F417526

General Info

Members Datasets Scaffolds Average Seq Length
348 172 696 434

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10001300|Ga0157369_100013003
Length 426
Sequence MLRNFSSSLLRSFCAAVAAVVLLVAPQAHAYSVLTHEQIVDLVWDDDIRPLLASRFPGLTDDQLRECHAYAYGGAVIHDVGYYPFGSHQFSDLVHYVRSGDFVLALIRSAQTADEYCFALGSLAHYVSDVNGHPAVNESVADLYPKLRQKFGSHVTYWQNKAAHLKTEFGFDVAQVAKQRYTSDTYHNFIGFEISKPLLERVFPQVYGIEFKDAMAKEDLAIGTFRWSVSSVIPKMTKVAWATHKDEITKDRPDMAERVFLYHLSRAEYNKSWGNQYQRPGVGSRILAFFFRLLPKIGPLRALALRPPTPQTEDLYFKSVDATVANYKQLLHALRARAPLDLPNRDFDTGRDTRYSEYPLTDSTYSDLTVSLAKDNFQRTTPELRNNILQFYSAAAAPKAVGKHAADLPDALQKLRAWTPTATAKQ

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
78 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
79 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10001300 3300013105 Bacteria 31037
2 LJNas_1000115 3300000546 Bacteria 12468
3 rootH1_10246689 3300003323 Bacteria 2246
4 Ga0070658_10009563 3300005327 Bacteria 7783
5 Ga0070658_10027894 3300005327 Bacteria 4531
6 Ga0070683_100001966 3300005329 Bacteria 16104
7 Ga0070683_100036898 3300005329 Bacteria 4472
8 Ga0070683_100062325 3300005329 Bacteria 3468
9 Ga0070683_100062666 3300005329 Bacteria 3457
10 Ga0070670_100016145 3300005331 Bacteria 6409
11 Ga0070670_100033812 3300005331 Bacteria 4402
12 Ga0068869_100010764 3300005334 Bacteria 5975
13 Ga0068869_100132336 3300005334 Unclassified 1918
14 Ga0068868_100000004 3300005338 Bacteria 150718
15 Ga0068868_100015771 3300005338 Bacteria 5597
16 Ga0070661_100048576 3300005344 Bacteria 3106
17 Ga0070675_100036055 3300005354 Bacteria 4023
18 Ga0070671_100009039 3300005355 Bacteria 7995
19 Ga0070671_100057668 3300005355 Bacteria 3232
20 Ga0070673_100036293 3300005364 Bacteria 3745
21 Ga0070667_100001557 3300005367 Bacteria 20558
22 Ga0070667_100054028 3300005367 Bacteria 3391
23 Ga0070709_10009624 3300005434 Bacteria 5337
24 Ga0070709_10026029 3300005434 Bacteria 3462
25 Ga0070709_10096724 3300005434 Bacteria 1958
26 Ga0070709_10136494 3300005434 Bacteria 1680
27 Ga0070714_100000063 3300005435 Bacteria 98109
28 Ga0070714_100005440 3300005435 Bacteria 9721
29 Ga0070714_100040037 3300005435 Unclassified 3950
30 Ga0070714_100055479 3300005435 Unclassified 3386
31 Ga0070714_100131965 3300005435 Bacteria 2233
32 Ga0070714_100187466 3300005435 Bacteria 1885
33 Ga0070713_100009691 3300005436 Bacteria 6916
34 Ga0070713_100016102 3300005436 Bacteria 5615
35 Ga0070713_100038269 3300005436 Bacteria 3885
36 Ga0070713_100061670 3300005436 Bacteria 3138
37 Ga0070713_100214123 3300005436 Unclassified 1745
38 Ga0070710_10039734 3300005437 Bacteria 2590
39 Ga0070710_10083921 3300005437 Bacteria 1865
40 Ga0070711_100007544 3300005439 Bacteria 6620
41 Ga0070711_100008025 3300005439 Bacteria 6444
42 Ga0070711_100014677 3300005439 Unclassified 4940
43 Ga0070711_100058853 3300005439 Bacteria 2666
44 Ga0070711_100101555 3300005439 Bacteria 2093
45 Ga0070708_100000372 3300005445 Bacteria 33949
46 Ga0070708_100029587 3300005445 Bacteria 4725
47 Ga0070663_100046135 3300005455 Bacteria 3082
48 Ga0070662_100125754 3300005457 Bacteria 1970
49 Ga0070681_10040196 3300005458 Bacteria 4688
50 Ga0070681_10236586 3300005458 Bacteria 1740
51 Ga0070706_100058002 3300005467 Bacteria 3573
52 Ga0070707_100004550 3300005468 Bacteria 12987
53 Ga0070698_100039011 3300005471 Bacteria 4892
54 Ga0070698_100070859 3300005471 Bacteria 3497
55 Ga0070699_100005089 3300005518 Bacteria 11574
