F417492

General Info

Members Datasets Scaffolds Average Seq Length
348 215 348 466

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100021950|Ga0075431_1000219506
Length 511
Sequence VTSEALELTAAEAVRRIETGELSADEYSDAWAQAAGGDELNAFLWRADPEQPPVIAAAGPAADAQLRGVPIAVKDLFCTEDIETTAGSRILEGYRPPYTATAVRRLGEAGALLLGKTNMDEFAMGSSNENSGYGPVLNPWDRGRVPGGSSXXXXAAVAGRLAPCAIGTDTGGSIRQPASLCGIVGLKPTYGAISRFGMVAFASSLDQCGPLTRDVTDAALLLRAMEGHDRRDSTSVGVEGGVELPSREDLAGLRIGVARDFSHHAEGVEPGVAETFERSLRTIEALGATIEEIELPHAEHGISAYYVLAPAEASANLARYDGVRYGLRVNGDRDLITMYERTRARGFGPEVKRRIMLGTYALSSGYYEAYYGSAQKVRTLIAGDFDRAFTACDLIVTPTSPSVAFELGARTADPLAMYLSDYFTVPMSLAGIPAISIPAGLAEPPEGGTPLPVGLQLTAPAFAESRLLDAAYALERSLEPLPAASSQGASATGDPAEGRIPPGAAGSGGGT

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 12.07
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007423 3300001979 Bacteria 4459
2 JGI24034J26672_10000331 3300002239 Bacteria 6067
3 JGI24751J29686_10008535 3300002459 Bacteria 2096
4 Ga0070683_100001932 3300005329 Bacteria 16227
5 Ga0070683_100002878 3300005329 Bacteria 13789
6 Ga0070677_10000175 3300005333 Bacteria 22197
7 Ga0070682_100000030 3300005337 Bacteria 182768
8 Ga0070682_100000171 3300005337 Bacteria 48470
9 Ga0070682_100084223 3300005337 Bacteria 2065
10 Ga0068868_100000225 3300005338 Bacteria 38457
11 Ga0068868_100173367 3300005338 Bacteria 1786
12 Ga0070689_100029093 3300005340 Bacteria 4179
13 Ga0070691_10000018 3300005341 Bacteria 47284
14 Ga0070668_100013523 3300005347 Bacteria 6092
15 Ga0070668_100070846 3300005347 Bacteria 2715
16 Ga0070674_100000004 3300005356 Bacteria 169446
17 Ga0070673_100004352 3300005364 Bacteria 8943
18 Ga0070667_100038217 3300005367 Bacteria 4025
19 Ga0070714_100020891 3300005435 Bacteria 5352
20 Ga0070713_100000010 3300005436 Bacteria 151790
21 Ga0070711_100076175 3300005439 Bacteria 2378
22 Ga0070700_100023575 3300005441 Bacteria 3601
23 Ga0070700_100119308 3300005441 Bacteria 1765
24 Ga0070663_100003388 3300005455 Bacteria 9204
25 Ga0070662_100000006 3300005457 Bacteria 169366
26 Ga0068867_100000295 3300005459 Bacteria 32708
27 Ga0070679_100001408 3300005530 Bacteria 21242
28 Ga0070684_100004687 3300005535 Bacteria 10439
29 Ga0070684_100267123 3300005535 Bacteria 1566
30 Ga0070697_100017434 3300005536 Bacteria 5650
31 Ga0068853_100063506 3300005539 Bacteria 3199
32 Ga0068853_100162094 3300005539 Bacteria 2019
33 Ga0070693_100001071 3300005547 Bacteria 12233
34 Ga0070665_100000040 3300005548 Bacteria 305480
35 Ga0070665_100168574 3300005548 Bacteria 2191
36 Ga0070665_100177538 3300005548 Bacteria 2130
37 Ga0070704_100094673 3300005549 Bacteria 2235
38 Ga0068857_100005021 3300005577 Bacteria 11246
39 Ga0068854_100000237 3300005578 Bacteria 37524
40 Ga0068856_100009805 3300005614 Bacteria 9304
41 Ga0068856_100017100 3300005614 Bacteria 7031
42 Ga0068866_10000004 3300005718 Bacteria 202810
43 Ga0068863_100002902 3300005841 Bacteria 16986
44 Ga0068858_100000319 3300005842 Bacteria 51080
45 Ga0068860_100194274 3300005843 Bacteria 1965
46 Ga0081455_10028289 3300005937 Bacteria 5123
47 Ga0081455_10033529 3300005937 Bacteria 4612
48 Ga0081455_10037050 3300005937 Bacteria 4335
49 Ga0081455_10068451 3300005937 Bacteria 2955
50 Ga0081538_10001207 3300005981 Bacteria 27113
51 Ga0081538_10008465 3300005981 Bacteria 8723
52 Ga0081538_10015434 3300005981 Bacteria 5910
53 Ga0081540_1001324 3300005983 Bacteria 21610
54 Ga0081539_10003034 3300005985 Bacteria 21758
55 Ga0070715_10000014 3300006163 Bacteria 154272
56 Ga0075367_10029936 3300006178 Bacteria 3118
57 Ga0075431_100021950 3300006847 Bacteria 6527
58 Ga0075433_10001600 3300006852 Bacteria 16782
59 Ga0068865_100000140 3300006881 Bacteria 38055
60 Ga0075435_100234906 3300007076 Unclassified 1558
61 Ga0111539_10010170 3300009094 Bacteria 11856
62 Ga0105245_10000212 3300009098 Bacteria 55133
63 Ga0105245_10001289 3300009098 Bacteria 22604
64 Ga0105245_10002024 3300009098 Bacteria 18381
65 Ga0105247_10000955 3300009101 Bacteria 21799
66 Ga0114129_10155678 3300009147 Bacteria 3125
67 Ga0114129_10247777 3300009147 Bacteria 2393
68 Ga0105242_10000085 3300009176 Bacteria 64353
69 Ga0105238_10000048 3300009551 Bacteria 146322
70 Ga0105249_10000070 3300009553 Bacteria 147277
71 Ga0105249_10002695 3300009553 Bacteria 15354
72 Ga0157374_10000686 3300013296 Bacteria 29832
73 Ga0157375_10000130 3300013308 Bacteria 74968
74 Ga0157375_10007080 3300013308 Bacteria 9796
75 Ga0157380_10000149 3300014326 Bacteria 39858
76 Ga0157380_10000261 3300014326 Bacteria 31504
77 Ga0157379_10052889 3300014968 Bacteria 3628
78 Ga0163161_10000160 3300017792 Bacteria 62228
79 Ga0207656_10000393 3300025321 Bacteria 14719
80 Ga0207682_10000251 3300025893 Bacteria 24229
81 Ga0207642_10000005 3300025899 Bacteria 401934
82 Ga0207680_10023499 3300025903 Bacteria 3368
83 Ga0207685_10000025 3300025905 Bacteria 110358
84 Ga0207663_10044925 3300025916 Bacteria 2714
85 Ga0207663_10066105 3300025916 Bacteria 2314
86 Ga0207652_10000720 3300025921 Bacteria 32059
87 Ga0207694_10000056 3300025924 Bacteria 146908
88 Ga0207687_10000020 3300025927 Bacteria 228407
89 Ga0207700_10000007 3300025928 Bacteria 345720
90 Ga0207664_10002611 3300025929 Bacteria 11928
