F417546

General Info

Members Datasets Scaffolds Average Seq Length
348 166 696 231

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1009158|Ga0224572_10091582
Length 260
Sequence MMIQIRRAFDPQTIKLVIFDLDGTLIDSRLDLVHSVNAALRHIGRPELPDDVIASYVGDGAPVLIQRALGGEAVDEAIVRDGLQYFLSYYREHKLDHTTVYEGIPGALRFIQNGHAVGGANHSLGGNSNGFSRRMAVLSNKPVVPSRAIVEALGLGPFFTNVYGGNSFSTKKPDPEGARKLLEENAIRPEEVVIVGDSHVDVETGRNAGLWTIGVSYGFAPHTLRRLGRMWLWIRRRSWGRCLSKGASGGISCTAGVVLM

Samples

Sample ID Description Type Environment
1 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
76 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
124 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.45
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 16.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224572_1009158 3300024225 Bacteria 1842
2 LJNas_1000713 3300000546 Bacteria 5592
3 rootH1_10107917 3300003323 Bacteria 2519
4 Ga0070683_100035234 3300005329 Bacteria 4575
5 Ga0070690_100076773 3300005330 Bacteria 2180
6 Ga0070670_100000902 3300005331 Bacteria 23358
7 Ga0068869_100002990 3300005334 Bacteria 10271
8 Ga0068869_100011918 3300005334 Bacteria 5720
9 Ga0070680_100631498 3300005336 Bacteria 920
10 Ga0068868_100004776 3300005338 Bacteria 9515
11 Ga0068868_100089775 3300005338 Bacteria 2474
12 Ga0070661_100096379 3300005344 Bacteria 2195
13 Ga0070671_100255714 3300005355 Bacteria 1488
14 Ga0070673_100050079 3300005364 Bacteria 3264
15 Ga0070673_100371043 3300005364 Bacteria 1274
16 Ga0070673_100636397 3300005364 Unclassified 975
17 Ga0070659_100118106 3300005366 Bacteria 2145
18 Ga0070709_10000710 3300005434 Bacteria 18918
19 Ga0070709_10030059 3300005434 Bacteria 3257
20 Ga0070709_10051223 3300005434 Bacteria 2590
21 Ga0070714_100000501 3300005435 Bacteria 28470
22 Ga0070714_100026231 3300005435 Bacteria 4814
23 Ga0070714_100049865 3300005435 Unclassified 3564
24 Ga0070714_100219535 3300005435 Unclassified 1746
25 Ga0070713_100000275 3300005436 Bacteria 33686
26 Ga0070713_100000718 3300005436 Bacteria 21244
27 Ga0070713_100017254 3300005436 Bacteria 5455
28 Ga0070713_100067377 3300005436 Bacteria 3014
29 Ga0070713_100323869 3300005436 Bacteria 1424
30 Ga0070710_10010216 3300005437 Bacteria 4607
31 Ga0070711_100003308 3300005439 Bacteria 9378
32 Ga0070711_100079449 3300005439 Unclassified 2333
33 Ga0070711_100100746 3300005439 Bacteria 2101
34 Ga0070708_100012404 3300005445 Bacteria 6957
35 Ga0070708_100039944 3300005445 Bacteria 4108
36 Ga0070662_100475897 3300005457 Bacteria 1039
37 Ga0070681_10000420 3300005458 Bacteria 34438
38 Ga0070681_10033375 3300005458 Bacteria 5168
39 Ga0070681_10041674 3300005458 Bacteria 4602
40 Ga0070681_10086571 3300005458 Bacteria 3086
41 Ga0070681_10311703 3300005458 Unclassified 1483
42 Ga0068867_100089397 3300005459 Bacteria 2336
43 Ga0068867_100277753 3300005459 Unclassified 1372
44 Ga0070706_100001629 3300005467 Bacteria 23411
45 Ga0070706_100017910 3300005467 Bacteria 6535
46 Ga0070707_100065593 3300005468 Bacteria 3488
47 Ga0070698_100669668 3300005471 Bacteria 979
48 Ga0070699_100154094 3300005518 Unclassified 2033
49 Ga0070679_100012479 3300005530 Bacteria 8123
50 Ga0070679_100073781 3300005530 Bacteria 3403
51 Ga0070684_100023163 3300005535 Bacteria 5188
52 Ga0070684_100097943 3300005535 Bacteria 2616
53 Ga0070684_100133075 3300005535 Unclassified 2244
54 Ga0070684_100258017 3300005535 Bacteria 1594
55 Ga0070697_100019117 3300005536 Bacteria 5408
56 Ga0068853_100114880 3300005539 Bacteria 2395
57 Ga0070695_100513848 3300005545 Unclassified 928
58 Ga0070693_100166767 3300005547 Bacteria 1407
59 Ga0068855_100004101 3300005563 Bacteria 17772
60 Ga0068855_100014547 3300005563 Bacteria 9477