56 Ga0070699_100074083 3300005518 Bacteria 2962
57 Ga0070684_100053114 3300005535 Bacteria 3526
58 Ga0070684_100077474 3300005535 Bacteria 2936
59 Ga0070697_100000991 3300005536 Bacteria 21476
60 Ga0068853_100000352 3300005539 Bacteria 31664
61 Ga0070665_100033278 3300005548 Bacteria 5187
62 Ga0070665_100073940 3300005548 Bacteria 3414
63 Ga0068855_100004740 3300005563 Bacteria 16602
64 Ga0068855_100008075 3300005563 Bacteria 12719
65 Ga0068855_100011354 3300005563 Bacteria 10754
66 Ga0068855_100109760 3300005563 Bacteria 3167
67 Ga0070664_100034331 3300005564 Bacteria 4254
68 Ga0068857_100016086 3300005577 Bacteria 6554
69 Ga0068857_100127007 3300005577 Bacteria 2298
70 Ga0068856_100002264 3300005614 Bacteria 19865
71 Ga0068856_100019811 3300005614 Bacteria 6531
72 Ga0068856_100049077 3300005614 Bacteria 4160
73 Ga0068856_100102988 3300005614 Bacteria 2848
74 Ga0068856_100245808 3300005614 Unclassified 1804
75 Ga0068852_100000048 3300005616 Bacteria 87297
76 Ga0068852_100002815 3300005616 Bacteria 12055
77 Ga0068852_100083754 3300005616 Bacteria 2836
78 Ga0068859_100065669 3300005617 Bacteria 3662
79 Ga0068859_100164464 3300005617 Bacteria 2298
80 Ga0068864_100015566 3300005618 Bacteria 6326
81 Ga0068864_100039067 3300005618 Bacteria 4055
82 Ga0068863_100001631 3300005841 Bacteria 22176
83 Ga0068858_100024639 3300005842 Bacteria 5605
84 Ga0068860_100000069 3300005843 Bacteria 179064
85 Ga0068860_100063080 3300005843 Bacteria 3520
86 Ga0068862_100009227 3300005844 Bacteria 8170
87 Ga0070717_10016687 3300006028 Bacteria 5699
88 Ga0070717_10023078 3300006028 Bacteria 4924
89 Ga0070717_10030922 3300006028 Bacteria 4303
90 Ga0070717_10037885 3300006028 Unclassified 3917
91 Ga0070717_10056143 3300006028 Unclassified 3252
92 Ga0070717_10080818 3300006028 Bacteria 2728
93 Ga0070715_10046198 3300006163 Bacteria 1850
94 Ga0070716_100000211 3300006173 Bacteria 23246
95 Ga0070716_100021321 3300006173 Unclassified 3412
96 Ga0070712_100000888 3300006175 Bacteria 17906
97 Ga0070712_100001106 3300006175 Bacteria 16233
98 Ga0070712_100002323 3300006175 Bacteria 11710
99 Ga0070712_100005266 3300006175 Bacteria 8002
100 Ga0070712_100017225 3300006175 Bacteria 4675
101 Ga0070712_100204248 3300006175 Unclassified 1554
102 Ga0097621_100013543 3300006237 Bacteria 6080
103 Ga0097621_100064707 3300006237 Bacteria 3008
104 Ga0068871_100002247 3300006358 Bacteria 13129
105 Ga0068871_100157145 3300006358 Bacteria 1942
106 Ga0075436_100001105 3300006914 Bacteria 18215
107 Ga0075436_100127506 3300006914 Bacteria 1783
108 Ga0097620_100065671 3300006931 Bacteria 3662
109 Ga0097620_100164470 3300006931 Bacteria 2298
110 Ga0075435_100074157 3300007076 Bacteria 2783
111 Ga0105240_10000084 3300009093 Bacteria 192787
112 Ga0105240_10004442 3300009093 Bacteria 21388
113 Ga0105240_10008224 3300009093 Bacteria 14951
114 Ga0105240_10012355 3300009093 Bacteria 11792
115 Ga0105240_10014229 3300009093 Bacteria 10868
116 Ga0105240_10018649 3300009093 Bacteria 9301
117 Ga0105245_10001510 3300009098 Bacteria 21074
118 Ga0105245_10021036 3300009098 Bacteria 5723
119 Ga0105245_10045540 3300009098 Bacteria 3918
120 Ga0105247_10077609 3300009101 Bacteria 2088
121 Ga0105241_10000275 3300009174 Bacteria 38432
122 Ga0105241_10001118 3300009174 Bacteria 20426
123 Ga0105241_10001760 3300009174 Bacteria 16425
124 Ga0105241_10017310 3300009174 Bacteria 5293
125 Ga0105241_10036182 3300009174 Bacteria 3715
126 Ga0105241_10037200 3300009174 Bacteria 3666