91 Ga0207706_10000017 3300025933 Bacteria 169589
92 Ga0207706_10002564 3300025933 Bacteria 17721
93 Ga0207686_10000982 3300025934 Bacteria 16986
94 Ga0207669_10000195 3300025937 Bacteria 27661
95 Ga0207704_10000360 3300025938 Bacteria 21224
96 Ga0207661_10001110 3300025944 Bacteria 17909
97 Ga0207661_10001317 3300025944 Bacteria 16619
98 Ga0207661_10015947 3300025944 Bacteria 5537
99 Ga0207679_10029980 3300025945 Bacteria 3794
100 Ga0207651_10001317 3300025960 Bacteria 11208
101 Ga0207712_10000019 3300025961 Bacteria 317060
102 Ga0207668_10034008 3300025972 Bacteria 3381
103 Ga0207640_10000248 3300025981 Bacteria 36585
104 Ga0207658_10002010 3300025986 Bacteria 15166
105 Ga0207677_10000508 3300026023 Bacteria 25092
106 Ga0207703_10000166 3300026035 Bacteria 76553
107 Ga0207703_10037640 3300026035 Bacteria 3854
108 Ga0207639_10020577 3300026041 Bacteria 4725
109 Ga0207639_10181785 3300026041 Bacteria 1789
110 Ga0207678_10006876 3300026067 Bacteria 10090
111 Ga0207708_10024612 3300026075 Bacteria 4553
112 Ga0207708_10038848 3300026075 Bacteria 3626
113 Ga0207702_10010962 3300026078 Bacteria 7561
114 Ga0207641_10126367 3300026088 Bacteria 2290
115 Ga0207641_10130179 3300026088 Bacteria 2258
116 Ga0207648_10029844 3300026089 Bacteria 4836
117 Ga0207674_10043551 3300026116 Bacteria 4628
118 Ga0268266_10000045 3300028379 Bacteria 312955
119 Ga0268266_10001339 3300028379 Bacteria 29819
120 Ga0268266_10003814 3300028379 Bacteria 14745
121 Ga0268266_10024298 3300028379 Bacteria 5156
122 Ga0268264_10019164 3300028381 Bacteria 5592
123 Ga0265337_1000287 3300028556 Bacteria 27334
124 Ga0265319_1000110 3300028563 Bacteria 63277
125 Ga0265322_10000020 3300028654 Bacteria 108805
126 Ga0265338_10000578 3300028800 Bacteria 64450
127 Ga0265324_10000360 3300029957 Bacteria 33003
128 Ga0265320_10000035 3300031240 Bacteria 137855
129 Ga0265331_10003207 3300031250 Bacteria 10668
130 Ga0265331_10040277 3300031250 Bacteria 2274
131 Ga0265327_10000015 3300031251 Bacteria 496677
132 Ga0265316_10013674 3300031344 Bacteria 7198
133 Ga0265314_10002307 3300031711 Bacteria 19713
134 Ga0307409_100047860 3300031995 Bacteria 3250
135 Ga0307415_100037574 3300032126 Bacteria 3184
136 Ga0373952_0010763 3300035092 Bacteria 1773
137 Ga0373937_0005520 3300036401 Bacteria 10841
138 Ga0395899_0005066 3300037312 Bacteria 10251
139 Ga0395899_0012057 3300037312 Bacteria 6622
140 Ga0395899_0063095 3300037312 Bacteria 2727
141 Ga0395900_0033119 3300037418 Bacteria 5318
142 Ga0395900_0059586 3300037418 Bacteria 3930
143 Ga0395900_0068972 3300037418 Bacteria 3634
144 Ga0395898_0093415 3300037466 Bacteria 2891
145 Ga0395898_0133340 3300037466 Bacteria 2379
146 Ga0395898_0291671 3300037466 Bacteria 1556
147 Ga0395905_0057484 3300037471 Bacteria 3638
148 Ga0436364_0253679 3300037853 Bacteria 41160
149 Ga0395901_0010297 3300038443 Bacteria 9470
150 Ga0395901_0033486 3300038443 Bacteria 5304
151 Ga0436365_0142551 3300039437 Bacteria 55439
152 Ga0436365_0295376 3300039437 Bacteria 2686
153 Ga0436363_1236543 3300039450 Bacteria 9949
154 Ga0466965_0033095 3300044683 Bacteria 2526
155 Ga0466966_0053279 3300044684 Bacteria 2567
156 Ga0466966_0063301 3300044684 Bacteria 2331
157 Ga0466963_0002237 3300044694 Bacteria 10729
158 Ga0466963_0046059 3300044694 Bacteria 2874
159 Ga0466963_0111235 3300044694 Bacteria 1880
160 Ga0466963_0144090 3300044694 Bacteria 1652
161 Ga0466957_0012584 3300044842 Bacteria 4898
162 Ga0466959_0015633 3300045049 Bacteria 5534
163 Ga0466958_0018847 3300045836 Bacteria 4010
164 Ga0466958_0053657 3300045836 Bacteria 2444
165 Ga0466958_0112912 3300045836 Bacteria 1697
166 Ga0466967_0000017 3300045976 Bacteria 89904
167 Ga0466967_0159473 3300045976 Bacteria 2116
168 Ga0466967_0273000 3300045976 Bacteria 1620
169 Ga0495592_0000318 3300046454 Bacteria 40338
170 Ga0495603_0001286 3300046455 Bacteria 14630
171 Ga0495603_0017853 3300046455 Bacteria 4294
172 Ga0495629_0000691 3300046459 Bacteria 27311
173 Ga0495629_0004043 3300046459 Bacteria 11026
174 Ga0495629_0092704 3300046459 Bacteria 2108
175 Ga0495641_0052533 3300046461 Bacteria 1857
176 Ga0495641_0052988 3300046461 Bacteria 1847
177 Ga0495651_0007905 3300046462 Bacteria 8148
178 Ga0495651_0057145 3300046462 Bacteria 2996
179 Ga0495653_0088009 3300046463 Bacteria 2280
180 Ga0495582_0000001 3300046473 Bacteria 252434
181 Ga0495662_0000137 3300046476 Bacteria 28083
182 Ga0495662_0008107 3300046476 Bacteria 5175
183 Ga0495662_0036518 3300046476 Bacteria 2371
184 Ga0495664_0025547 3300046477 Bacteria 3439
185 Ga0495606_0000108 3300046507 Bacteria 140473
186 Ga0495608_0000036 3300046511 Bacteria 129609
187 Ga0495618_0000126 3300046514 Bacteria 55293
188 Ga0495620_0000797 3300046515 Bacteria 19341
189 Ga0495628_0001454 3300046516 Bacteria 21724
190 Ga0495628_0001544 3300046516 Bacteria 21069
191 Ga0495628_0034597 3300046516 Bacteria 4063
192 Ga0495628_0039034 3300046516 Bacteria 3799
193 Ga0495628_0046700 3300046516 Bacteria 3439
194 Ga0495628_0098048 3300046516 Bacteria 2264
195 Ga0495628_0106957 3300046516 Bacteria 2154
196 Ga0495630_0000012 3300046517 Bacteria 223330
197 Ga0495630_0000175 3300046517 Bacteria 49924