61 Ga0068855_100024137 3300005563 Bacteria 7279
62 Ga0068855_100043329 3300005563 Bacteria 5332
63 Ga0068855_100066310 3300005563 Unclassified 4209
64 Ga0068855_100146700 3300005563 Unclassified 2685
65 Ga0070664_100003460 3300005564 Bacteria 12761
66 Ga0068857_100007974 3300005577 Bacteria 9143
67 Ga0068857_100012558 3300005577 Bacteria 7377
68 Ga0068857_100321622 3300005577 Bacteria 1429
69 Ga0068854_100005183 3300005578 Bacteria 8217
70 Ga0068854_100120461 3300005578 Bacteria 1991
71 Ga0068854_100212957 3300005578 Unclassified 1525
72 Ga0068856_100004788 3300005614 Bacteria 13412
73 Ga0068856_100006849 3300005614 Bacteria 11145
74 Ga0068856_100014023 3300005614 Bacteria 7748
75 Ga0068856_100045939 3300005614 Bacteria 4301
76 Ga0068856_100054535 3300005614 Unclassified 3943
77 Ga0070702_100098303 3300005615 Bacteria 1790
78 Ga0068859_100018554 3300005617 Bacteria 6992
79 Ga0068859_100037587 3300005617 Bacteria 4859
80 Ga0068864_100008989 3300005618 Bacteria 8239
81 Ga0068864_100011565 3300005618 Bacteria 7288
82 Ga0068864_100062120 3300005618 Bacteria 3236
83 Ga0068866_10005851 3300005718 Bacteria 5106
84 Ga0068866_10178130 3300005718 Unclassified 1253
85 Ga0068861_100133554 3300005719 Bacteria 2017
86 Ga0068851_10216082 3300005834 Bacteria 1075
87 Ga0068870_10007347 3300005840 Bacteria 4908
88 Ga0068863_100024181 3300005841 Bacteria 5795
89 Ga0068863_100095291 3300005841 Unclassified 2825
90 Ga0068863_100106334 3300005841 Bacteria 2670
91 Ga0068863_100890339 3300005841 Bacteria 890
92 Ga0068858_100003297 3300005842 Bacteria 16070
93 Ga0068858_100028651 3300005842 Bacteria 5172
94 Ga0068858_100455542 3300005842 Bacteria 1233
95 Ga0068860_100008103 3300005843 Bacteria 10465
96 Ga0068862_100129122 3300005844 Bacteria 2234
97 Ga0081455_10170008 3300005937 Bacteria 1661
98 Ga0070717_10004169 3300006028 Bacteria 10421
99 Ga0070717_10072635 3300006028 Unclassified 2873
100 Ga0070717_10081753 3300006028 Unclassified 2713
101 Ga0070717_10128476 3300006028 Unclassified 2178
102 Ga0070717_10142957 3300006028 Bacteria 2065
103 Ga0070717_10162866 3300006028 Bacteria 1936
104 Ga0070717_10568218 3300006028 Bacteria 1028
105 Ga0070717_10748226 3300006028 Unclassified 889
106 Ga0070716_100003978 3300006173 Bacteria 7014
107 Ga0070716_100018335 3300006173 Unclassified 3645
108 Ga0070712_100000411 3300006175 Bacteria 24429
109 Ga0070712_100001631 3300006175 Bacteria 13726
110 Ga0070712_100016227 3300006175 Bacteria 4809
111 Ga0070712_100109484 3300006175 Bacteria 2059
112 Ga0070712_100330513 3300006175 Bacteria 1242
113 Ga0097621_100000929 3300006237 Bacteria 20506
114 Ga0097621_100027321 3300006237 Bacteria 4486
115 Ga0097621_100562334 3300006237 Bacteria 1039
116 Ga0068871_100000847 3300006358 Bacteria 20492
117 Ga0068871_100011723 3300006358 Bacteria 6438
118 Ga0068871_100047554 3300006358 Unclassified 3460
119 Ga0068871_100050953 3300006358 Bacteria 3350
120 Ga0068865_100010382 3300006881 Bacteria 5797
121 Ga0068865_100016017 3300006881 Unclassified 4789
122 Ga0068865_100040527 3300006881 Unclassified 3165
123 Ga0097620_100018554 3300006931 Bacteria 6992
124 Ga0097620_100037587 3300006931 Bacteria 4859
125 Ga0105240_10047681 3300009093 Bacteria 5420
126 Ga0105240_10050185 3300009093 Bacteria 5262
127 Ga0105240_10054677 3300009093 Bacteria 5002
128 Ga0105240_10131356 3300009093 Bacteria 3003
129 Ga0105245_10133491 3300009098 Unclassified 2331
130 Ga0105245_10242810 3300009098 Bacteria 1746
131 Ga0105245_10541461 3300009098 Unclassified 1185
132 Ga0105245_10695732 3300009098 Bacteria 1049
133 Ga0105247_10239563 3300009101 Bacteria 1235
134 Ga0105241_10043436 3300009174 Bacteria 3404
135 Ga0105241_10077889 3300009174 Bacteria 2589
