F417477

General Info

Members Datasets Scaffolds Average Seq Length
348 200 696 221

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100049899|Ga0068858_1000498994
Length 264
Sequence MLRGPKGMDSYGAPQESLAVQPERRLLVDSTTRADDRIQYPRPHIMPVLELITSSGLGSLLGMRHALEPDHLAAVTTLVTGERNSFKAALLGACWGLGHTFSLIVVGTLLVILRAEMPVRVADAFEFCVALMLIGLGLRAIYLAARQGPVGPVHLHHHGTKEHTWTLARRPLIVGAVHGLAGSGALTALVVATLPTAAERITYMLLFGLGSTLGMAALSGLLGWPLARAGRNRSLARALSMTVGCVSTVLGLAWGYPILGRMFG

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 4.31
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 16.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100049899 3300005842 Bacteria 3874
2 Ga0070676_10007403 3300005328 Bacteria 5892
3 Ga0070676_10431392 3300005328 Bacteria 923
4 Ga0070683_100213709 3300005329 Bacteria 1832
5 Ga0070690_100133117 3300005330 Bacteria 1681
6 Ga0070670_100637598 3300005331 Bacteria 955
7 Ga0070670_100769906 3300005331 Unclassified 868
8 Ga0070677_10049316 3300005333 Bacteria 1695
9 Ga0068869_100185870 3300005334 Bacteria 1631
10 Ga0068869_100277141 3300005334 Bacteria 1348
11 Ga0068869_100331198 3300005334 Bacteria 1237
12 Ga0068868_100093875 3300005338 Bacteria 2420
13 Ga0068868_100484612 3300005338 Bacteria 1081
14 Ga0070660_100025604 3300005339 Bacteria 4386
15 Ga0070691_10009156 3300005341 Bacteria 4525
16 Ga0070687_100033779 3300005343 Bacteria 2528
17 Ga0070687_100062645 3300005343 Bacteria 1970
18 Ga0070692_10046989 3300005345 Bacteria 2233
19 Ga0070668_100268114 3300005347 Unclassified 1422
20 Ga0070668_100420870 3300005347 Unclassified 1144
21 Ga0070669_100015329 3300005353 Bacteria 5461
22 Ga0070675_100001170 3300005354 Bacteria 19000
23 Ga0070675_100019625 3300005354 Bacteria 5387
24 Ga0070674_100160073 3300005356 Bacteria 1707
25 Ga0070674_100570701 3300005356 Bacteria 952
26 Ga0070673_100092340 3300005364 Bacteria 2476
27 Ga0070659_100291941 3300005366 Bacteria 1358
28 Ga0070709_10005873 3300005434 Bacteria 6657
29 Ga0070709_10035559 3300005434 Bacteria 3028
30 Ga0070714_100009662 3300005435 Bacteria 7595
31 Ga0070713_100040524 3300005436 Bacteria 3787
32 Ga0070705_100006075 3300005440 Bacteria 5911
33 Ga0070705_100247224 3300005440 Bacteria 1250
34 Ga0070705_100273067 3300005440 Bacteria 1198
35 Ga0070700_100006817 3300005441 Bacteria 6125
36 Ga0070708_100086142 3300005445 Unclassified 2853
37 Ga0070678_100005063 3300005456 Bacteria 7560
38 Ga0070662_100320364 3300005457 Unclassified 1264
39 Ga0070681_10047275 3300005458 Bacteria 4301
40 Ga0068867_100365857 3300005459 Bacteria 1207
41 Ga0070685_10297360 3300005466 Unclassified 1087
42 Ga0070706_100562868 3300005467 Bacteria 1060
43 Ga0070707_100157177 3300005468 Bacteria 2215
44 Ga0070707_100454744 3300005468 Unclassified 1241
45 Ga0070707_100507821 3300005468 Bacteria 1167
46 Ga0070707_100581787 3300005468 Bacteria 1082
47 Ga0070698_100134096 3300005471 Bacteria 2431
48 Ga0070699_100009868 3300005518 Bacteria 8266
49 Ga0070699_100031862 3300005518 Bacteria 4553
50 Ga0070699_100063835 3300005518 Unclassified 3194
51 Ga0070699_100269715 3300005518 Unclassified 1523
52 Ga0070699_100658884 3300005518 Bacteria 956
53 Ga0070679_100034560 3300005530 Bacteria 5011
54 Ga0070679_100126859 3300005530 Bacteria 2534
55 Ga0070684_100211388 3300005535 Bacteria 1768
56 Ga0070697_100019516 3300005536 Bacteria 5356
57 Ga0070697_100397438 3300005536 Bacteria 1195
58 Ga0068853_100096682 3300005539 Bacteria 2606
