga0395898_0046637 3300037466 Bacteria 4256
257 Ga0395901_0041146 3300038443 Bacteria 4788
258 Ga0436365_1167770 3300039437 Bacteria 1311
259 Ga0436363_0212371 3300039450 Bacteria 14338
260 Ga0436363_1222094 3300039450 Bacteria 22720
261 Ga0436363_1317556 3300039450 Bacteria 42699
262 Ga0436362_1201411 3300039453 Bacteria 7103
263 Ga0439435_0013250 3300042436 Bacteria 2013
264 Ga0466969_0022057 3300044656 Bacteria 3290
265 Ga0466966_0032635 3300044684 Unclassified 3373
266 Ga0466963_0124146 3300044694 Unclassified 1779
267 Ga0466957_0338785 3300044842 Bacteria 1018
268 Ga0466959_0046947 3300045049 Bacteria 3177
269 Ga0466958_0009443 3300045836 Bacteria 5435
270 Ga0495592_0012737 3300046454 Bacteria 6393
271 Ga0495580_0017485 3300046472 Bacteria 5363
272 Ga0495580_0042000 3300046472 Bacteria 3259
273 Ga0495582_0072978 3300046473 Bacteria 1900
274 Ga0495639_0139627 3300046475 Bacteria 1164
275 Ga0495618_0155628 3300046514 Bacteria 1459
276 Ga0495630_0021105 3300046517 Bacteria 4808
277 Ga0495643_0000019 3300046522 Bacteria 303627
278 Ga0495652_0258272 3300046529 Bacteria 1287
279 Ga0495586_0107078 3300046535 Bacteria 1555
280 Ga0495587_0126812 3300046536 Bacteria 1460
281 Ga0495645_0003697 3300046543 Bacteria 10399
282 Ga0495633_0038425 3300046558 Bacteria 2286
283 Ga0495667_0005007 3300046559 Bacteria 8958
284 Ga0495634_0190368 3300046642 Bacteria 1280
285 Ga0495635_0225533 3300046663 Bacteria 1266
286 Ga0495659_0019102 3300046664 Bacteria 2291
287 Ga0495658_0151292 3300046683 Bacteria 1425
288 Ga0495669_0091424 3300046684 Bacteria 1405
289 Ga0495613_0002590 3300046689 Bacteria 13590
290 Ga0495613_0203808 3300046689 Bacteria 1394
291 Ga0495581_0116164 3300047315 Bacteria 1556
292 Ga0495581_0261955 3300047315 Bacteria 1011
293 Ga0495604_0042629 3300047317 Bacteria 3556
294 Ga0495674_0127732 3300047319 Bacteria 2143
295 Ga0495684_0000446 3300047471 Bacteria 33794
296 Ga0495684_0107046 3300047471 Bacteria 2112
297 Ga0496108_0193806 3300048911 Bacteria 1762
298 Ga0496109_0058727 3300048912 Bacteria 3514
299 Ga0496110_0341822 3300048913 Eukaryota 1363
300 Ga0496114_0259749 3300048917 Bacteria 1529
301 Ga0501033_0240946 3300049570 Bacteria 1283
302 Ga0501034_0224245 3300049571 Bacteria 1831
303 Ga0501037_0051185 3300049573 Bacteria 3021
304 Ga0501038_0102691 3300049574 Bacteria 2379
305 Ga0501039_0438051 3300049575 Bacteria 1026
306 Ga0501040_0141613 3300049576 Bacteria 1694
307 Ga0501042_0022884 3300049578 Bacteria 4366
308 Ga0501046_0061065 3300049580 Bacteria 2949
309 Ga0501048_0135235 3300049582 Bacteria 1742
310 Ga0501048_0151004 3300049582 Bacteria 1643
311 Ga0501067_0101120 3300049583 Bacteria 1602
312 Ga0501070_0058543 3300049586 Bacteria 3194
313 Ga0501070_0105533 3300049586 Bacteria 2329
314 Ga0501071_0232207 3300049587 Bacteria 1390
315 Ga0501074_0147024 3300049590 Bacteria 1685
316 Ga0501075_0044302 3300049591 Bacteria 3338
317 Ga0501077_0110477 3300049593 Bacteria 1742
318 Ga0501079_0110863 3300049741 Bacteria 2132
319 Ga0501080_0237846 3300049742 Bacteria 1663
320 Ga0501081_0234151 3300049743 Bacteria 1338
321 Ga0501083_0074258 3300049744 Bacteria 2259
322 Ga0501044_0007485 3300049823 Bacteria 12008
323 Ga0501045_0170194 3300049824 Bacteria 1623
324 nmdc:mga05p37_19865_c1 3300050507 Bacteria 8128
325 nmdc:mga05p37_31350_c1 3300050507 Bacteria 6493
326 nmdc:mga05p37_344475_c1 3300050507 Bacteria 1756
327 nmdc:mga05p37_384222_c1 3300050507 Bacteria 1644