136 Ga0105241_10109441 3300009174 Bacteria 2210
137 Ga0105241_10265822 3300009174 Bacteria 1459
138 Ga0105242_10062968 3300009176 Bacteria 3054
139 Ga0105242_10265170 3300009176 Bacteria 1553
140 Ga0105242_10646657 3300009176 Bacteria 1028
141 Ga0105242_11149239 3300009176 Unclassified 793
142 Ga0105237_10029945 3300009545 Bacteria 5529
143 Ga0105237_10042431 3300009545 Bacteria 4587
144 Ga0105237_10506295 3300009545 Bacteria 1214
145 Ga0105238_10000627 3300009551 Bacteria 37111
146 Ga0105238_10022542 3300009551 Bacteria 6418
147 Ga0105238_10157109 3300009551 Bacteria 2249
148 Ga0105238_10714171 3300009551 Bacteria 1015
149 Ga0105239_10008176 3300010375 Bacteria 11932
150 Ga0105239_10018754 3300010375 Bacteria 7642
151 Ga0105239_10100834 3300010375 Bacteria 3194
152 Ga0105239_10305950 3300010375 Bacteria 1791
153 Ga0105246_10117944 3300011119 Bacteria 1962
154 Ga0105246_10121224 3300011119 Bacteria 1938
155 Ga0157373_10013742 3300013100 Bacteria 5935
156 Ga0157373_10034145 3300013100 Bacteria 3654
157 Ga0157370_10067544 3300013104 Bacteria 3379
158 Ga0157369_10000133 3300013105 Bacteria 105997
159 Ga0157369_10031966 3300013105 Bacteria 5790
160 Ga0157369_10092917 3300013105 Bacteria 3221
161 Ga0157374_10001442 3300013296 Bacteria 20103
162 Ga0157374_10001556 3300013296 Bacteria 19298
163 Ga0157374_10004514 3300013296 Bacteria 11698
164 Ga0157374_10014638 3300013296 Bacteria 6865
165 Ga0157374_10063072 3300013296 Unclassified 3476
166 Ga0157374_10180014 3300013296 Bacteria 2064
167 Ga0157378_10000405 3300013297 Bacteria 42598
168 Ga0157378_10001015 3300013297 Bacteria 25643
169 Ga0157378_10004210 3300013297 Bacteria 12702
170 Ga0157378_10346562 3300013297 Bacteria 1450
171 Ga0163162_10004846 3300013306 Bacteria 12990
172 Ga0163162_10138519 3300013306 Bacteria 2545
173 Ga0157372_10005057 3300013307 Bacteria 14012
174 Ga0157372_10016570 3300013307 Bacteria 7908
175 Ga0157372_10020979 3300013307 Bacteria 7053
176 Ga0157372_10023584 3300013307 Bacteria 6673
177 Ga0157372_10071244 3300013307 Bacteria 3914
178 Ga0157372_10076693 3300013307 Bacteria 3774
179 Ga0163163_10153608 3300014325 Bacteria 2345
180 Ga0163163_10354859 3300014325 Bacteria 1523
181 Ga0157376_10004821 3300014969 Bacteria 9398
182 Ga0157376_10009336 3300014969 Bacteria 7126
183 Ga0157376_10066733 3300014969 Bacteria 3042
184 Ga0224569_100178 3300022732 Bacteria 5042
185 Ga0224571_101738 3300022734 Bacteria 1366
186 Ga0207697_10249628 3300025315 Unclassified 785
187 Ga0207692_10005275 3300025898 Bacteria 5166
188 Ga0207642_10014225 3300025899 Bacteria 2930
189 Ga0207642_10169538 3300025899 Unclassified 1180
190 Ga0207647_10003272 3300025904 Bacteria 12168
191 Ga0207647_10050070 3300025904 Bacteria 2588
192 Ga0207699_10006172 3300025906 Bacteria 5778
193 Ga0207699_10146879 3300025906 Bacteria 1556
194 Ga0207643_10024341 3300025908 Bacteria 3341
195 Ga0207684_10000217 3300025910 Bacteria 88691
196 Ga0207654_10021438 3300025911 Bacteria 3436
197 Ga0207707_10003714 3300025912 Bacteria 13514
198 Ga0207707_10008566 3300025912 Bacteria 8867
199 Ga0207707_10154872 3300025912 Unclassified 2004
200 Ga0207695_10043827 3300025913 Bacteria 4763
201 Ga0207695_10095341 3300025913 Bacteria 2980
202 Ga0207695_10144505 3300025913 Bacteria 2324
203 Ga0207695_10162344 3300025913 Unclassified 2165
204 Ga0207671_10346468 3300025914 Unclassified 1178
205 Ga0207671_10535347 3300025914 Unclassified 934
206 Ga0207693_10000293 3300025915 Bacteria 46425
207 Ga0207693_10000350 3300025915 Bacteria 42606
208 Ga0207693_10065852 3300025915 Unclassified 2837
209 Ga0207693_10079521 3300025915 Bacteria 2566
210 Ga0207663_10001205 3300025916 Bacteria 11947
211 Ga0207663_10143187 3300025916 Unclassified 1668