127 Ga0105242_10136593 3300009176 Unclassified 2123
128 Ga0105248_10001008 3300009177 Bacteria 31117
129 Ga0105248_10021549 3300009177 Bacteria 7138
130 Ga0105237_10004032 3300009545 Bacteria 17158
131 Ga0105237_10010800 3300009545 Bacteria 9692
132 Ga0105237_10264926 3300009545 Bacteria 1721
133 Ga0105238_10000160 3300009551 Bacteria 73564
134 Ga0105238_10003910 3300009551 Bacteria 14798
135 Ga0105238_10004744 3300009551 Bacteria 13447
136 Ga0105238_10017512 3300009551 Bacteria 7285
137 Ga0105238_10065551 3300009551 Bacteria 3633
138 Ga0105249_10013109 3300009553 Bacteria 7316
139 Ga0105249_10263688 3300009553 Unclassified 1713
140 Ga0105239_10003397 3300010375 Bacteria 19526
141 Ga0105239_10005479 3300010375 Bacteria 14885
142 Ga0105239_10011551 3300010375 Bacteria 9850
143 Ga0105239_10023933 3300010375 Bacteria 6727
144 Ga0105239_10060699 3300010375 Bacteria 4150
145 Ga0105239_10280242 3300010375 Bacteria 1877
146 Ga0105246_10000618 3300011119 Bacteria 19835
147 Ga0157373_10157770 3300013100 Bacteria 1596
148 Ga0157371_10028677 3300013102 Bacteria 4029
149 Ga0157371_10096002 3300013102 Bacteria 2101
150 Ga0157370_10002535 3300013104 Bacteria 21958
151 Ga0157369_10000334 3300013105 Bacteria 62941
152 Ga0157369_10003357 3300013105 Bacteria 19001
153 Ga0157369_10005393 3300013105 Bacteria 14884
154 Ga0157369_10035408 3300013105 Bacteria 5474
155 Ga0157369_10036445 3300013105 Bacteria 5388
156 Ga0157369_10137899 3300013105 Bacteria 2582
157 Ga0157374_10000612 3300013296 Bacteria 31607
158 Ga0157374_10020568 3300013296 Bacteria 5858
159 Ga0157374_10142728 3300013296 Bacteria 2325
160 Ga0157378_10001453 3300013297 Bacteria 21351
161 Ga0157378_10010379 3300013297 Bacteria 8131
162 Ga0157378_10103711 3300013297 Bacteria 2599
163 Ga0157378_10133840 3300013297 Bacteria 2297
164 Ga0163162_10063703 3300013306 Bacteria 3730
165 Ga0163162_10183971 3300013306 Archaea 2216
166 Ga0157372_10000092 3300013307 Bacteria 93247
167 Ga0157372_10003312 3300013307 Bacteria 17402
168 Ga0157372_10003477 3300013307 Bacteria 16976
169 Ga0157372_10013298 3300013307 Bacteria 8786
170 Ga0157372_10034949 3300013307 Bacteria 5531
171 Ga0157372_10062948 3300013307 Bacteria 4158
172 Ga0157372_10065329 3300013307 Bacteria 4085
173 Ga0157372_10070370 3300013307 Bacteria 3936
174 Ga0157372_10299546 3300013307 Bacteria 1870
175 Ga0157375_10002806 3300013308 Bacteria 15079
176 Ga0163163_10001715 3300014325 Bacteria 18487
177 Ga0157379_10002856 3300014968 Bacteria 14562
178 Ga0157379_10097315 3300014968 Bacteria 2642
179 Ga0157376_10000498 3300014969 Bacteria 25370
180 Ga0163161_10019141 3300017792 Bacteria 4800
181 Ga0206352_10104120 3300020078 Bacteria 1810
182 Ga0206350_11554954 3300020080 Unclassified 1799
183 Ga0224712_10036674 3300022467 Unclassified 1819
184 Ga0224571_100181 3300022734 Unclassified 2944
185 Ga0224572_1000436 3300024225 Bacteria 4839
186 Ga0228598_1002029 3300024227 Unclassified 4421
187 Ga0228598_1002039 3300024227 Bacteria 4409
188 Ga0207656_10057669 3300025321 Bacteria 1694
189 Ga0207692_10029840 3300025898 Bacteria 2596
190 Ga0207710_10000839 3300025900 Bacteria 16567
191 Ga0207710_10039320 3300025900 Bacteria 2093
192 Ga0207647_10031821 3300025904 Bacteria 3393
193 Ga0207647_10053518 3300025904 Unclassified 2487
194 Ga0207699_10005684 3300025906 Bacteria 5991
195 Ga0207699_10023692 3300025906 Bacteria 3344
196 Ga0207699_10026278 3300025906 Bacteria 3206
197 Ga0207705_10011480 3300025909 Bacteria 6407