328 nmdc:mga09592_15462_c1 3300050508 Bacteria 6236
329 nmdc:mga0qj67_36095_c1 3300050509 Bacteria 3866
330 nmdc:mga0qj67_73299_c1 3300050509 Bacteria 2735
331 nmdc:mga06r32_11689_c1 3300050510 Bacteria 7902
332 nmdc:mga06r32_3055_c1 3300050510 Bacteria 14984
333 nmdc:mga06r32_330052_c1 3300050510 Bacteria 1510
334 nmdc:mga06r32_48368_c1 3300050510 Bacteria 4064
335 nmdc:mga06r32_7651_c1 3300050510 Bacteria 9715
336 nmdc:mga08y16_1998_c1 3300050511 Bacteria 20844
337 nmdc:mga08y16_28383_c1 3300050511 Bacteria 5899
338 nmdc:mga08y16_506456_c1 3300050511 Bacteria 1226
339 nmdc:mga0n895_279829_c1 3300050512 Unclassified 1692
340 nmdc:mga0n895_38591_c1 3300050512 Bacteria 4629
341 nmdc:mga0n895_6070_c1 3300050512 Bacteria 10189
342 nmdc:mga0a205_1255_c1 3300050515 Bacteria 21291
343 nmdc:mga0a205_16169_c1 3300050515 Bacteria 6987
344 nmdc:mga0a205_172419_c1 3300050515 Bacteria 2059
345 nmdc:mga0a205_63306_c1 3300050515 Bacteria 3574
346 Ga0495619_0007882 3300053085 Bacteria 6739
347 Ga0500637_0199245 3300053178 Unclassified 1141
348 Ga0501084_0051953 3300054114 Bacteria 3430
349 Ga0530510_0179817 3300061734 Bacteria 1568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0000019 Ga0495643_0000019_227695_228591 284
2 3300046558 Ga0495633_0038425 Ga0495633_0038425_1379_2275 284
3 3300049575 Ga0501039_0438051 Ga0501039_0438051_32_919 284
4 3300053178 Ga0500637_0199245 Ga0500637_0199245_25_939 287
5 3300044656 Ga0466969_0022057 Ga0466969_0022057_1648_2547 288
6 3300044684 Ga0466966_0032635 Ga0466966_0032635_211_1110 288
7 3300044694 Ga0466963_0124146 Ga0466963_0124146_539_1438 288
8 3300044842 Ga0466957_0338785 Ga0466957_0338785_95_994 288
9 3300045049 Ga0466959_0046947 Ga0466959_0046947_1705_2604 288
10 3300045836 Ga0466958_0009443 Ga0466958_0009443_989_1888 288
11 3300049570 Ga0501033_0240946 Ga0501033_0240946_288_1163 288
12 3300049583 Ga0501067_0101120 Ga0501067_0101120_645_1511 288
13 3300049586 Ga0501070_0058543 Ga0501070_0058543_1385_2251 288
14 3300049586 Ga0501070_0105533 Ga0501070_0105533_405_1280 288
15 3300049744 Ga0501083_0074258 Ga0501083_0074258_1071_1937 288
16 3300005329 Ga0070683_100014416 Ga0070683_1000144163 291
17 3300005614 Ga0068856_100698203 Ga0068856_1006982031 291
18 3300025941 Ga0207711_10519712 Ga0207711_105197121 291
19 3300025944 Ga0207661_10052842 Ga0207661_100528422 291
20 3300037312 Ga0395899_0002889 Ga0395899_0002889_6008_6976 291
21 3300037418 Ga0395900_0006837 Ga0395900_0006837_7989_8957 291
22 3300037466 Ga0395898_0046637 Ga0395898_0046637_2595_3563 291
23 3300038443 Ga0395901_0041146 Ga0395901_0041146_1921_2889 291
24 3300005328 Ga0070676_10002320 Ga0070676_100023206 292
25 3300005331 Ga0070670_100040227 Ga0070670_1000402272 292
26 3300005334 Ga0068869_100000636 Ga0068869_1000006363 292
27 3300005340 Ga0070689_100071477 Ga0070689_1000714773 292
28 3300005340 Ga0070689_100088296 Ga0070689_1000882962 292
29 3300005353 Ga0070669_100008659 Ga0070669_1000086592 292
30 3300005353 Ga0070669_100130402 Ga0070669_1001304022 292
31 3300005354 Ga0070675_100002214 Ga0070675_1000022148 292
32 3300005354 Ga0070675_100020327 Ga0070675_1000203273 292
33 3300005354 Ga0070675_100026240 Ga0070675_1000262404 292
34 3300005354 Ga0070675_100453320 Ga0070675_1004533201 292
35 3300005355 Ga0070671_100013815 Ga0070671_1000138154 292
36 3300005364 Ga0070673_100134668 Ga0070673_1001346681 292
37 3300005364 Ga0070673_100246961 Ga0070673_1002469612 292