212 Ga0207663_10498292 3300025916 Bacteria 946
213 Ga0207660_10546705 3300025917 Bacteria 942
214 Ga0207657_10001558 3300025919 Bacteria 24604
215 Ga0207649_10008885 3300025920 Bacteria 5486
216 Ga0207652_10022369 3300025921 Bacteria 5230
217 Ga0207652_10039381 3300025921 Unclassified 4011
218 Ga0207652_10088712 3300025921 Bacteria 2714
219 Ga0207652_10316740 3300025921 Bacteria 1408
220 Ga0207646_10001311 3300025922 Bacteria 30882
221 Ga0207694_10295471 3300025924 Bacteria 1333
222 Ga0207650_10049445 3300025925 Bacteria 3105
223 Ga0207687_10162703 3300025927 Bacteria 1714
224 Ga0207700_10000632 3300025928 Bacteria 20587
225 Ga0207700_10004653 3300025928 Bacteria 8130
226 Ga0207700_10028949 3300025928 Bacteria 3904
227 Ga0207700_10114496 3300025928 Bacteria 2176
228 Ga0207664_10000528 3300025929 Bacteria 27199
229 Ga0207664_10013149 3300025929 Bacteria 5934
230 Ga0207664_10042320 3300025929 Unclassified 3555
231 Ga0207664_10563648 3300025929 Unclassified 1022
232 Ga0207644_10273149 3300025931 Bacteria 1355
233 Ga0207690_10122858 3300025932 Bacteria 1888
234 Ga0207706_10121207 3300025933 Unclassified 2299
235 Ga0207686_10269251 3300025934 Unclassified 1252
236 Ga0207686_10796669 3300025934 Unclassified 757
237 Ga0207704_10013420 3300025938 Bacteria 4098
238 Ga0207704_10051858 3300025938 Bacteria 2484
239 Ga0207704_10121179 3300025938 Bacteria 1790
240 Ga0207665_10007473 3300025939 Bacteria 7223
241 Ga0207665_10011452 3300025939 Bacteria 5825
242 Ga0207665_10247561 3300025939 Unclassified 1316
243 Ga0207665_10465274 3300025939 Bacteria 972
244 Ga0207711_10072812 3300025941 Bacteria 2985
245 Ga0207689_10000418 3300025942 Bacteria 39833
246 Ga0207689_10010295 3300025942 Bacteria 8052
247 Ga0207689_10010624 3300025942 Bacteria 7924
248 Ga0207661_10025791 3300025944 Bacteria 4472
249 Ga0207661_10058009 3300025944 Unclassified 3115
250 Ga0207679_10004886 3300025945 Bacteria 8355
251 Ga0207667_10001385 3300025949 Bacteria 30410
252 Ga0207667_10014785 3300025949 Bacteria 8881
253 Ga0207667_10018714 3300025949 Bacteria 7759
254 Ga0207667_10208432 3300025949 Bacteria 2004
255 Ga0207667_10322351 3300025949 Bacteria 1578
256 Ga0207651_10094421 3300025960 Bacteria 2199
257 Ga0207640_10003686 3300025981 Bacteria 8261
258 Ga0207640_10197090 3300025981 Bacteria 1523
259 Ga0207703_10002946 3300026035 Bacteria 14458
260 Ga0207703_10012580 3300026035 Bacteria 6596
261 Ga0207703_10016620 3300026035 Bacteria 5738
262 Ga0207639_10087920 3300026041 Bacteria 2478
263 Ga0207678_10003661 3300026067 Bacteria 13811
264 Ga0207702_10001639 3300026078 Bacteria 22149
265 Ga0207702_10007275 3300026078 Bacteria 9469
266 Ga0207702_10062923 3300026078 Bacteria 3171
267 Ga0207702_10299406 3300026078 Bacteria 1526
268 Ga0207702_10549017 3300026078 Bacteria 1130
269 Ga0207641_10009425 3300026088 Bacteria 8044
270 Ga0207641_10095997 3300026088 Unclassified 2603
271 Ga0207641_10873448 3300026088 Bacteria 892
272 Ga0207648_10010993 3300026089 Bacteria 8547
273 Ga0207676_10005048 3300026095 Bacteria 9339
274 Ga0207676_10316281 3300026095 Bacteria 1431
275 Ga0207674_10002806 3300026116 Bacteria 21673
276 Ga0207674_10003348 3300026116 Bacteria 19669
277 Ga0207674_10083209 3300026116 Bacteria 3200
278 Ga0207674_10327245 3300026116 Bacteria 1482
279 Ga0207675_100133081 3300026118 Bacteria 2358
280 Ga0207698_10139206 3300026142 Bacteria 2088
281 Ga0265356_1008508 3300028017 Unclassified 1168
282 Ga0265355_1000462 3300028036 Unclassified 2118
283 Ga0268265_10110830 3300028380 Bacteria 2240
284 Ga0268264_10076484 3300028381 Bacteria 2848
285 Ga0268264_10129430 3300028381 Bacteria 2235
286 Ga0265338_10004414 3300028800 Bacteria 19018