198 Ga0207705_10199415 3300025909 Bacteria 1516
199 Ga0207684_10000343 3300025910 Bacteria 64775
200 Ga0207654_10000024 3300025911 Bacteria 147501
201 Ga0207654_10000122 3300025911 Bacteria 50286
202 Ga0207654_10000336 3300025911 Bacteria 28255
203 Ga0207654_10019262 3300025911 Bacteria 3599
204 Ga0207654_10072929 3300025911 Bacteria 2045
205 Ga0207707_10038889 3300025912 Bacteria 4158
206 Ga0207695_10000115 3300025913 Bacteria 240394
207 Ga0207695_10000145 3300025913 Bacteria 209555
208 Ga0207695_10002097 3300025913 Bacteria 30292
209 Ga0207695_10007181 3300025913 Bacteria 14246
210 Ga0207695_10008853 3300025913 Bacteria 12533
211 Ga0207695_10034879 3300025913 Bacteria 5464
212 Ga0207695_10067142 3300025913 Bacteria 3680
213 Ga0207695_10078853 3300025913 Bacteria 3340
214 Ga0207695_10145759 3300025913 Bacteria 2312
215 Ga0207671_10000032 3300025914 Bacteria 245878
216 Ga0207671_10001127 3300025914 Bacteria 32172
217 Ga0207693_10000323 3300025915 Bacteria 44246
218 Ga0207693_10006340 3300025915 Bacteria 9806
219 Ga0207693_10006754 3300025915 Bacteria 9473
220 Ga0207693_10018152 3300025915 Bacteria 5606
221 Ga0207693_10085064 3300025915 Bacteria 2478
222 Ga0207693_10202605 3300025915 Unclassified 1560
223 Ga0207663_10078213 3300025916 Bacteria 2156
224 Ga0207663_10115832 3300025916 Bacteria 1826
225 Ga0207657_10011646 3300025919 Bacteria 8720
226 Ga0207649_10036208 3300025920 Bacteria 2971
227 Ga0207646_10000566 3300025922 Bacteria 48722
228 Ga0207694_10000029 3300025924 Bacteria 239107
229 Ga0207694_10001570 3300025924 Bacteria 19333
230 Ga0207694_10011816 3300025924 Bacteria 6586
231 Ga0207694_10089967 3300025924 Bacteria 2421
232 Ga0207650_10019353 3300025925 Bacteria 4782
233 Ga0207650_10087785 3300025925 Bacteria 2370
234 Ga0207687_10001035 3300025927 Bacteria 18903
235 Ga0207687_10030036 3300025927 Bacteria 3661
236 Ga0207700_10002428 3300025928 Bacteria 10696
237 Ga0207700_10006441 3300025928 Bacteria 7089
238 Ga0207700_10036183 3300025928 Unclassified 3563
239 Ga0207664_10000031 3300025929 Bacteria 179373
240 Ga0207664_10038429 3300025929 Unclassified 3711
241 Ga0207664_10138087 3300025929 Bacteria 2059
242 Ga0207664_10143009 3300025929 Bacteria 2026
243 Ga0207644_10031363 3300025931 Bacteria 3702
244 Ga0207706_10003714 3300025933 Bacteria 14563
245 Ga0207706_10094749 3300025933 Bacteria 2626
246 Ga0207665_10000608 3300025939 Bacteria 24075
247 Ga0207691_10005340 3300025940 Bacteria 12402
248 Ga0207711_10008206 3300025941 Bacteria 8740
249 Ga0207711_10035365 3300025941 Bacteria 4234
250 Ga0207711_10114247 3300025941 Bacteria 2404
251 Ga0207689_10002718 3300025942 Bacteria 16358
252 Ga0207661_10001150 3300025944 Bacteria 17677
253 Ga0207661_10049443 3300025944 Bacteria 3347
254 Ga0207667_10004567 3300025949 Bacteria 16975
255 Ga0207667_10012641 3300025949 Bacteria 9702
256 Ga0207667_10077021 3300025949 Bacteria 3459
257 Ga0207712_10048569 3300025961 Bacteria 2952
258 Ga0207640_10004400 3300025981 Bacteria 7637
259 Ga0207658_10001341 3300025986 Bacteria 19263
260 Ga0207677_10000023 3300026023 Bacteria 128514
261 Ga0207677_10005092 3300026023 Bacteria 7106
262 Ga0207703_10051075 3300026035 Bacteria 3349
263 Ga0207639_10000333 3300026041 Bacteria 32744
264 Ga0207639_10021817 3300026041 Bacteria 4604
265 Ga0207639_10029608 3300026041 Bacteria 4010
266 Ga0207702_10001243 3300026078 Bacteria 25735
267 Ga0207702_10006975 3300026078 Bacteria 9670