198 Ga0495630_0000555 3300046517 Bacteria 27256
199 Ga0495630_0012385 3300046517 Bacteria 6192
200 Ga0495644_0001144 3300046523 Bacteria 10893
201 Ga0495652_0001413 3300046529 Bacteria 26631
202 Ga0495652_0040825 3300046529 Bacteria 4010
203 Ga0495640_0009053 3300046533 Bacteria 7768
204 Ga0495586_0000436 3300046535 Bacteria 25071
205 Ga0495587_0002109 3300046536 Bacteria 13290
206 Ga0495587_0117183 3300046536 Bacteria 1527
207 Ga0495645_0111591 3300046543 Bacteria 1934
208 Ga0495645_0118791 3300046543 Bacteria 1863
209 Ga0495667_0000034 3300046559 Bacteria 141464
210 Ga0495667_0006422 3300046559 Bacteria 7976
211 Ga0495667_0027204 3300046559 Bacteria 3855
212 Ga0495656_0000557 3300046615 Bacteria 12182
213 Ga0495668_0031200 3300046616 Bacteria 3004
214 Ga0495634_0000028 3300046642 Bacteria 114075
215 Ga0495634_0002025 3300046642 Bacteria 17228
216 Ga0495634_0022055 3300046642 Bacteria 4489
217 Ga0495625_0000506 3300046660 Bacteria 57832
218 Ga0495635_0000005 3300046663 Bacteria 302178
219 Ga0495588_0000149 3300046674 Bacteria 100598
220 Ga0495657_0000001 3300046675 Bacteria 445641
221 Ga0495657_0002724 3300046675 Bacteria 14752
222 Ga0495599_0018699 3300046678 Bacteria 4318
223 Ga0495599_0058327 3300046678 Bacteria 2415
224 Ga0495647_0000009 3300046681 Bacteria 94874
225 Ga0495647_0003520 3300046681 Bacteria 5013
226 Ga0495647_0003571 3300046681 Bacteria 4986
227 Ga0495658_0000306 3300046683 Bacteria 27840
228 Ga0495669_0000102 3300046684 Bacteria 53777
229 Ga0495613_0000321 3300046689 Bacteria 43464
230 Ga0495613_0020748 3300046689 Bacteria 4898
231 Ga0495624_0000038 3300046690 Bacteria 83368
232 Ga0495624_0000744 3300046690 Bacteria 25641
233 Ga0495649_0001181 3300046694 Bacteria 20231
234 Ga0495600_0001413 3300046809 Bacteria 13256
235 Ga0495604_0000267 3300047317 Bacteria 46398
236 Ga0495604_0018520 3300047317 Bacteria 5578
237 Ga0495604_0032108 3300047317 Bacteria 4163
238 Ga0495674_0000019 3300047319 Bacteria 185107
239 Ga0495674_0001471 3300047319 Bacteria 23093
240 Ga0495672_0012593 3300047320 Bacteria 5892
241 Ga0495676_0002025 3300047321 Bacteria 17856
242 Ga0495680_0000193 3300047322 Bacteria 65567
243 Ga0495680_0001449 3300047322 Bacteria 25562
244 Ga0495680_0004877 3300047322 Bacteria 12707
245 Ga0495680_0010481 3300047322 Bacteria 8271
246 Ga0495680_0096015 3300047322 Bacteria 2215
247 Ga0495680_0098313 3300047322 Bacteria 2184
248 Ga0495675_0000037 3300047444 Bacteria 91283
249 Ga0495602_0013145 3300048088 Bacteria 8469
250 Ga0496100_0000005 3300048903 Bacteria 312112
251 Ga0496100_0000014 3300048903 Bacteria 174991
252 Ga0496101_0000022 3300048904 Bacteria 216728
253 Ga0496101_0000036 3300048904 Bacteria 175595
254 Ga0496102_0000081 3300048905 Bacteria 139266
255 Ga0496102_0026071 3300048905 Bacteria 5210
256 Ga0496103_0000031 3300048906 Bacteria 204016
257 Ga0496103_0050326 3300048906 Bacteria 2577
258 Ga0496104_0000024 3300048907 Bacteria 229913
259 Ga0496104_0001895 3300048907 Bacteria 18118
260 Ga0496105_0000004 3300048908 Bacteria 475798
261 Ga0496105_0000013 3300048908 Bacteria 229894
262 Ga0496105_0000098 3300048908 Bacteria 59301
263 Ga0496105_0001661 3300048908 Bacteria 15851
264 Ga0496105_0043755 3300048908 Bacteria 3693
265 Ga0496106_0000043 3300048909 Bacteria 105477
266 Ga0496106_0000087 3300048909 Bacteria 73787
267 Ga0496106_0000440 3300048909 Bacteria 29633
268 Ga0496106_0107253 3300048909 Bacteria 2172
269 Ga0496107_0000022 3300048910 Bacteria 128991
270 Ga0496107_0000046 3300048910 Bacteria 67209
271 Ga0496107_0019500 3300048910 Bacteria 4785
272 Ga0496108_0000005 3300048911 Bacteria 535059
273 Ga0496108_0000006 3300048911 Bacteria 469473
274 Ga0496109_0000004 3300048912 Bacteria 404818
275 Ga0496109_0057812 3300048912 Bacteria 3542
276 Ga0496109_0144773 3300048912 Bacteria 2223
277 Ga0496110_0000011 3300048913 Bacteria 97293
278 Ga0496110_0010692 3300048913 Bacteria 7475
279 Ga0496110_0020066 3300048913 Bacteria 5637
280 Ga0496111_0000170 3300048914 Bacteria 29627
281 Ga0496111_0020861 3300048914 Bacteria 4568
282 Ga0496111_0048042 3300048914 Bacteria 3074
283 Ga0496111_0082729 3300048914 Bacteria 2345
284 Ga0496112_0001176 3300048915 Bacteria 19620
285 Ga0496113_0000202 3300048916 Bacteria 27530
286 Ga0496114_0000054 3300048917 Bacteria 98328
287 Ga0496114_0007327 3300048917 Bacteria 8714
288 Ga0496114_0040769 3300048917 Bacteria 3845
289 Ga0496115_0000010 3300048918 Bacteria 227112
290 Ga0496115_0000334 3300048918 Bacteria 40085
291 Ga0496115_0009591 3300048918 Bacteria 7196
292 Ga0496116_0000519 3300048919 Bacteria 51925
293 Ga0496120_0003095 3300048923 Bacteria 15653
294 Ga0496125_0090521 3300048928 Bacteria 2296
295 Ga0496126_0012731 3300048929 Bacteria 8602
296 Ga0496126_0038795 3300048929 Bacteria 4427
297 Ga0496126_0093015 3300048929 Bacteria 2648
298 Ga0501031_0026052 3300049568 Bacteria 3814
299 Ga0501032_0025683 3300049569 Bacteria 4059
300 Ga0501034_0237826 3300049571 Bacteria 1768
301 Ga0501036_0011955 3300049572 Bacteria 7197
302 Ga0501037_0034089 3300049573 Bacteria 3758
303 Ga0501039_0021601 3300049575 Bacteria 4937
304 Ga0501039_0080237 3300049575 Bacteria 2539