287 Ga0265338_10046780 3300028800 Bacteria 3960
288 Ga0265338_10162369 3300028800 Bacteria 1724
289 Ga0265762_1021573 3300030760 Bacteria 1188
290 Ga0265760_10001338 3300031090 Bacteria 7234
291 Ga0265760_10008491 3300031090 Bacteria 2937
292 Ga0265340_10274530 3300031247 Unclassified 749
293 Ga0265339_10026662 3300031249 Bacteria 3308
294 Ga0265316_10014873 3300031344 Bacteria 6826
295 Ga0265314_10038464 3300031711 Bacteria 3455
296 Ga0373926_0011774 3300035083 Bacteria 2951
297 Ga0373944_0010720 3300035089 Bacteria 2503
298 Ga0373923_0009592 3300035111 Bacteria 3499
299 Ga0373923_0114102 3300035111 Unclassified 1202
300 Ga0373936_0000354 3300035113 Bacteria 15557
301 Ga0373936_0004765 3300035113 Bacteria 5125
302 Ga0373936_0111681 3300035113 Bacteria 1161
303 Ga0373945_0024475 3300035116 Bacteria 2092
304 Ga0373945_0112796 3300035116 Bacteria 1074
305 Ga0373943_0000054 3300035170 Bacteria 38966
306 Ga0373955_0117750 3300035172 Bacteria 1541
307 Ga0373924_0164370 3300035410 Bacteria 974
308 Ga0373935_0000891 3300035692 Bacteria 16134
309 Ga0373935_0029899 3300035692 Unclassified 3373
310 Ga0373935_0259356 3300035692 Bacteria 1219
311 Ga0373927_0000093 3300035695 Bacteria 67477
312 Ga0373927_0271690 3300035695 Bacteria 1115
313 Ga0373933_0564807 3300035724 Bacteria 747
314 Ga0373947_0002260 3300035725 Bacteria 11635
315 Ga0373937_0259322 3300036401 Bacteria 1639
316 Ga0373937_0296029 3300036401 Bacteria 1529
317 Ga0373937_0920574 3300036401 Unclassified 823
318 Ga0373925_0000603 3300037068 Bacteria 34219
319 Ga0395905_1045155 3300037471 Unclassified 720
320 Ga0466957_0051748 3300044842 Bacteria 2500
321 Ga0466967_0587689 3300045976 Unclassified 1098
322 Ga0495629_0019342 3300046459 Bacteria 4867
323 Ga0495580_0000031 3300046472 Bacteria 76248
324 Ga0495580_0010864 3300046472 Bacteria 7067
325 Ga0495580_0072390 3300046472 Unclassified 2407
326 Ga0495580_0075330 3300046472 Bacteria 2354
327 Ga0495664_0007802 3300046477 Bacteria 5956
328 Ga0495584_0266992 3300046491 Viruses 870
329 Ga0495658_0004604 3300046683 Bacteria 6789
330 Ga0495674_0029021 3300047319 Bacteria 5039
331 Ga0495674_0036582 3300047319 Bacteria 4418
332 Ga0495675_0133927 3300047444 Bacteria 1539
333 Ga0495602_0456288 3300048088 Unclassified 901
334 Ga0496100_0433322 3300048903 Bacteria 1006
335 Ga0496102_0270180 3300048905 Bacteria 1603
336 Ga0496102_0840529 3300048905 Unclassified 840
337 Ga0496104_0054639 3300048907 Bacteria 3775
338 Ga0496104_0085692 3300048907 Bacteria 3007
339 Ga0496104_0357331 3300048907 Bacteria 1373
340 Ga0496104_0538760 3300048907 Unclassified 1078
341 Ga0496109_0232912 3300048912 Bacteria 1733
342 Ga0496109_0755686 3300048912 Bacteria 910
343 Ga0496112_0002782 3300048915 Bacteria 14197
344 Ga0496112_0014914 3300048915 Bacteria 7232
345 Ga0496115_0043326 3300048918 Bacteria 3589
346 Ga0501083_0143049 3300049744 Unclassified 1566
347 Ga0501083_0288038 3300049744 Bacteria 1068
348 Ga0466962_0063113 3300061719 Bacteria 1769
349 Ga0224572_1009158
350 LJNas_1000713
351 rootH1_10107917
352 Ga0070683_100035234
353 Ga0070690_100076773
354 Ga0070670_100000902
355 Ga0068869_100002990
356 Ga0068869_100011918
357 Ga0070680_100631498
358 Ga0068868_100004776
359 Ga0068868_100089775
360 Ga0070661_100096379
361 Ga0070671_100255714
362 Ga0070673_100050079
363 Ga0070673_100371043
364 Ga0070673_100636397
365 Ga0070659_100118106
366 Ga0070709_10000710
367 Ga0070709_10030059
368 Ga0070709_10051223
369 Ga0070714_100000501
370 Ga0070714_100026231
371 Ga0070714_100049865
372 Ga0070714_100219535
373 Ga0070713_100000275
374 Ga0070713_100000718
375 Ga0070713_100017254
376 Ga0070713_100067377
377 Ga0070713_100323869
378 Ga0070710_10010216
379 Ga0070711_100003308