268 Ga0207702_10059076 3300026078 Bacteria 3265
269 Ga0207702_10060740 3300026078 Unclassified 3222
270 Ga0207702_10101630 3300026078 Bacteria 2539
271 Ga0207702_10104606 3300026078 Bacteria 2505
272 Ga0207641_10000283 3300026088 Bacteria 63661
273 Ga0207674_10004294 3300026116 Bacteria 17187
274 Ga0207674_10022394 3300026116 Bacteria 6786
275 Ga0207674_10049396 3300026116 Bacteria 4302
276 Ga0207683_10023857 3300026121 Bacteria 5262
277 Ga0207698_10000011 3300026142 Bacteria 260352
278 Ga0207698_10005902 3300026142 Bacteria 7610
279 Ga0268266_10092027 3300028379 Bacteria 2660
280 Ga0268265_10100021 3300028380 Bacteria 2339
281 Ga0268264_10000086 3300028381 Bacteria 239021
282 Ga0268264_10076656 3300028381 Unclassified 2845
283 Ga0265338_10002923 3300028800 Bacteria 24793
284 Ga0265338_10039805 3300028800 Unclassified 4426
285 Ga0265760_10012238 3300031090 Bacteria 2452
286 Ga0265339_10075349 3300031249 Bacteria 1791
287 Ga0265316_10023619 3300031344 Bacteria 5162
288 Ga0265316_10044405 3300031344 Unclassified 3535
289 Ga0265316_10079358 3300031344 Bacteria 2519
290 Ga0373934_0021111 3300035086 Bacteria 2508
291 Ga0373934_0076376 3300035086 Unclassified 1343
292 Ga0373944_0015306 3300035089 Bacteria 2152
293 Ga0373923_0041931 3300035111 Unclassified 1889
294 Ga0373936_0005986 3300035113 Unclassified 4581
295 Ga0373936_0017584 3300035113 Unclassified 2754
296 Ga0373945_0007388 3300035116 Unclassified 3562
297 Ga0373953_0024389 3300035117 Bacteria 2299
298 Ga0373943_0000032 3300035170 Bacteria 46172
299 Ga0373924_0012585 3300035410 Bacteria 3164
300 Ga0373927_0000036 3300035695 Bacteria 102847
301 Ga0373933_0099754 3300035724 Unclassified 1800
302 Ga0373947_0002171 3300035725 Bacteria 11919
303 Ga0373937_0027302 3300036401 Bacteria 5163
304 Ga0373937_0029040 3300036401 Bacteria 5008
305 Ga0373937_0046578 3300036401 Unclassified 3966
306 Ga0373937_0123747 3300036401 Bacteria 2411
307 Ga0373925_0011228 3300037068 Bacteria 6495
308 Ga0436363_0138419 3300039450 Bacteria 1470
309 Ga0451577_0002261 3300042876 Bacteria 23346
310 Ga0453683_0051886 3300044673 Bacteria 2568
311 Ga0466963_0011270 3300044694 Bacteria 5441
312 Ga0466963_0050845 3300044694 Bacteria 2744
313 Ga0453684_0001927 3300044712 Bacteria 53655
314 Ga0451576_0003390 3300045051 Bacteria 22003
315 Ga0466967_0004209 3300045976 Bacteria 9646
316 Ga0466967_0007152 3300045976 Bacteria 8013
317 Ga0466967_0035635 3300045976 Bacteria 4239
318 Ga0466967_0065248 3300045976 Bacteria 3240
319 Ga0495629_0117704 3300046459 Bacteria 1851
320 Ga0495651_0093972 3300046462 Bacteria 2245
321 Ga0495653_0159057 3300046463 Unclassified 1570
322 Ga0495580_0000600 3300046472 Bacteria 30472
323 Ga0495580_0001363 3300046472 Bacteria 21493
324 Ga0495580_0005244 3300046472 Bacteria 10770
325 Ga0495580_0020467 3300046472 Bacteria 4895
326 Ga0495582_0044381 3300046473 Bacteria 2448
327 Ga0495630_0076201 3300046517 Unclassified 2527
328 Ga0495587_0060398 3300046536 Bacteria 2223
329 Ga0495645_0074288 3300046543 Bacteria 2449
330 Ga0495635_0045120 3300046663 Bacteria 3041
331 Ga0495658_0086305 3300046683 Bacteria 1851
332 Ga0495613_0020874 3300046689 Bacteria 4883
333 Ga0495604_0172087 3300047317 Bacteria 1522
334 Ga0495674_0088551 3300047319 Unclassified 2647
335 Ga0495674_0104286 3300047319 Unclassified 2410
336 Ga0495684_0149658 3300047471 Unclassified 1746
337 Ga0495602_0147850 3300048088 Unclassified 1851
338 Ga0496101_0014244 3300048904 Bacteria 5343