305 Ga0501042_0023230 3300049578 Bacteria 4337
306 Ga0501042_0064309 3300049578 Bacteria 2621
307 Ga0501047_0004198 3300049581 Bacteria 13565
308 Ga0501047_0091994 3300049581 Bacteria 2911
309 Ga0501048_0026480 3300049582 Bacteria 4222
310 Ga0501067_0008201 3300049583 Bacteria 5800
311 Ga0501070_0029861 3300049586 Bacteria 4567
312 Ga0501070_0070041 3300049586 Bacteria 2904
313 Ga0501071_0006330 3300049587 Bacteria 7679
314 Ga0501073_0042821 3300049589 Bacteria 3194
315 Ga0501074_0033908 3300049590 Bacteria 3701
316 Ga0501079_0016121 3300049741 Bacteria 5710
317 Ga0501079_0198114 3300049741 Bacteria 1568
318 Ga0501080_0003038 3300049742 Bacteria 14805
319 Ga0501080_0067934 3300049742 Bacteria 3315
320 Ga0501081_0035518 3300049743 Bacteria 3393
321 Ga0501083_0004865 3300049744 Bacteria 9497
322 Ga0501083_0011696 3300049744 Bacteria 6152
323 Ga0501083_0015100 3300049744 Bacteria 5406
324 Ga0501035_0075623 3300049822 Bacteria 2978
325 Ga0501044_0034404 3300049823 Bacteria 5314
326 Ga0501044_0091989 3300049823 Bacteria 3059
327 nmdc:mga00v17_30923_c1 3300050491 Bacteria 3154
328 nmdc:mga08y16_120835_c1 3300050511 Bacteria 2726
329 nmdc:mga08y16_18634_c1 3300050511 Bacteria 7311
330 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
331 Ga0495601_0007570 3300053077 Bacteria 6375
332 Ga0495601_0024585 3300053077 Bacteria 3711
333 Ga0495601_0024973 3300053077 Bacteria 3682
334 Ga0495612_0000217 3300053078 Bacteria 24406
335 Ga0495612_0011323 3300053078 Bacteria 3595
336 Ga0495655_0000006 3300053083 Bacteria 201200
337 Ga0495595_0000002 3300053084 Bacteria 445641
338 Ga0495595_0000121 3300053084 Bacteria 33439
339 Ga0495619_0000037 3300053085 Bacteria 124007
340 Ga0495619_0000541 3300053085 Bacteria 24974
341 Ga0495619_0000596 3300053085 Bacteria 23953
342 Ga0495619_0002019 3300053085 Bacteria 13492
343 Ga0495619_0039098 3300053085 Bacteria 3096
344 Ga0500566_0005438 3300053094 Bacteria 7576
345 Ga0500556_0000244 3300053104 Bacteria 44183
346 Ga0500628_000001 3300053129 Bacteria 564074
347 Ga0500616_0003142 3300053153 Bacteria 12896
348 Ga0466962_0003992 3300061719 Bacteria 7063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0291671 Ga0395898_0291671_65_1252 382
2 3300047322 Ga0495680_0098313 Ga0495680_0098313_12_1289 394
3 3300045976 Ga0466967_0159473 Ga0466967_0159473_561_1859 411
4 3300039450 Ga0436363_1236543 Ga0436363_1236543_8624_9922 414
5 3300005536 Ga0070697_100017434 Ga0070697_1000174342 421
6 3300039437 Ga0436365_0295376 Ga0436365_0295376_703_2133 422
7 3300035092 Ga0373952_0010763 Ga0373952_0010763_140_1471 423
8 3300046462 Ga0495651_0057145 Ga0495651_0057145_475_1881 425
9 3300046477 Ga0495664_0025547 Ga0495664_0025547_784_2190 425
10 3300046516 Ga0495628_0039034 Ga0495628_0039034_381_1787 425
11 3300046517 Ga0495630_0012385 Ga0495630_0012385_3392_4798 425
12 3300046529 Ga0495652_0040825 Ga0495652_0040825_2185_3591 425
13 3300046533 Ga0495640_0009053 Ga0495640_0009053_5041_6447 425
14 3300046559 Ga0495667_0006422 Ga0495667_0006422_4974_6380 425
15 3300046642 Ga0495634_0022055 Ga0495634_0022055_1890_3296 425
16 3300046678 Ga0495599_0058327 Ga0495599_0058327_854_2260 425
17 3300046689 Ga0495613_0020748 Ga0495613_0020748_2324_3730 425
18 3300047317 Ga0495604_0032108 Ga0495604_0032108_448_1854 425
19 3300047319 Ga0495674_0001471 Ga0495674_0001471_9048_10454 425
20 3300047322 Ga0495680_0001449 Ga0495680_0001449_7098_8504 425
21 3300053085 Ga0495619_0039098 Ga0495619_0039098_1134_2540 425
22 3300007076 Ga0075435_100234906 Ga0075435_1002349061 426
23 3300037312 Ga0395899_0012057 Ga0395899_0012057_372_1778 428
24 3300049571 Ga0501034_0237826 Ga0501034_0237826_230_1645 428
25 3300049823 Ga0501044_0091989 Ga0501044_0091989_943_2358 428
26 3300050491 nmdc:mga00v17_30923_c1 nmdc:mga00v17_30923_c1_963_2405 429
27 3300044683 Ga0466965_0033095 Ga0466965_0033095_575_2002 430
28 3300044684 Ga0466966_0053279 Ga0466966_0053279_854_2281 430
29 3300044694 Ga0466963_0002237 Ga0466963_0002237_9026_10453 430
30 3300044842 Ga0466957_0012584 Ga0466957_0012584_2141_3568 430
31 3300046642 Ga0495634_0002025 Ga0495634_0002025_118_1563 434
32 3300037466 Ga0395898_0133340 Ga0395898_0133340_738_2153 437
33 3300037312 Ga0395899_0005066 Ga0395899_0005066_2274_3683 439
34 3300037418 Ga0395900_0059586 Ga0395900_0059586_968_2377 439
35 3300005329 Ga0070683_100001932 Ga0070683_10000193211 441
36 3300005577 Ga0068857_100005021 Ga0068857_1000050214 441
37 3300009147 Ga0114129_10155678 Ga0114129_101556782 441
38 3300025944 Ga0207661_10001110 Ga0207661_1000111015 441
39 3300025945 Ga0207679_10029980 Ga0207679_100299802 441
40 3300026116 Ga0207674_10043551 Ga0207674_100435513 441
41 3300045836 Ga0466958_0112912 Ga0466958_0112912_27_1406 443
42 3300005981 Ga0081538_10015434 Ga0081538_100154345 444
43 3300044694 Ga0466963_0046059 Ga0466963_0046059_1458_2864 444
44 3300044694 Ga0466963_0111235 Ga0466963_0111235_311_1714 444
45 3300045976 Ga0466967_0273000 Ga0466967_0273000_171_1577 444
46 3300046455 Ga0495603_0017853 Ga0495603_0017853_2598_4079 444
47 3300061719 Ga0466962_0003992 Ga0466962_0003992_648_2051 444
48 3300005347 Ga0070668_100013523 Ga0070668_1000135232 445