380 Ga0070711_100079449
381 Ga0070711_100100746
382 Ga0070708_100012404
383 Ga0070708_100039944
384 Ga0070662_100475897
385 Ga0070681_10000420
386 Ga0070681_10033375
387 Ga0070681_10041674
388 Ga0070681_10086571
389 Ga0070681_10311703
390 Ga0068867_100089397
391 Ga0068867_100277753
392 Ga0070706_100001629
393 Ga0070706_100017910
394 Ga0070707_100065593
395 Ga0070698_100669668
396 Ga0070699_100154094
397 Ga0070679_100012479
398 Ga0070679_100073781
399 Ga0070684_100023163
400 Ga0070684_100097943
401 Ga0070684_100133075
402 Ga0070684_100258017
403 Ga0070697_100019117
404 Ga0068853_100114880
405 Ga0070695_100513848
406 Ga0070693_100166767
407 Ga0068855_100004101
408 Ga0068855_100014547
409 Ga0068855_100024137
410 Ga0068855_100043329
411 Ga0068855_100066310
412 Ga0068855_100146700
413 Ga0070664_100003460
414 Ga0068857_100007974
415 Ga0068857_100012558
416 Ga0068857_100321622
417 Ga0068854_100005183
418 Ga0068854_100120461
419 Ga0068854_100212957
420 Ga0068856_100004788
421 Ga0068856_100006849
422 Ga0068856_100014023
423 Ga0068856_100045939
424 Ga0068856_100054535
425 Ga0070702_100098303
426 Ga0068859_100018554
427 Ga0068859_100037587
428 Ga0068864_100008989
429 Ga0068864_100011565
430 Ga0068864_100062120
431 Ga0068866_10005851
432 Ga0068866_10178130
433 Ga0068861_100133554
434 Ga0068851_10216082
435 Ga0068870_10007347
436 Ga0068863_100024181
437 Ga0068863_100095291
438 Ga0068863_100106334
439 Ga0068863_100890339
440 Ga0068858_100003297
441 Ga0068858_100028651
442 Ga0068858_100455542
443 Ga0068860_100008103
444 Ga0068862_100129122
445 Ga0081455_10170008
446 Ga0070717_10004169
447 Ga0070717_10072635
448 Ga0070717_10081753
449 Ga0070717_10128476
450 Ga0070717_10142957
451 Ga0070717_10162866
452 Ga0070717_10568218
453 Ga0070717_10748226
454 Ga0070716_100003978
455 Ga0070716_100018335
456 Ga0070712_100000411
457 Ga0070712_100001631
458 Ga0070712_100016227
459 Ga0070712_100109484
460 Ga0070712_100330513
461 Ga0097621_100000929
462 Ga0097621_100027321
463 Ga0097621_100562334
464 Ga0068871_100000847
465 Ga0068871_100011723
466 Ga0068871_100047554
467 Ga0068871_100050953
468 Ga0068865_100010382
469 Ga0068865_100016017
470 Ga0068865_100040527
471 Ga0097620_100018554
472 Ga0097620_100037587
473 Ga0105240_10047681
474 Ga0105240_10050185
475 Ga0105240_10054677
476 Ga0105240_10131356
477 Ga0105245_10133491
478 Ga0105245_10242810
479 Ga0105245_10541461
480 Ga0105245_10695732
481 Ga0105247_10239563
482 Ga0105241_10043436
483 Ga0105241_10077889
484 Ga0105241_10109441
485 Ga0105241_10265822
486 Ga0105242_10062968
487 Ga0105242_10265170
488 Ga0105242_10646657
489 Ga0105242_11149239
490 Ga0105237_10029945
491 Ga0105237_10042431
492 Ga0105237_10506295
493 Ga0105238_10000627
494 Ga0105238_10022542
495 Ga0105238_10157109
496 Ga0105238_10714171
497 Ga0105239_10008176
498 Ga0105239_10018754
499 Ga0105239_10100834
500 Ga0105239_10305950
501 Ga0105246_10117944
502 Ga0105246_10121224
503 Ga0157373_10013742
504 Ga0157373_10034145
505 Ga0157370_10067544
506 Ga0157369_10000133
507 Ga0157369_10031966
508 Ga0157369_10092917
509 Ga0157374_10001442
510 Ga0157374_10001556
511 Ga0157374_10004514
512 Ga0157374_10014638
513 Ga0157374_10063072
514 Ga0157374_10180014
515 Ga0157378_10000405
516 Ga0157378_10001015
517 Ga0157378_10004210
518 Ga0157378_10346562
519 Ga0163162_10004846
520 Ga0163162_10138519
521 Ga0157372_10005057
522 Ga0157372_10016570
523 Ga0157372_10020979
524 Ga0157372_10023584
525 Ga0157372_10071244
526 Ga0157372_10076693
527 Ga0163163_10153608
528 Ga0163163_10354859
529 Ga0157376_10004821
530 Ga0157376_10009336
531 Ga0157376_10066733
532 Ga0224569_100178
533 Ga0224571_101738
534 Ga0207697_10249628
535 Ga0207692_10005275
536 Ga0207642_10014225