339 Ga0496103_0022470 3300048906 Bacteria 3799
340 Ga0496104_0061054 3300048907 Bacteria 3572
341 Ga0496106_0101128 3300048909 Bacteria 2236
342 Ga0496110_0046531 3300048913 Bacteria 3796
343 Ga0496112_0045310 3300048915 Bacteria 4311
344 Ga0496113_0021609 3300048916 Bacteria 4541
345 Ga0496115_0013083 3300048918 Bacteria 6266
346 nmdc:mga08x19_6509_c1 3300050514 Bacteria 6919
347 Ga0495601_0005235 3300053077 Bacteria 7545
348 Ga0587073_0005373 3300059492 Bacteria 1905
349 Ga0157369_10001300
350 LJNas_1000115
351 rootH1_10246689
352 Ga0070658_10009563
353 Ga0070658_10027894
354 Ga0070683_100001966
355 Ga0070683_100036898
356 Ga0070683_100062325
357 Ga0070683_100062666
358 Ga0070670_100016145
359 Ga0070670_100033812
360 Ga0068869_100010764
361 Ga0068869_100132336
362 Ga0068868_100000004
363 Ga0068868_100015771
364 Ga0070661_100048576
365 Ga0070675_100036055
366 Ga0070671_100009039
367 Ga0070671_100057668
368 Ga0070673_100036293
369 Ga0070667_100001557
370 Ga0070667_100054028
371 Ga0070709_10009624
372 Ga0070709_10026029
373 Ga0070709_10096724
374 Ga0070709_10136494
375 Ga0070714_100000063
376 Ga0070714_100005440
377 Ga0070714_100040037
378 Ga0070714_100055479
379 Ga0070714_100131965
380 Ga0070714_100187466
381 Ga0070713_100009691
382 Ga0070713_100016102
383 Ga0070713_100038269
384 Ga0070713_100061670
385 Ga0070713_100214123
386 Ga0070710_10039734
387 Ga0070710_10083921
388 Ga0070711_100007544
389 Ga0070711_100008025
390 Ga0070711_100014677
391 Ga0070711_100058853
392 Ga0070711_100101555
393 Ga0070708_100000372
394 Ga0070708_100029587
395 Ga0070663_100046135
396 Ga0070662_100125754
397 Ga0070681_10040196
398 Ga0070681_10236586
399 Ga0070706_100058002
400 Ga0070707_100004550
401 Ga0070698_100039011
402 Ga0070698_100070859
403 Ga0070699_100005089
404 Ga0070699_100074083
405 Ga0070684_100053114
406 Ga0070684_100077474
407 Ga0070697_100000991
408 Ga0068853_100000352
409 Ga0070665_100033278
410 Ga0070665_100073940
411 Ga0068855_100004740
412 Ga0068855_100008075
413 Ga0068855_100011354
414 Ga0068855_100109760
415 Ga0070664_100034331
416 Ga0068857_100016086
417 Ga0068857_100127007
418 Ga0068856_100002264
419 Ga0068856_100019811
420 Ga0068856_100049077
421 Ga0068856_100102988
422 Ga0068856_100245808
423 Ga0068852_100000048
424 Ga0068852_100002815
425 Ga0068852_100083754
426 Ga0068859_100065669
427 Ga0068859_100164464
428 Ga0068864_100015566
429 Ga0068864_100039067
430 Ga0068863_100001631
431 Ga0068858_100024639
432 Ga0068860_100000069
433 Ga0068860_100063080
434 Ga0068862_100009227
435 Ga0070717_10016687
436 Ga0070717_10023078
437 Ga0070717_10030922
438 Ga0070717_10037885
439 Ga0070717_10056143
440 Ga0070717_10080818
441 Ga0070715_10046198
442 Ga0070716_100000211
443 Ga0070716_100021321
444 Ga0070712_100000888
445 Ga0070712_100001106
446 Ga0070712_100002323
447 Ga0070712_100005266
448 Ga0070712_100017225
449 Ga0070712_100204248
450 Ga0097621_100013543
451 Ga0097621_100064707
452 Ga0068871_100002247
453 Ga0068871_100157145
454 Ga0075436_100001105
455 Ga0075436_100127506
456 Ga0097620_100065671
457 Ga0097620_100164470
458 Ga0075435_100074157
459 Ga0105240_10000084
460 Ga0105240_10004442
461 Ga0105240_10008224
462 Ga0105240_10012355
463 Ga0105240_10014229
464 Ga0105240_10018649
465 Ga0105245_10001510
466 Ga0105245_10021036
467 Ga0105245_10045540
468 Ga0105247_10077609
469 Ga0105241_10000275
470 Ga0105241_10001118
471 Ga0105241_10001760
472 Ga0105241_10017310
473 Ga0105241_10036182