49 3300009098 Ga0105245_10001289 Ga0105245_100012899 445
50 3300009553 Ga0105249_10002695 Ga0105249_1000269517 445
51 3300025933 Ga0207706_10002564 Ga0207706_1000256415 445
52 3300026075 Ga0207708_10038848 Ga0207708_100388482 445
53 3300049575 Ga0501039_0021601 Ga0501039_0021601_375_1778 445
54 3300005937 Ga0081455_10028289 Ga0081455_100282895 446
55 3300005937 Ga0081455_10068451 Ga0081455_100684512 446
56 3300005981 Ga0081538_10008465 Ga0081538_100084654 446
57 3300009094 Ga0111539_10010170 Ga0111539_1001017010 446
58 3300031995 Ga0307409_100047860 Ga0307409_1000478605 446
59 3300037471 Ga0395905_0057484 Ga0395905_0057484_691_2097 446
60 3300038443 Ga0395901_0010297 Ga0395901_0010297_3970_5376 446
61 3300044684 Ga0466966_0063301 Ga0466966_0063301_566_1993 446
62 3300050511 nmdc:mga08y16_120835_c1 nmdc:mga08y16_120835_c1_977_2377 446
63 3300050511 nmdc:mga08y16_18634_c1 nmdc:mga08y16_18634_c1_1496_2896 446
64 3300053085 Ga0495619_0002019 Ga0495619_0002019_10612_12123 446
65 3300005337 Ga0070682_100000030 Ga0070682_100000030140 447
66 3300048917 Ga0496114_0007327 Ga0496114_0007327_5136_6581 447
67 3300006178 Ga0075367_10029936 Ga0075367_100299364 448
68 3300049587 Ga0501071_0006330 Ga0501071_0006330_2057_3610 448
69 3300049741 Ga0501079_0016121 Ga0501079_0016121_2451_4004 448
70 3300049744 Ga0501083_0015100 Ga0501083_0015100_766_2319 448
71 3300049823 Ga0501044_0034404 Ga0501044_0034404_3075_4628 448
72 3300045049 Ga0466959_0015633 Ga0466959_0015633_890_2332 449
73 3300048919 Ga0496116_0000519 Ga0496116_0000519_14029_15579 449
74 3300049742 Ga0501080_0067934 Ga0501080_0067934_471_2024 449
75 3300005435 Ga0070714_100020891 Ga0070714_1000208913 450
76 3300025929 Ga0207664_10002611 Ga0207664_100026113 450
77 3300026088 Ga0207641_10126367 Ga0207641_101263672 450
78 3300046536 Ga0495587_0117183 Ga0495587_0117183_19_1461 450
79 3300048929 Ga0496126_0012731 Ga0496126_0012731_3659_5212 450
80 3300047320 Ga0495672_0012593 Ga0495672_0012593_1320_2780 452
81 3300049568 Ga0501031_0026052 Ga0501031_0026052_1548_2960 452
82 3300049569 Ga0501032_0025683 Ga0501032_0025683_416_1828 452
83 3300049572 Ga0501036_0011955 Ga0501036_0011955_2440_3852 452
84 3300049573 Ga0501037_0034089 Ga0501037_0034089_1838_3250 452
85 3300049578 Ga0501042_0064309 Ga0501042_0064309_630_2042 452
86 3300049581 Ga0501047_0091994 Ga0501047_0091994_544_1956 452
87 3300049582 Ga0501048_0026480 Ga0501048_0026480_109_1521 452
88 3300049583 Ga0501067_0008201 Ga0501067_0008201_2211_3623 452
89 3300049586 Ga0501070_0029861 Ga0501070_0029861_2582_4132 452
90 3300049589 Ga0501073_0042821 Ga0501073_0042821_1240_2652 452
91 3300049590 Ga0501074_0033908 Ga0501074_0033908_49_1461 452
92 3300049742 Ga0501080_0003038 Ga0501080_0003038_2226_3638 452
93 3300049744 Ga0501083_0004865 Ga0501083_0004865_3382_4794 452
94 3300049822 Ga0501035_0075623 Ga0501035_0075623_818_2230 452
95 3300005338 Ga0068868_100000225 Ga0068868_10000022512 453
96 3300026023 Ga0207677_10000508 Ga0207677_100005089 453
97 3300046559 Ga0495667_0000034 Ga0495667_0000034_88386_89786 453
98 3300047322 Ga0495680_0010481 Ga0495680_0010481_407_1807 453
99 3300002459 JGI24751J29686_10008535 JGI24751J29686_100085352 454
100 3300005457 Ga0070662_100000006 Ga0070662_100000006129 454
101 3300025933 Ga0207706_10000017 Ga0207706_10000017129 454
102 3300049581 Ga0501047_0004198 Ga0501047_0004198_3343_4896 454
103 3300053104 Ga0500556_0000244 Ga0500556_0000244_10824_12242 454
104 3300053153 Ga0500616_0003142 Ga0500616_0003142_6939_8357 454
105 3300046689 Ga0495613_0000321 Ga0495613_0000321_1483_2925 455
106 3300005338 Ga0068868_100173367 Ga0068868_1001733672 456
107 3300005535 Ga0070684_100267123 Ga0070684_1002671232 456
108 3300037312 Ga0395899_0063095 Ga0395899_0063095_698_2116 456
109 3300037418 Ga0395900_0033119 Ga0395900_0033119_1387_2805 456
110 3300037466 Ga0395898_0093415 Ga0395898_0093415_266_1684 456
111 3300038443 Ga0395901_0033486 Ga0395901_0033486_236_1654 456
112 3300045836 Ga0466958_0053657 Ga0466958_0053657_423_1853 456
113 3300046473 Ga0495582_0000001 Ga0495582_0000001_233096_234595 456
114 3300046642 Ga0495634_0000028 Ga0495634_0000028_66586_68034 456
115 3300046683 Ga0495658_0000306 Ga0495658_0000306_17827_19326 456
116 3300049586 Ga0501070_0070041 Ga0501070_0070041_1441_2889 456
117 3300009551 Ga0105238_10000048 Ga0105238_10000048100 457
118 3300009553 Ga0105249_10000070 Ga0105249_1000007045 457
119 3300025924 Ga0207694_10000056 Ga0207694_10000056100 457
120 3300025961 Ga0207712_10000019 Ga0207712_10000019266 457
121 3300037418 Ga0395900_0068972 Ga0395900_0068972_1981_3399 457
122 3300045836 Ga0466958_0018847 Ga0466958_0018847_719_2146 457
123 3300048914 Ga0496111_0082729 Ga0496111_0082729_52_1470 457
124 3300005547 Ga0070693_100001071 Ga0070693_1000010719 458
125 3300037853 Ga0436364_0253679 Ga0436364_0253679_7205_8635 458
126 3300039437 Ga0436365_0142551 Ga0436365_0142551_15655_17085 458
127 3300048912 Ga0496109_0057812 Ga0496109_0057812_84_1532 458
128 3300046517 Ga0495630_0000175 Ga0495630_0000175_38553_39980 459
129 3300053085 Ga0495619_0000596 Ga0495619_0000596_14362_15789 459
130 3300005367 Ga0070667_100038217 Ga0070667_1000382172 460