38 3300005364 Ga0070673_100341200 Ga0070673_1003412001 292
39 3300005367 Ga0070667_100220960 Ga0070667_1002209602 292
40 3300005367 Ga0070667_100239188 Ga0070667_1002391882 292
41 3300005441 Ga0070700_100009403 Ga0070700_1000094033 292
42 3300005441 Ga0070700_100320291 Ga0070700_1003202912 292
43 3300005455 Ga0070663_100008047 Ga0070663_1000080472 292
44 3300005456 Ga0070678_100216127 Ga0070678_1002161272 292
45 3300005459 Ga0068867_100006351 Ga0068867_1000063513 292
46 3300005459 Ga0068867_100466811 Ga0068867_1004668111 292
47 3300005459 Ga0068867_100537927 Ga0068867_1005379271 292
48 3300005543 Ga0070672_100011370 Ga0070672_1000113703 292
49 3300005543 Ga0070672_100045604 Ga0070672_1000456042 292
50 3300005615 Ga0070702_100032319 Ga0070702_1000323193 292
51 3300005618 Ga0068864_100034829 Ga0068864_1000348293 292
52 3300005618 Ga0068864_100075557 Ga0068864_1000755572 292
53 3300005718 Ga0068866_10001987 Ga0068866_100019874 292
54 3300005841 Ga0068863_100091951 Ga0068863_1000919512 292
55 3300005842 Ga0068858_100094310 Ga0068858_1000943102 292
56 3300005842 Ga0068858_100194527 Ga0068858_1001945273 292
57 3300005843 Ga0068860_100144920 Ga0068860_1001449202 292
58 3300005844 Ga0068862_100204461 Ga0068862_1002044612 292
59 3300005844 Ga0068862_100210662 Ga0068862_1002106621 292
60 3300006881 Ga0068865_100003497 Ga0068865_1000034977 292
61 3300009148 Ga0105243_10013712 Ga0105243_100137123 292
62 3300009176 Ga0105242_10014788 Ga0105242_100147886 292
63 3300009177 Ga0105248_10073859 Ga0105248_100738592 292
64 3300009551 Ga0105238_10018756 Ga0105238_100187563 292
65 3300011119 Ga0105246_10061826 Ga0105246_100618262 292
66 3300011119 Ga0105246_10427430 Ga0105246_104274301 292
67 3300013308 Ga0157375_10545738 Ga0157375_105457382 292
68 3300014325 Ga0163163_10010402 Ga0163163_100104025 292
69 3300014325 Ga0163163_10029715 Ga0163163_100297152 292
70 3300014326 Ga0157380_10003751 Ga0157380_100037515 292
71 3300014326 Ga0157380_10003997 Ga0157380_100039979 292
72 3300025893 Ga0207682_10033736 Ga0207682_100337363 292
73 3300025899 Ga0207642_10015889 Ga0207642_100158893 292
74 3300025903 Ga0207680_10436238 Ga0207680_104362381 292
75 3300025907 Ga0207645_10002246 Ga0207645_100022466 292
76 3300025908 Ga0207643_10022591 Ga0207643_100225913 292
77 3300025923 Ga0207681_10138337 Ga0207681_101383373 292
78 3300025925 Ga0207650_10061870 Ga0207650_100618703 292
79 3300025926 Ga0207659_10000116 Ga0207659_1000011633 292
80 3300025926 Ga0207659_10004973 Ga0207659_100049735 292
81 3300025926 Ga0207659_10006385 Ga0207659_100063856 292
82 3300025934 Ga0207686_10020936 Ga0207686_100209363 292
83 3300025935 Ga0207709_10019504 Ga0207709_100195042 292
84 3300025936 Ga0207670_10011859 Ga0207670_100118592 292
85 3300025936 Ga0207670_10082135 Ga0207670_100821353 292
86 3300025937 Ga0207669_10031054 Ga0207669_100310542 292
87 3300025940 Ga0207691_10028705 Ga0207691_100287053 292
88 3300025940 Ga0207691_10047283 Ga0207691_100472833 292
89 3300025941 Ga0207711_10109588 Ga0207711_101095883 292
90 3300025942 Ga0207689_10008126 Ga0207689_100081264 292
91 3300025960 Ga0207651_10029303 Ga0207651_100293033 292
92 3300025960 Ga0207651_10109329 Ga0207651_101093293 292
93 3300025960 Ga0207651_10182465 Ga0207651_101824652 292
94 3300025986 Ga0207658_10249693 Ga0207658_102496931 292
95 3300025986 Ga0207658_10284670 Ga0207658_102846702 292
96 3300026035 Ga0207703_10039720 Ga0207703_100397203 292