537 Ga0207642_10169538
538 Ga0207647_10003272
539 Ga0207647_10050070
540 Ga0207699_10006172
541 Ga0207699_10146879
542 Ga0207643_10024341
543 Ga0207684_10000217
544 Ga0207654_10021438
545 Ga0207707_10003714
546 Ga0207707_10008566
547 Ga0207707_10154872
548 Ga0207695_10043827
549 Ga0207695_10095341
550 Ga0207695_10144505
551 Ga0207695_10162344
552 Ga0207671_10346468
553 Ga0207671_10535347
554 Ga0207693_10000293
555 Ga0207693_10000350
556 Ga0207693_10065852
557 Ga0207693_10079521
558 Ga0207663_10001205
559 Ga0207663_10143187
560 Ga0207663_10498292
561 Ga0207660_10546705
562 Ga0207657_10001558
563 Ga0207649_10008885
564 Ga0207652_10022369
565 Ga0207652_10039381
566 Ga0207652_10088712
567 Ga0207652_10316740
568 Ga0207646_10001311
569 Ga0207694_10295471
570 Ga0207650_10049445
571 Ga0207687_10162703
572 Ga0207700_10000632
573 Ga0207700_10004653
574 Ga0207700_10028949
575 Ga0207700_10114496
576 Ga0207664_10000528
577 Ga0207664_10013149
578 Ga0207664_10042320
579 Ga0207664_10563648
580 Ga0207644_10273149
581 Ga0207690_10122858
582 Ga0207706_10121207
583 Ga0207686_10269251
584 Ga0207686_10796669
585 Ga0207704_10013420
586 Ga0207704_10051858
587 Ga0207704_10121179
588 Ga0207665_10007473
589 Ga0207665_10011452
590 Ga0207665_10247561
591 Ga0207665_10465274
592 Ga0207711_10072812
593 Ga0207689_10000418
594 Ga0207689_10010295
595 Ga0207689_10010624
596 Ga0207661_10025791
597 Ga0207661_10058009
598 Ga0207679_10004886
599 Ga0207667_10001385
600 Ga0207667_10014785
601 Ga0207667_10018714
602 Ga0207667_10208432
603 Ga0207667_10322351
604 Ga0207651_10094421
605 Ga0207640_10003686
606 Ga0207640_10197090
607 Ga0207703_10002946
608 Ga0207703_10012580
609 Ga0207703_10016620
610 Ga0207639_10087920
611 Ga0207678_10003661
612 Ga0207702_10001639
613 Ga0207702_10007275
614 Ga0207702_10062923
615 Ga0207702_10299406
616 Ga0207702_10549017
617 Ga0207641_10009425
618 Ga0207641_10095997
619 Ga0207641_10873448
620 Ga0207648_10010993
621 Ga0207676_10005048
622 Ga0207676_10316281
623 Ga0207674_10002806
624 Ga0207674_10003348
625 Ga0207674_10083209
626 Ga0207674_10327245
627 Ga0207675_100133081
628 Ga0207698_10139206
629 Ga0265356_1008508
630 Ga0265355_1000462
631 Ga0268265_10110830
632 Ga0268264_10076484
633 Ga0268264_10129430
634 Ga0265338_10004414
635 Ga0265338_10046780
636 Ga0265338_10162369
637 Ga0265762_1021573
638 Ga0265760_10001338
639 Ga0265760_10008491
640 Ga0265340_10274530
641 Ga0265339_10026662
642 Ga0265316_10014873
643 Ga0265314_10038464
644 Ga0373926_0011774
645 Ga0373944_0010720
646 Ga0373923_0009592
647 Ga0373923_0114102
648 Ga0373936_0000354
649 Ga0373936_0004765
650 Ga0373936_0111681
651 Ga0373945_0024475
652 Ga0373945_0112796
653 Ga0373943_0000054
654 Ga0373955_0117750
655 Ga0373924_0164370
656 Ga0373935_0000891
657 Ga0373935_0029899
658 Ga0373935_0259356
659 Ga0373927_0000093
660 Ga0373927_0271690
661 Ga0373933_0564807
662 Ga0373947_0002260
663 Ga0373937_0259322
664 Ga0373937_0296029
665 Ga0373937_0920574
666 Ga0373925_0000603
667 Ga0395905_1045155
668 Ga0466957_0051748
669 Ga0466967_0587689
670 Ga0495629_0019342
671 Ga0495580_0000031
672 Ga0495580_0010864
673 Ga0495580_0072390
674 Ga0495580_0075330
675 Ga0495664_0007802
676 Ga0495584_0266992
677 Ga0495658_0004604
678 Ga0495674_0029021
679 Ga0495674_0036582
680 Ga0495675_0133927
681 Ga0495602_0456288
682 Ga0496100_0433322
683 Ga0496102_0270180
684 Ga0496102_0840529
685 Ga0496104_0054639
686 Ga0496104_0085692
687 Ga0496104_0357331
688 Ga0496104_0538760
689 Ga0496109_0232912
690 Ga0496109_0755686
691 Ga0496112_0002782
692 Ga0496112_0014914
693 Ga0496115_0043326
694 Ga0501083_0143049
695 Ga0501083_0288038
696 Ga0466962_0063113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