131 3300005548 Ga0070665_100168574 Ga0070665_1001685742 460
132 3300005981 Ga0081538_10001207 Ga0081538_1000120715 460
133 3300025903 Ga0207680_10023499 Ga0207680_100234992 460
134 3300025986 Ga0207658_10002010 Ga0207658_100020106 460
135 3300028379 Ga0268266_10003814 Ga0268266_1000381413 460
136 3300048928 Ga0496125_0090521 Ga0496125_0090521_248_1750 460
137 3300048929 Ga0496126_0093015 Ga0496126_0093015_944_2446 460
138 3300049575 Ga0501039_0080237 Ga0501039_0080237_974_2410 461
139 3300049741 Ga0501079_0198114 Ga0501079_0198114_42_1478 461
140 3300005983 Ga0081540_1001324 Ga0081540_100132423 462
141 3300006852 Ga0075433_10001600 Ga0075433_1000160013 462
142 3300028563 Ga0265319_1000110 Ga0265319_100011016 462
143 3300028800 Ga0265338_10000578 Ga0265338_1000057817 462
144 3300031250 Ga0265331_10040277 Ga0265331_100402772 462
145 3300049744 Ga0501083_0011696 Ga0501083_0011696_2819_4369 462
146 3300050515 nmdc:mga0a205_45_c1 nmdc:mga0a205_45_c1_45238_46674 462
147 3300005549 Ga0070704_100094673 Ga0070704_1000946733 463
148 3300013308 Ga0157375_10000130 Ga0157375_1000013026 463
149 3300046516 Ga0495628_0098048 Ga0495628_0098048_657_2096 463
150 3300046559 Ga0495667_0027204 Ga0495667_0027204_1458_2897 463
151 3300048906 Ga0496103_0050326 Ga0496103_0050326_695_2245 463
152 3300048908 Ga0496105_0043755 Ga0496105_0043755_1535_3037 463
153 3300048912 Ga0496109_0144773 Ga0496109_0144773_523_2001 463
154 3300048914 Ga0496111_0048042 Ga0496111_0048042_781_2259 463
155 3300048923 Ga0496120_0003095 Ga0496120_0003095_9223_10773 463
156 3300005337 Ga0070682_100084223 Ga0070682_1000842232 464
157 3300005341 Ga0070691_10000018 Ga0070691_1000001828 464
158 3300005441 Ga0070700_100119308 Ga0070700_1001193081 464
159 3300005937 Ga0081455_10033529 Ga0081455_100335293 464
160 3300005937 Ga0081455_10037050 Ga0081455_100370504 464
161 3300017792 Ga0163161_10000160 Ga0163161_1000016012 464
162 3300026035 Ga0207703_10037640 Ga0207703_100376402 464
163 3300036401 Ga0373937_0005520 Ga0373937_0005520_3072_4517 464
164 3300046455 Ga0495603_0001286 Ga0495603_0001286_3557_4996 464
165 3300046459 Ga0495629_0004043 Ga0495629_0004043_8104_9549 464
166 3300046459 Ga0495629_0092704 Ga0495629_0092704_264_1706 464
167 3300046462 Ga0495651_0007905 Ga0495651_0007905_2612_4087 464
168 3300046476 Ga0495662_0036518 Ga0495662_0036518_296_1738 464
169 3300046516 Ga0495628_0001544 Ga0495628_0001544_18566_20002 464
170 3300046516 Ga0495628_0046700 Ga0495628_0046700_104_1546 464
171 3300046516 Ga0495628_0106957 Ga0495628_0106957_145_1581 464
172 3300046615 Ga0495656_0000557 Ga0495656_0000557_6205_7644 464
173 3300046663 Ga0495635_0000005 Ga0495635_0000005_253861_255297 464
174 3300047319 Ga0495674_0000019 Ga0495674_0000019_163255_164697 464
175 3300047321 Ga0495676_0002025 Ga0495676_0002025_1500_2942 464
176 3300047322 Ga0495680_0000193 Ga0495680_0000193_45394_46869 464
177 3300048903 Ga0496100_0000005 Ga0496100_0000005_44507_45949 464
178 3300048904 Ga0496101_0000022 Ga0496101_0000022_195737_197179 464
179 3300048905 Ga0496102_0000081 Ga0496102_0000081_85656_87098 464
180 3300048906 Ga0496103_0000031 Ga0496103_0000031_51246_52688 464
181 3300048909 Ga0496106_0000087 Ga0496106_0000087_70252_71694 464
182 3300048910 Ga0496107_0000046 Ga0496107_0000046_64294_65736 464
183 3300048917 Ga0496114_0000054 Ga0496114_0000054_76768_78210 464
184 3300048918 Ga0496115_0000334 Ga0496115_0000334_20119_21561 464
185 3300053077 Ga0495601_0024585 Ga0495601_0024585_166_1608 464
186 3300053078 Ga0495612_0000217 Ga0495612_0000217_16694_18136 464
187 3300053083 Ga0495655_0000006 Ga0495655_0000006_187824_189266 464
188 3300053094 Ga0500566_0005438 Ga0500566_0005438_1391_2833 464
189 3300053129 Ga0500628_000001 Ga0500628_000001_455035_456477 464
190 3300005364 Ga0070673_100004352 Ga0070673_1000043527 465
191 3300005459 Ga0068867_100000295 Ga0068867_10000029527 465
192 3300005841 Ga0068863_100002902 Ga0068863_10000290214 465
193 3300009176 Ga0105242_10000085 Ga0105242_1000008547 465
194 3300025934 Ga0207686_10000982 Ga0207686_100009826 465
195 3300025960 Ga0207651_10001317 Ga0207651_100013177 465
196 3300026088 Ga0207641_10130179 Ga0207641_101301793 465
197 3300026089 Ga0207648_10029844 Ga0207648_100298444 465
198 3300044694 Ga0466963_0144090 Ga0466963_0144090_116_1558 465
199 3300046476 Ga0495662_0000137 Ga0495662_0000137_1483_2970 465
200 3300046529 Ga0495652_0001413 Ga0495652_0001413_13271_14722 465
201 3300046535 Ga0495586_0000436 Ga0495586_0000436_431_1864 465
202 3300046543 Ga0495645_0118791 Ga0495645_0118791_326_1780 465
203 3300046681 Ga0495647_0000009 Ga0495647_0000009_12273_13709 465
204 3300046690 Ga0495624_0000744 Ga0495624_0000744_2746_4182 465
205 3300047317 Ga0495604_0018520 Ga0495604_0018520_3139_4575 465
206 3300049578 Ga0501042_0023230 Ga0501042_0023230_2821_4305 465
207 3300005985 Ga0081539_10003034 Ga0081539_1000303419 466
208 3300046454 Ga0495592_0000318 Ga0495592_0000318_5333_6826 466
209 3300046536 Ga0495587_0002109 Ga0495587_0002109_10123_11571 466
210 3300046660 Ga0495625_0000506 Ga0495625_0000506_362_1831 466
211 3300048905 Ga0496102_0026071 Ga0496102_0026071_1164_2630 466