97 3300026035 Ga0207703_10072553 Ga0207703_100725532 292
98 3300026067 Ga0207678_10015698 Ga0207678_100156982 292
99 3300026075 Ga0207708_10026855 Ga0207708_100268553 292
100 3300026075 Ga0207708_10382937 Ga0207708_103829371 292
101 3300026089 Ga0207648_10003093 Ga0207648_100030937 292
102 3300026095 Ga0207676_10062478 Ga0207676_100624782 292
103 3300026118 Ga0207675_100017706 Ga0207675_1000177064 292
104 3300026118 Ga0207675_100180177 Ga0207675_1001801772 292
105 3300028380 Ga0268265_10191602 Ga0268265_101916021 292
106 3300049743 Ga0501081_0234151 Ga0501081_0234151_261_1163 292
107 3300050511 nmdc:mga08y16_506456_c1 nmdc:mga08y16_506456_c1_90_971 292
108 3300005518 Ga0070699_100323230 Ga0070699_1003232302 293
109 3300025907 Ga0207645_10143511 Ga0207645_101435112 294
110 3300048913 Ga0496110_0341822 Ga0496110_0341822_160_1056 295
111 3300005445 Ga0070708_100236937 Ga0070708_1002369373 296
112 3300005546 Ga0070696_100306621 Ga0070696_1003066211 296
113 3300013308 Ga0157375_10294553 Ga0157375_102945531 296
114 3300031824 Ga0307413_10154132 Ga0307413_101541322 296
115 3300048911 Ga0496108_0193806 Ga0496108_0193806_15_905 296
116 3300050507 nmdc:mga05p37_344475_c1 nmdc:mga05p37_344475_c1_708_1598 296
117 3300005356 Ga0070674_100157542 Ga0070674_1001575422 298
118 3300005617 Ga0068859_100771334 Ga0068859_1007713341 298
119 3300006931 Ga0097620_100771235 Ga0097620_1007712351 298
120 3300025937 Ga0207669_10142258 Ga0207669_101422583 298
121 3300005338 Ga0068868_100143321 Ga0068868_1001433212 299
122 3300006844 Ga0075428_100004294 Ga0075428_1000042949 299
123 3300009098 Ga0105245_10315595 Ga0105245_103155952 299
124 3300009177 Ga0105248_10089919 Ga0105248_100899193 299
125 3300025941 Ga0207711_10054660 Ga0207711_100546603 299
126 3300005289 Ga0065704_10083607 Ga0065704_100836072 300
127 3300005331 Ga0070670_100025631 Ga0070670_1000256313 300
128 3300005334 Ga0068869_100020498 Ga0068869_1000204982 300
129 3300005334 Ga0068869_100339041 Ga0068869_1003390412 300
130 3300005338 Ga0068868_100051330 Ga0068868_1000513302 300
131 3300005340 Ga0070689_100070852 Ga0070689_1000708523 300
132 3300005344 Ga0070661_100231192 Ga0070661_1002311922 300
133 3300005354 Ga0070675_100021755 Ga0070675_1000217552 300
134 3300005354 Ga0070675_100072500 Ga0070675_1000725002 300
135 3300005354 Ga0070675_100125327 Ga0070675_1001253272 300
136 3300005354 Ga0070675_100319500 Ga0070675_1003195002 300
137 3300005355 Ga0070671_100026539 Ga0070671_1000265392 300
138 3300005356 Ga0070674_100002446 Ga0070674_1000024465 300
139 3300005356 Ga0070674_100189729 Ga0070674_1001897292 300
140 3300005364 Ga0070673_100071391 Ga0070673_1000713912 300
141 3300005364 Ga0070673_100421676 Ga0070673_1004216761 300
142 3300005365 Ga0070688_100104600 Ga0070688_1001046001 300
143 3300005367 Ga0070667_100066741 Ga0070667_1000667412 300
144 3300005438 Ga0070701_10012555 Ga0070701_100125553 300
145 3300005456 Ga0070678_100131910 Ga0070678_1001319101 300
146 3300005459 Ga0068867_100027480 Ga0068867_1000274804 300
147 3300005577 Ga0068857_100102599 Ga0068857_1001025992 300
148 3300005617 Ga0068859_100341705 Ga0068859_1003417052 300
149 3300005617 Ga0068859_100602373 Ga0068859_1006023731 300
150 3300005618 Ga0068864_100087042 Ga0068864_1000870422 300
151 3300005719 Ga0068861_100306049 Ga0068861_1003060492 300
152 3300005841 Ga0068863_100011364 Ga0068863_1000113649 300
153 3300005844 Ga0068862_100548429 Ga0068862_1005484291 300