474 Ga0105241_10037200
475 Ga0105242_10136593
476 Ga0105248_10001008
477 Ga0105248_10021549
478 Ga0105237_10004032
479 Ga0105237_10010800
480 Ga0105237_10264926
481 Ga0105238_10000160
482 Ga0105238_10003910
483 Ga0105238_10004744
484 Ga0105238_10017512
485 Ga0105238_10065551
486 Ga0105249_10013109
487 Ga0105249_10263688
488 Ga0105239_10003397
489 Ga0105239_10005479
490 Ga0105239_10011551
491 Ga0105239_10023933
492 Ga0105239_10060699
493 Ga0105239_10280242
494 Ga0105246_10000618
495 Ga0157373_10157770
496 Ga0157371_10028677
497 Ga0157371_10096002
498 Ga0157370_10002535
499 Ga0157369_10000334
500 Ga0157369_10003357
501 Ga0157369_10005393
502 Ga0157369_10035408
503 Ga0157369_10036445
504 Ga0157369_10137899
505 Ga0157374_10000612
506 Ga0157374_10020568
507 Ga0157374_10142728
508 Ga0157378_10001453
509 Ga0157378_10010379
510 Ga0157378_10103711
511 Ga0157378_10133840
512 Ga0163162_10063703
513 Ga0163162_10183971
514 Ga0157372_10000092
515 Ga0157372_10003312
516 Ga0157372_10003477
517 Ga0157372_10013298
518 Ga0157372_10034949
519 Ga0157372_10062948
520 Ga0157372_10065329
521 Ga0157372_10070370
522 Ga0157372_10299546
523 Ga0157375_10002806
524 Ga0163163_10001715
525 Ga0157379_10002856
526 Ga0157379_10097315
527 Ga0157376_10000498
528 Ga0163161_10019141
529 Ga0206352_10104120
530 Ga0206350_11554954
531 Ga0224712_10036674
532 Ga0224571_100181
533 Ga0224572_1000436
534 Ga0228598_1002029
535 Ga0228598_1002039
536 Ga0207656_10057669
537 Ga0207692_10029840
538 Ga0207710_10000839
539 Ga0207710_10039320
540 Ga0207647_10031821
541 Ga0207647_10053518
542 Ga0207699_10005684
543 Ga0207699_10023692
544 Ga0207699_10026278
545 Ga0207705_10011480
546 Ga0207705_10199415
547 Ga0207684_10000343
548 Ga0207654_10000024
549 Ga0207654_10000122
550 Ga0207654_10000336
551 Ga0207654_10019262
552 Ga0207654_10072929
553 Ga0207707_10038889
554 Ga0207695_10000115
555 Ga0207695_10000145
556 Ga0207695_10002097
557 Ga0207695_10007181
558 Ga0207695_10008853
559 Ga0207695_10034879
560 Ga0207695_10067142
561 Ga0207695_10078853
562 Ga0207695_10145759
563 Ga0207671_10000032
564 Ga0207671_10001127
565 Ga0207693_10000323
566 Ga0207693_10006340
567 Ga0207693_10006754
568 Ga0207693_10018152
569 Ga0207693_10085064
570 Ga0207693_10202605
571 Ga0207663_10078213
572 Ga0207663_10115832
573 Ga0207657_10011646
574 Ga0207649_10036208
575 Ga0207646_10000566
576 Ga0207694_10000029
577 Ga0207694_10001570
578 Ga0207694_10011816
579 Ga0207694_10089967
580 Ga0207650_10019353
581 Ga0207650_10087785
582 Ga0207687_10001035
583 Ga0207687_10030036
584 Ga0207700_10002428
585 Ga0207700_10006441
586 Ga0207700_10036183
587 Ga0207664_10000031
588 Ga0207664_10038429
589 Ga0207664_10138087
590 Ga0207664_10143009
591 Ga0207644_10031363
592 Ga0207706_10003714
593 Ga0207706_10094749
594 Ga0207665_10000608
595 Ga0207691_10005340
596 Ga0207711_10008206
597 Ga0207711_10035365
598 Ga0207711_10114247
599 Ga0207689_10002718
600 Ga0207661_10001150
601 Ga0207661_10049443
602 Ga0207667_10004567
603 Ga0207667_10012641
604 Ga0207667_10077021
605 Ga0207712_10048569
606 Ga0207640_10004400
607 Ga0207658_10001341
608 Ga0207677_10000023
609 Ga0207677_10005092
610 Ga0207703_10051075
611 Ga0207639_10000333
612 Ga0207639_10021817
613 Ga0207639_10029608
614 Ga0207702_10001243
615 Ga0207702_10006975
616 Ga0207702_10059076
617 Ga0207702_10060740
618 Ga0207702_10101630
619 Ga0207702_10104606
620 Ga0207641_10000283
621 Ga0207674_10004294
622 Ga0207674_10022394