212 3300048909 Ga0496106_0107253 Ga0496106_0107253_44_1510 466
213 3300049743 Ga0501081_0035518 Ga0501081_0035518_1189_2637 466
214 3300005436 Ga0070713_100000010 Ga0070713_10000001019 467
215 3300005439 Ga0070711_100076175 Ga0070711_1000761752 467
216 3300005441 Ga0070700_100023575 Ga0070700_1000235752 467
217 3300005535 Ga0070684_100004687 Ga0070684_10000468710 467
218 3300025916 Ga0207663_10066105 Ga0207663_100661052 467
219 3300025928 Ga0207700_10000007 Ga0207700_10000007220 467
220 3300026075 Ga0207708_10024612 Ga0207708_100246122 467
221 3300032126 Ga0307415_100037574 Ga0307415_1000375742 467
222 3300046514 Ga0495618_0000126 Ga0495618_0000126_6950_8395 467
223 3300046517 Ga0495630_0000555 Ga0495630_0000555_5452_6897 467
224 3300046523 Ga0495644_0001144 Ga0495644_0001144_2014_3507 467
225 3300046675 Ga0495657_0002724 Ga0495657_0002724_1475_2968 467
226 3300046681 Ga0495647_0003571 Ga0495647_0003571_745_2241 467
227 3300046809 Ga0495600_0001413 Ga0495600_0001413_5077_6522 467
228 3300048907 Ga0496104_0001895 Ga0496104_0001895_10724_12172 467
229 3300048908 Ga0496105_0000098 Ga0496105_0000098_18794_20242 467
230 3300053077 Ga0495601_0024973 Ga0495601_0024973_866_2314 467
231 3300053084 Ga0495595_0000121 Ga0495595_0000121_17022_18467 467
232 3300005329 Ga0070683_100002878 Ga0070683_1000028787 468
233 3300005333 Ga0070677_10000175 Ga0070677_1000017519 468
234 3300005337 Ga0070682_100000171 Ga0070682_10000017129 468
235 3300005340 Ga0070689_100029093 Ga0070689_1000290932 468
236 3300005347 Ga0070668_100070846 Ga0070668_1000708462 468
237 3300005356 Ga0070674_100000004 Ga0070674_100000004125 468
238 3300005539 Ga0068853_100063506 Ga0068853_1000635064 468
239 3300005539 Ga0068853_100162094 Ga0068853_1001620942 468
240 3300005548 Ga0070665_100000040 Ga0070665_10000004047 468
241 3300005578 Ga0068854_100000237 Ga0068854_10000023710 468
242 3300005614 Ga0068856_100009805 Ga0068856_1000098057 468
243 3300005718 Ga0068866_10000004 Ga0068866_10000004162 468
244 3300005842 Ga0068858_100000319 Ga0068858_10000031931 468
245 3300006163 Ga0070715_10000014 Ga0070715_10000014123 468
246 3300006881 Ga0068865_100000140 Ga0068865_10000014016 468
247 3300009098 Ga0105245_10000212 Ga0105245_1000021221 468
248 3300009098 Ga0105245_10002024 Ga0105245_100020249 468
249 3300013296 Ga0157374_10000686 Ga0157374_1000068623 468
250 3300014326 Ga0157380_10000149 Ga0157380_1000014923 468
251 3300014326 Ga0157380_10000261 Ga0157380_1000026136 468
252 3300014968 Ga0157379_10052889 Ga0157379_100528894 468
253 3300025321 Ga0207656_10000393 Ga0207656_1000039312 468
254 3300025893 Ga0207682_10000251 Ga0207682_100002517 468
255 3300025899 Ga0207642_10000005 Ga0207642_1000000546 468
256 3300025905 Ga0207685_10000025 Ga0207685_1000002544 468
257 3300025916 Ga0207663_10044925 Ga0207663_100449251 468
258 3300025927 Ga0207687_10000020 Ga0207687_1000002048 468
259 3300025937 Ga0207669_10000195 Ga0207669_1000019514 468
260 3300025938 Ga0207704_10000360 Ga0207704_100003606 468
261 3300025944 Ga0207661_10001317 Ga0207661_100013177 468
262 3300025972 Ga0207668_10034008 Ga0207668_100340082 468
263 3300025981 Ga0207640_10000248 Ga0207640_1000024820 468
264 3300026035 Ga0207703_10000166 Ga0207703_1000016631 468
265 3300026041 Ga0207639_10020577 Ga0207639_100205773 468
266 3300026041 Ga0207639_10181785 Ga0207639_101817851 468
267 3300026078 Ga0207702_10010962 Ga0207702_100109627 468
268 3300028379 Ga0268266_10000045 Ga0268266_1000004550 468
269 3300028379 Ga0268266_10001339 Ga0268266_1000133915 468
270 3300028556 Ga0265337_1000287 Ga0265337_100028711 468
271 3300028654 Ga0265322_10000020 Ga0265322_1000002078 468
272 3300029957 Ga0265324_10000360 Ga0265324_100003606 468
273 3300031240 Ga0265320_10000035 Ga0265320_1000003578 468
274 3300031250 Ga0265331_10003207 Ga0265331_100032076 468
275 3300031251 Ga0265327_10000015 Ga0265327_10000015420 468
276 3300031344 Ga0265316_10013674 Ga0265316_100136747 468
277 3300031711 Ga0265314_10002307 Ga0265314_100023076 468
278 3300045976 Ga0466967_0000017 Ga0466967_0000017_29834_31279 468
279 3300046459 Ga0495629_0000691 Ga0495629_0000691_6181_7626 468
280 3300046461 Ga0495641_0052533 Ga0495641_0052533_182_1633 468
281 3300046476 Ga0495662_0008107 Ga0495662_0008107_977_2422 468
282 3300046507 Ga0495606_0000108 Ga0495606_0000108_105392_106837 468
283 3300046511 Ga0495608_0000036 Ga0495608_0000036_82062_83510 468
284 3300046515 Ga0495620_0000797 Ga0495620_0000797_17635_19080 468
285 3300046516 Ga0495628_0001454 Ga0495628_0001454_19010_20455 468
286 3300046516 Ga0495628_0034597 Ga0495628_0034597_1569_3014 468
287 3300046517 Ga0495630_0000012 Ga0495630_0000012_191098_192543 468
288 3300046543 Ga0495645_0111591 Ga0495645_0111591_310_1803 468
289 3300046616 Ga0495668_0031200 Ga0495668_0031200_185_1681 468
290 3300046674 Ga0495588_0000149 Ga0495588_0000149_4066_5511 468
291 3300046675 Ga0495657_0000001 Ga0495657_0000001_82062_83510 468
292 3300046678 Ga0495599_0018699 Ga0495599_0018699_801_2246 468
293 3300046681 Ga0495647_0003520 Ga0495647_0003520_169_1614 468
294 3300046684 Ga0495669_0000102 Ga0495669_0000102_2720_4165 468