154 3300006058 Ga0075432_10022239 Ga0075432_100222392 300
155 3300006844 Ga0075428_100206893 Ga0075428_1002068932 300
156 3300006846 Ga0075430_100001888 Ga0075430_1000018886 300
157 3300006846 Ga0075430_100070021 Ga0075430_1000700212 300
158 3300006847 Ga0075431_100006116 Ga0075431_1000061169 300
159 3300006847 Ga0075431_100009127 Ga0075431_1000091278 300
160 3300006880 Ga0075429_100398895 Ga0075429_1003988951 300
161 3300006931 Ga0097620_100341711 Ga0097620_1003417112 300
162 3300006931 Ga0097620_100602342 Ga0097620_1006023421 300
163 3300009094 Ga0111539_10002454 Ga0111539_1000245414 300
164 3300009094 Ga0111539_10119705 Ga0111539_101197052 300
165 3300009094 Ga0111539_10144534 Ga0111539_101445343 300
166 3300009147 Ga0114129_10035772 Ga0114129_100357723 300
167 3300009147 Ga0114129_10064405 Ga0114129_100644052 300
168 3300009147 Ga0114129_10232499 Ga0114129_102324992 300
169 3300009176 Ga0105242_10390633 Ga0105242_103906332 300
170 3300011119 Ga0105246_10278394 Ga0105246_102783942 300
171 3300013296 Ga0157374_10236760 Ga0157374_102367602 300
172 3300013308 Ga0157375_10277646 Ga0157375_102776462 300
173 3300014325 Ga0163163_10200937 Ga0163163_102009372 300
174 3300014326 Ga0157380_10065936 Ga0157380_100659362 300
175 3300014326 Ga0157380_10083289 Ga0157380_100832893 300
176 3300014326 Ga0157380_10537801 Ga0157380_105378011 300
177 3300014968 Ga0157379_10062893 Ga0157379_100628932 300
178 3300017792 Ga0163161_10229176 Ga0163161_102291762 300
179 3300021377 Ga0213874_10034328 Ga0213874_100343282 300
180 3300025901 Ga0207688_10006362 Ga0207688_100063622 300
181 3300025903 Ga0207680_10065152 Ga0207680_100651521 300
182 3300025907 Ga0207645_10008417 Ga0207645_100084176 300
183 3300025908 Ga0207643_10018291 Ga0207643_100182913 300
184 3300025908 Ga0207643_10060131 Ga0207643_100601312 300
185 3300025923 Ga0207681_10068393 Ga0207681_100683932 300
186 3300025925 Ga0207650_10233575 Ga0207650_102335752 300
187 3300025926 Ga0207659_10013335 Ga0207659_100133353 300
188 3300025926 Ga0207659_10111952 Ga0207659_101119523 300
189 3300025933 Ga0207706_10042151 Ga0207706_100421512 300
190 3300025937 Ga0207669_10001682 Ga0207669_100016822 300
191 3300025940 Ga0207691_10123725 Ga0207691_101237252 300
192 3300025942 Ga0207689_10106166 Ga0207689_101061662 300
193 3300025945 Ga0207679_10045357 Ga0207679_100453573 300
194 3300026075 Ga0207708_10482945 Ga0207708_104829452 300
195 3300026088 Ga0207641_10042754 Ga0207641_100427542 300
196 3300026089 Ga0207648_10165951 Ga0207648_101659512 300
197 3300026089 Ga0207648_10380701 Ga0207648_103807012 300
198 3300026116 Ga0207674_10126586 Ga0207674_101265862 300
199 3300026116 Ga0207674_10428609 Ga0207674_104286092 300
200 3300026118 Ga0207675_100047554 Ga0207675_1000475542 300
201 3300026118 Ga0207675_100224892 Ga0207675_1002248922 300
202 3300026121 Ga0207683_10029975 Ga0207683_100299755 300
203 3300026121 Ga0207683_10202299 Ga0207683_102022992 300
204 3300026121 Ga0207683_10300102 Ga0207683_103001021 300
205 3300027907 Ga0207428_10002055 Ga0207428_100020556 300
206 3300027907 Ga0207428_10010695 Ga0207428_100106958 300
207 3300027907 Ga0207428_10244767 Ga0207428_102447672 300
208 3300028380 Ga0268265_10063693 Ga0268265_100636931 300
209 3300028381 Ga0268264_10024489 Ga0268264_100244896 300
210 3300039450 Ga0436363_0212371 Ga0436363_0212371_12994_13929 300
211 3300042436 Ga0439435_0013250 Ga0439435_0013250_1008_1910 300