131

215

0.97

PF13242

Hydrolase_like

HAD-hyrolase-like

169

229

0.92

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

17

118

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

14

209

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8987 37 254
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.883 37 254
3fm9-assembly1.cif.gz_A analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis 0.8611 37 225
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.8561 36 254
4rn3-assembly1.cif.gz_A crystal structure of a had-superfamily hydrolase, subfamily ia, variant 1 (gsu2069) from geobacter sulfurreducens pca at 2.15 a resolution 0.8538 30 254
ID Description Score Start End Superfamily
af_Q54P82_223_296_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9483 182 225 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9264 39 252 3.40.50.1000
2go7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9234 126 224 3.40.50.1000
af_Q6EP66_224_294_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9212 182 225 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9195 124 222 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Z9KVB7-F1-model_v4 HAD family hydrolase 0.9614 144 254 GO:0005829
GO:0006281
GO:0008967
AF-D2MLU3-F1-model_v4 HAD hydrolase, family IA, variant 3 0.953 144 224 GO:0006281
GO:0008967
AF-D3CXG8-F1-model_v4 HAD family hydrolase 0.9364 122 254 GO:0005829
GO:0006281
GO:0008967
AF-A0A428BVZ1-F1-model_v4 deleted 0.9344 144 225
AF-A0A521XCZ9-F1-model_v4 HAD family phosphatase 0.9343 144 226 GO:0050308

Map