623 Ga0207674_10049396
624 Ga0207683_10023857
625 Ga0207698_10000011
626 Ga0207698_10005902
627 Ga0268266_10092027
628 Ga0268265_10100021
629 Ga0268264_10000086
630 Ga0268264_10076656
631 Ga0265338_10002923
632 Ga0265338_10039805
633 Ga0265760_10012238
634 Ga0265339_10075349
635 Ga0265316_10023619
636 Ga0265316_10044405
637 Ga0265316_10079358
638 Ga0373934_0021111
639 Ga0373934_0076376
640 Ga0373944_0015306
641 Ga0373923_0041931
642 Ga0373936_0005986
643 Ga0373936_0017584
644 Ga0373945_0007388
645 Ga0373953_0024389
646 Ga0373943_0000032
647 Ga0373924_0012585
648 Ga0373927_0000036
649 Ga0373933_0099754
650 Ga0373947_0002171
651 Ga0373937_0027302
652 Ga0373937_0029040
653 Ga0373937_0046578
654 Ga0373937_0123747
655 Ga0373925_0011228
656 Ga0436363_0138419
657 Ga0451577_0002261
658 Ga0453683_0051886
659 Ga0466963_0011270
660 Ga0466963_0050845
661 Ga0453684_0001927
662 Ga0451576_0003390
663 Ga0466967_0004209
664 Ga0466967_0007152
665 Ga0466967_0035635
666 Ga0466967_0065248
667 Ga0495629_0117704
668 Ga0495651_0093972
669 Ga0495653_0159057
670 Ga0495580_0000600
671 Ga0495580_0001363
672 Ga0495580_0005244
673 Ga0495580_0020467
674 Ga0495582_0044381
675 Ga0495630_0076201
676 Ga0495587_0060398
677 Ga0495645_0074288
678 Ga0495635_0045120
679 Ga0495658_0086305
680 Ga0495613_0020874
681 Ga0495604_0172087
682 Ga0495674_0088551
683 Ga0495674_0104286
684 Ga0495684_0149658
685 Ga0495602_0147850
686 Ga0496101_0014244
687 Ga0496103_0022470
688 Ga0496104_0061054
689 Ga0496106_0101128
690 Ga0496110_0046531
691 Ga0496112_0045310
692 Ga0496113_0021609
693 Ga0496115_0013083
694 nmdc:mga08x19_6509_c1
695 Ga0495601_0005235
696 Ga0587073_0005373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00882

Zn_dep_PLPC

Zinc dependent phospholipase C

35

217

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wy6-assembly3.cif.gz_C clostridium perfringens alpha-toxin strain nctc8237 mutant t74i 0.2712 28 339
8wa5-assembly1.cif.gz_A cryo-em structure of the gastric proton pump y799w/e936q mutant in k+-occluded (k+)e2-alf state 0.244 64 334
6jxh-assembly1.cif.gz_A k+-bound e2-mgf state of the gastric proton pump (tyr799trp) 0.2402 64 334
7d93-assembly2.cif.gz_C crystal structure of the na+,k+-atpase in the e2p state with bound mg2+ and anthroylouabain (p2(1)2(1)2(1) symmetry) 0.2394 64 338
2wy6-assembly1.cif.gz_A clostridium perfringens alpha-toxin strain nctc8237 mutant t74i 0.2353 28 340
ID Description Score Start End Superfamily
4nt1A00 Mainly Alpha;Orthogonal Bundle;Glycolipid transfer protein, GLTP;Glycolipid transfer protein 0.26 129 340 1.10.3520.10
af_A4I2I3_1_277_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.2488 103 336 1.10.472.10
4nt1A00 Mainly Alpha;Orthogonal Bundle;Glycolipid transfer protein, GLTP;Glycolipid transfer protein 0.2488 129 340 1.10.3520.10
af_Q9VPD9_294_503_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2412 35 292 1.20.1250.20
af_Q19845_46_476_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2379 34 337 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A838TRU8-F1-model_v4 Zinc dependent phospholipase C family protein 0.9599 32 218
AF-A0A2V8USC5-F1-model_v4 Phospholipase C/D domain-containing protein 0.9421 33 206
AF-A0A2V9VWT8-F1-model_v4 Phospholipase C/D domain-containing protein 0.9273 26 356
AF-A0A2V9ZJ78-F1-model_v4 Phospholipase C/D domain-containing protein 0.9264 10 420
AF-A0A1I6M301-F1-model_v4 Zinc dependent phospholipase C 0.9145 16 425

Map