212 3300046664 Ga0495659_0019102 Ga0495659_0019102_275_1177 300
213 3300048912 Ga0496109_0058727 Ga0496109_0058727_712_1614 300
214 3300049576 Ga0501040_0141613 Ga0501040_0141613_551_1453 300
215 3300049578 Ga0501042_0022884 Ga0501042_0022884_401_1303 300
216 3300049580 Ga0501046_0061065 Ga0501046_0061065_1845_2747 300
217 3300049582 Ga0501048_0151004 Ga0501048_0151004_433_1335 300
218 3300049587 Ga0501071_0232207 Ga0501071_0232207_195_1097 300
219 3300049590 Ga0501074_0147024 Ga0501074_0147024_575_1477 300
220 3300049591 Ga0501075_0044302 Ga0501075_0044302_350_1252 300
221 3300049593 Ga0501077_0110477 Ga0501077_0110477_238_1140 300
222 3300049741 Ga0501079_0110863 Ga0501079_0110863_503_1405 300
223 3300049742 Ga0501080_0237846 Ga0501080_0237846_60_962 300
224 3300049824 Ga0501045_0170194 Ga0501045_0170194_589_1491 300
225 3300050507 nmdc:mga05p37_19865_c1 nmdc:mga05p37_19865_c1_2759_3661 300
226 3300050507 nmdc:mga05p37_31350_c1 nmdc:mga05p37_31350_c1_1854_2756 300
227 3300050507 nmdc:mga05p37_384222_c1 nmdc:mga05p37_384222_c1_71_973 300
228 3300050508 nmdc:mga09592_15462_c1 nmdc:mga09592_15462_c1_1487_2389 300
229 3300050509 nmdc:mga0qj67_73299_c1 nmdc:mga0qj67_73299_c1_1665_2567 300
230 3300050510 nmdc:mga06r32_11689_c1 nmdc:mga06r32_11689_c1_5989_6891 300
231 3300050510 nmdc:mga06r32_3055_c1 nmdc:mga06r32_3055_c1_8991_9893 300
232 3300050510 nmdc:mga06r32_330052_c1 nmdc:mga06r32_330052_c1_346_1248 300
233 3300050510 nmdc:mga06r32_7651_c1 nmdc:mga06r32_7651_c1_1005_1907 300
234 3300050511 nmdc:mga08y16_1998_c1 nmdc:mga08y16_1998_c1_6664_7566 300
235 3300050515 nmdc:mga0a205_172419_c1 nmdc:mga0a205_172419_c1_656_1558 300
236 3300054114 Ga0501084_0051953 Ga0501084_0051953_1284_2186 300
237 3300061734 Ga0530510_0179817 Ga0530510_0179817_512_1414 300
238 3300005331 Ga0070670_100078673 Ga0070670_1000786733 301
239 3300005340 Ga0070689_100133991 Ga0070689_1001339912 301
240 3300005347 Ga0070668_100054514 Ga0070668_1000545142 301
241 3300005353 Ga0070669_100133099 Ga0070669_1001330992 301
242 3300005354 Ga0070675_100392757 Ga0070675_1003927571 301
243 3300005355 Ga0070671_100083879 Ga0070671_1000838791 301
244 3300005364 Ga0070673_100019791 Ga0070673_1000197914 301
245 3300005441 Ga0070700_100041415 Ga0070700_1000414152 301
246 3300005456 Ga0070678_100396365 Ga0070678_1003963652 301
247 3300005459 Ga0068867_100170123 Ga0068867_1001701232 301
248 3300005466 Ga0070685_10068257 Ga0070685_100682571 301
249 3300005564 Ga0070664_100164700 Ga0070664_1001647001 301
250 3300005842 Ga0068858_100185840 Ga0068858_1001858402 301
251 3300005844 Ga0068862_100053467 Ga0068862_1000534671 301
252 3300005844 Ga0068862_100243833 Ga0068862_1002438333 301
253 3300006237 Ga0097621_100044809 Ga0097621_1000448094 301
254 3300006358 Ga0068871_100002433 Ga0068871_1000024335 301
255 3300006358 Ga0068871_100023362 Ga0068871_1000233624 301
256 3300006358 Ga0068871_100113200 Ga0068871_1001132002 301
257 3300006358 Ga0068871_100177289 Ga0068871_1001772892 301
258 3300006871 Ga0075434_100002267 Ga0075434_10000226713 301
259 3300006871 Ga0075434_100489902 Ga0075434_1004899022 301
260 3300006881 Ga0068865_100157337 Ga0068865_1001573372 301
261 3300009098 Ga0105245_10231008 Ga0105245_102310082 301
262 3300009177 Ga0105248_10347682 Ga0105248_103476822 301
263 3300009553 Ga0105249_10002175 Ga0105249_100021752 301
264 3300013297 Ga0157378_10005152 Ga0157378_100051526 301
265 3300014969 Ga0157376_10038229 Ga0157376_100382295 301