295 3300046690 Ga0495624_0000038 Ga0495624_0000038_78480_79925 468
296 3300046694 Ga0495649_0001181 Ga0495649_0001181_1917_3410 468
297 3300047322 Ga0495680_0004877 Ga0495680_0004877_9075_10520 468
298 3300047322 Ga0495680_0096015 Ga0495680_0096015_43_1488 468
299 3300047444 Ga0495675_0000037 Ga0495675_0000037_68876_70324 468
300 3300048088 Ga0495602_0013145 Ga0495602_0013145_1493_2938 468
301 3300048903 Ga0496100_0000014 Ga0496100_0000014_52792_54237 468
302 3300048904 Ga0496101_0000036 Ga0496101_0000036_53396_54841 468
303 3300048907 Ga0496104_0000024 Ga0496104_0000024_51983_53428 468
304 3300048908 Ga0496105_0000013 Ga0496105_0000013_176486_177931 468
305 3300048909 Ga0496106_0000043 Ga0496106_0000043_55194_56639 468
306 3300048909 Ga0496106_0000440 Ga0496106_0000440_11658_13151 468
307 3300048910 Ga0496107_0000022 Ga0496107_0000022_6792_8237 468
308 3300048910 Ga0496107_0019500 Ga0496107_0019500_1797_3290 468
309 3300048911 Ga0496108_0000006 Ga0496108_0000006_180680_182125 468
310 3300048912 Ga0496109_0000004 Ga0496109_0000004_353423_354868 468
311 3300048913 Ga0496110_0000011 Ga0496110_0000011_49252_50697 468
312 3300048913 Ga0496110_0010692 Ga0496110_0010692_5399_6844 468
313 3300048913 Ga0496110_0020066 Ga0496110_0020066_1406_2899 468
314 3300048914 Ga0496111_0000170 Ga0496111_0000170_12587_14032 468
315 3300048914 Ga0496111_0020861 Ga0496111_0020861_2721_4166 468
316 3300048915 Ga0496112_0001176 Ga0496112_0001176_8394_9839 468
317 3300048916 Ga0496113_0000202 Ga0496113_0000202_11997_13442 468
318 3300048917 Ga0496114_0040769 Ga0496114_0040769_479_1927 468
319 3300048918 Ga0496115_0000010 Ga0496115_0000010_181739_183187 468
320 3300048918 Ga0496115_0009591 Ga0496115_0009591_2135_3580 468
321 3300053077 Ga0495601_0007570 Ga0495601_0007570_2737_4182 468
322 3300053078 Ga0495612_0011323 Ga0495612_0011323_1452_2897 468
323 3300053084 Ga0495595_0000002 Ga0495595_0000002_362132_363580 468
324 3300053085 Ga0495619_0000037 Ga0495619_0000037_9467_10912 468
325 3300053085 Ga0495619_0000541 Ga0495619_0000541_14025_15473 468
326 3300005548 Ga0070665_100177538 Ga0070665_1001775383 469
327 3300006847 Ga0075431_100021950 Ga0075431_1000219506 469
328 3300009147 Ga0114129_10247777 Ga0114129_102477772 469
329 3300028379 Ga0268266_10024298 Ga0268266_100242983 469
330 3300046463 Ga0495653_0088009 Ga0495653_0088009_86_1585 469
331 3300002239 JGI24034J26672_10000331 JGI24034J26672_100003313 470
332 3300005843 Ga0068860_100194274 Ga0068860_1001942743 470
333 3300028381 Ga0268264_10019164 Ga0268264_100191642 470
334 3300005455 Ga0070663_100003388 Ga0070663_1000033885 471
335 3300005530 Ga0070679_100001408 Ga0070679_10000140817 471
336 3300005614 Ga0068856_100017100 Ga0068856_1000171002 471
337 3300013308 Ga0157375_10007080 Ga0157375_100070802 471
338 3300025921 Ga0207652_10000720 Ga0207652_1000072025 471
339 3300025944 Ga0207661_10015947 Ga0207661_100159473 471
340 3300026067 Ga0207678_10006876 Ga0207678_100068765 471
341 3300048908 Ga0496105_0001661 Ga0496105_0001661_4249_5802 471
342 3300048929 Ga0496126_0038795 Ga0496126_0038795_140_1693 471
343 3300048911 Ga0496108_0000005 Ga0496108_0000005_5730_7196 473
344 3300046461 Ga0495641_0052988 Ga0495641_0052988_102_1571 474
345 3300047317 Ga0495604_0000267 Ga0495604_0000267_44486_45976 474
346 3300001979 JGI24740J21852_10007423 JGI24740J21852_100074232 478
347 3300009101 Ga0105247_10000955 Ga0105247_1000095518 478
348 3300048908 Ga0496105_0000004 Ga0496105_0000004_46357_47829 478

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

37

468

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8603 4 455
2gi3-assembly1.cif.gz_A-2 crystal structure of glutamyl-trna(gln) amidotransferase subunit a (tm1272) from thermotoga maritima at 1.80 a resolution 0.8556 3 455
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8548 1 455
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8543 4 455
3al0-assembly1.cif.gz_A crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. 0.8411 3 456
ID Description Score Start End Superfamily
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8637 7 457 3.90.1300.10
2gi3A01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8629 3 455 3.90.1300.10
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8603 4 455 3.90.1300.10
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8578 9 455 3.90.1300.10
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8566 3 455 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A7S0P6Z6-F1-model_v4 Amidase domain-containing protein 0.9187 334 463 GO:0050567
AF-A0A2V7KPY6-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A (EC 6.3.5.-) 0.8903 143 307 GO:0016740
GO:0016874
AF-A0A7S0P6Z6-F1-model_v4 Amidase domain-containing protein 0.8856 334 463 GO:0050567
AF-A0A7V8ZI79-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A) (EC 6.3.5.7) 0.8845 5 462 GO:0005524
GO:0006412
GO:0016740
GO:0030956
GO:0050567
AF-A0A0G0WF67-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT subunit A) (EC 6.3.5.7) 0.8823 3 456 GO:0005524
GO:0006412
GO:0016740
GO:0030956
GO:0050567

Feature Viewer

pLDDT pTM Quality
83.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map