266 3300014969 Ga0157376_10088031 Ga0157376_100880314 301
267 3300025315 Ga0207697_10002977 Ga0207697_100029776 301
268 3300025893 Ga0207682_10004751 Ga0207682_100047513 301
269 3300025906 Ga0207699_10229548 Ga0207699_102295481 301
270 3300025908 Ga0207643_10003472 Ga0207643_100034722 301
271 3300025926 Ga0207659_10022847 Ga0207659_100228472 301
272 3300025938 Ga0207704_10024999 Ga0207704_100249992 301
273 3300025944 Ga0207661_10129092 Ga0207661_101290922 301
274 3300026035 Ga0207703_10225506 Ga0207703_102255062 301
275 3300026067 Ga0207678_10077130 Ga0207678_100771302 301
276 3300026075 Ga0207708_10060464 Ga0207708_100604642 301
277 3300026089 Ga0207648_10396561 Ga0207648_103965612 301
278 3300026118 Ga0207675_100039464 Ga0207675_1000394642 301
279 3300026121 Ga0207683_10046846 Ga0207683_100468461 301
280 3300028380 Ga0268265_10010661 Ga0268265_100106614 301
281 3300028800 Ga0265338_10111587 Ga0265338_101115872 301
282 3300039437 Ga0436365_1167770 Ga0436365_1167770_267_1193 301
283 3300046472 Ga0495580_0017485 Ga0495580_0017485_948_1889 301
284 3300046475 Ga0495639_0139627 Ga0495639_0139627_55_996 301
285 3300046684 Ga0495669_0091424 Ga0495669_0091424_386_1312 301
286 3300046689 Ga0495613_0203808 Ga0495613_0203808_332_1273 301
287 3300047315 Ga0495581_0261955 Ga0495581_0261955_20_961 301
288 3300050509 nmdc:mga0qj67_36095_c1 nmdc:mga0qj67_36095_c1_192_1103 301
289 3300050510 nmdc:mga06r32_48368_c1 nmdc:mga06r32_48368_c1_2185_3111 301
290 3300050512 nmdc:mga0n895_279829_c1 nmdc:mga0n895_279829_c1_642_1583 301
291 3300050512 nmdc:mga0n895_38591_c1 nmdc:mga0n895_38591_c1_1090_2004 301
292 3300050515 nmdc:mga0a205_16169_c1 nmdc:mga0a205_16169_c1_212_1126 301
293 3300050515 nmdc:mga0a205_63306_c1 nmdc:mga0a205_63306_c1_333_1274 301
294 3300003323 rootH1_10169857 rootH1_101698572 302
295 3300005445 Ga0070708_100037017 Ga0070708_1000370176 302
296 3300005468 Ga0070707_100372221 Ga0070707_1003722212 302
297 3300005471 Ga0070698_100106609 Ga0070698_1001066092 302
298 3300005471 Ga0070698_100563980 Ga0070698_1005639801 302
299 3300005842 Ga0068858_100040023 Ga0068858_1000400232 302
300 3300005843 Ga0068860_100257331 Ga0068860_1002573312 302
301 3300006871 Ga0075434_100013753 Ga0075434_1000137533 302
302 3300007076 Ga0075435_100022855 Ga0075435_1000228555 302
303 3300009101 Ga0105247_10034709 Ga0105247_100347093 302
304 3300014968 Ga0157379_10011611 Ga0157379_100116117 302
305 3300028381 Ga0268264_10351387 Ga0268264_103513872 302
306 3300049571 Ga0501034_0224245 Ga0501034_0224245_14_1012 302
307 3300049573 Ga0501037_0051185 Ga0501037_0051185_807_1805 302
308 3300049574 Ga0501038_0102691 Ga0501038_0102691_58_1056 302
309 3300049582 Ga0501048_0135235 Ga0501048_0135235_288_1229 302
310 3300049823 Ga0501044_0007485 Ga0501044_0007485_4198_5196 302
311 3300050512 nmdc:mga0n895_6070_c1 nmdc:mga0n895_6070_c1_103_1020 302
312 3300050515 nmdc:mga0a205_1255_c1 nmdc:mga0a205_1255_c1_19451_20368 302
313 3300005842 Ga0068858_100205536 Ga0068858_1002055362 303
314 3300026035 Ga0207703_10094484 Ga0207703_100944841 303
315 3300035170 Ga0373943_0002797 Ga0373943_0002797_1161_2084 303
316 3300035410 Ga0373924_0022818 Ga0373924_0022818_1066_1989 303
317 3300046454 Ga0495592_0012737 Ga0495592_0012737_566_1489 303
318 3300046472 Ga0495580_0042000 Ga0495580_0042000_1875_2798 303
319 3300046473 Ga0495582_0072978 Ga0495582_0072978_242_1165 303
320 3300046514 Ga0495618_0155628 Ga0495618_0155628_489_1412 303
321 3300046517 Ga0495630_0021105 Ga0495630_0021105_312_1235 303
322 3300046529 Ga0495652_0258272 Ga0495652_0258272_207_1130 303
323 3300046535 Ga0495586_0107078 Ga0495586_0107078_12_935 303
324 3300046536 Ga0495587_0126812 Ga0495587_0126812_344_1267 303
325 3300046543 Ga0495645_0003697 Ga0495645_0003697_2420_3343 303
326 3300046559 Ga0495667_0005007 Ga0495667_0005007_5444_6367 303
327 3300046642 Ga0495634_0190368 Ga0495634_0190368_24_947 303
328 3300046663 Ga0495635_0225533 Ga0495635_0225533_135_1058 303
329 3300046683 Ga0495658_0151292 Ga0495658_0151292_270_1193 303
330 3300046689 Ga0495613_0002590 Ga0495613_0002590_3774_4697 303
331 3300047315 Ga0495581_0116164 Ga0495581_0116164_431_1354 303
332 3300047317 Ga0495604_0042629 Ga0495604_0042629_377_1300 303
333 3300047319 Ga0495674_0127732 Ga0495674_0127732_348_1271 303
334 3300047471 Ga0495684_0000446 Ga0495684_0000446_2112_3035 303
335 3300047471 Ga0495684_0107046 Ga0495684_0107046_322_1245 303
336 3300048917 Ga0496114_0259749 Ga0496114_0259749_235_1158 303
337 3300053085 Ga0495619_0007882 Ga0495619_0007882_3684_4607 303
338 3300005459 Ga0068867_100402268 Ga0068867_1004022682 304
339 3300021358 Ga0213873_10022417 Ga0213873_100224172 308
340 3300021377 Ga0213874_10006072 Ga0213874_100060722 308
341 3300021377 Ga0213874_10022262 Ga0213874_100222622 308
342 3300039450 Ga0436363_1222094 Ga0436363_1222094_12464_13432 308
343 3300039450 Ga0436363_1317556 Ga0436363_1317556_15614_16582 308
344 3300039453 Ga0436362_1201411 Ga0436362_1201411_6006_6974 308
345 3300003203 JGI25406J46586_10003549 JGI25406J46586_100035492 309
346 3300003203 JGI25406J46586_10007672 JGI25406J46586_100076721 309
347 3300005985 Ga0081539_10000133 Ga0081539_1000013376 309
348 3300005985 Ga0081539_10073802 Ga0081539_100738022 309
349 3300050511 nmdc:mga08y16_28383_c1 nmdc:mga08y16_28383_c1_2089_3021 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

140

352

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8suu-assembly1.cif.gz_B crystal structure of yisk from bacillus subtilis in apo form 0.9324 1 300
8suu-assembly1.cif.gz_B crystal structure of yisk from bacillus subtilis in apo form 0.923 1 300
8sky-assembly1.cif.gz_A crystal structure of yisk from bacillus subtilis in complex with oxalate 0.9122 1 300
8sut-assembly1.cif.gz_B crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid 0.9103 1 300
8suu-assembly1.cif.gz_A crystal structure of yisk from bacillus subtilis in apo form 0.9063 1 299
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9352 82 301 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9229 85 300 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9223 82 301 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9189 83 302 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9106 66 300 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A537SKQ0-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9803 202 300 GO:0016787
GO:0046872
AF-A0A7X0P1M9-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase in catechol pathway 0.9743 204 304 GO:0003824
GO:0046872
AF-A0A4Q2XYH2-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9724 203 304 GO:0016787
GO:0046872
AF-A0A4Q2XYH2-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9631 203 304 GO:0016787
GO:0046872
AF-A0A7C4J8B3-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.956 91 300 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map