59 Ga0070686_100018520 3300005544 Bacteria 4089
60 Ga0070686_100115990 3300005544 Bacteria 1832
61 Ga0070695_100072891 3300005545 Bacteria 2252
62 Ga0070695_100166826 3300005545 Bacteria 1550
63 Ga0070696_100013071 3300005546 Bacteria 5570
64 Ga0070665_100005241 3300005548 Bacteria 13409
65 Ga0070665_100018833 3300005548 Bacteria 6922
66 Ga0070665_101261582 3300005548 Bacteria 749
67 Ga0070704_100131326 3300005549 Bacteria 1941
68 Ga0068855_100019249 3300005563 Bacteria 8205
69 Ga0068855_100799293 3300005563 Unclassified 1003
70 Ga0070664_100566293 3300005564 Bacteria 1052
71 Ga0068854_100002897 3300005578 Bacteria 10657
72 Ga0068854_100017853 3300005578 Bacteria 4756
73 Ga0068856_100043810 3300005614 Bacteria 4402
74 Ga0068864_100007546 3300005618 Bacteria 8961
75 Ga0068864_100099762 3300005618 Bacteria 2573
76 Ga0068864_100242471 3300005618 Unclassified 1670
77 Ga0068864_100484804 3300005618 Bacteria 1187
78 Ga0068866_10061839 3300005718 Unclassified 1946
79 Ga0068861_100021856 3300005719 Bacteria 4602
80 Ga0068861_100023775 3300005719 Bacteria 4424
81 Ga0068861_100316148 3300005719 Bacteria 1358
82 Ga0068863_100145215 3300005841 Unclassified 2269
83 Ga0068863_100657086 3300005841 Bacteria 1040
84 Ga0068858_100003422 3300005842 Bacteria 15781
85 Ga0068858_100169868 3300005842 Bacteria 2056
86 Ga0068858_100629568 3300005842 Bacteria 1042
87 Ga0068858_100897777 3300005842 Bacteria 866
88 Ga0068860_100160030 3300005843 Bacteria 2171
89 Ga0068860_100806937 3300005843 Unclassified 952
90 Ga0068862_100061329 3300005844 Bacteria 3232
91 Ga0068862_100232921 3300005844 Bacteria 1672
92 Ga0068862_101091456 3300005844 Bacteria 793
93 Ga0081455_10112737 3300005937 Bacteria 2158
94 Ga0081539_10012058 3300005985 Bacteria 6722
95 Ga0070717_10199459 3300006028 Bacteria 1752
96 Ga0070716_100223866 3300006173 Bacteria 1266
97 Ga0097621_100013567 3300006237 Bacteria 6076
98 Ga0097621_100043707 3300006237 Bacteria 3612
99 Ga0097621_101115325 3300006237 Bacteria 741
100 Ga0068871_100038586 3300006358 Bacteria 3816
101 Ga0068871_100077888 3300006358 Bacteria 2740
102 Ga0068871_100291065 3300006358 Unclassified 1431
103 Ga0075428_100420568 3300006844 Bacteria 1432
104 Ga0075431_100109941 3300006847 Unclassified 2845
105 Ga0075431_100117832 3300006847 Bacteria 2740
106 Ga0075433_10010014 3300006852 Bacteria 7598
107 Ga0075434_100020265 3300006871 Bacteria 6447
108 Ga0075434_100127934 3300006871 Bacteria 2557
109 Ga0075434_100378348 3300006871 Bacteria 1437
110 Ga0075434_100413675 3300006871 Bacteria 1369
111 Ga0075429_100142972 3300006880 Unclassified 2094
112 Ga0068865_100009539 3300006881 Bacteria 6023
113 Ga0068865_100464430 3300006881 Bacteria 1049
114 Ga0075436_100001084 3300006914 Bacteria 18332
115 Ga0075436_100002257 3300006914 Bacteria 13290
116 Ga0075436_100082833 3300006914 Bacteria 2226
117 Ga0075436_100130183 3300006914 Bacteria 1764
118 Ga0075435_100000002 3300007076 Bacteria 140391
119 Ga0075435_100000431 3300007076 Bacteria 25670
120 Ga0075435_100020366 3300007076 Bacteria 5081
121 Ga0075435_100032091 3300007076 Bacteria 4146
122 Ga0075435_100082567 3300007076 Bacteria 2641
123 Ga0075435_100417707 3300007076 Bacteria 1155
124 Ga0105240_10010460 3300009093 Bacteria 13039
125 Ga0105240_10034458 3300009093 Bacteria 6530
126 Ga0105240_10638013 3300009093 Bacteria 1169
127 Ga0105240_10699841 3300009093 Unclassified 1106
128 Ga0111539_10012122 3300009094 Bacteria 10815
129 Ga0111539_10042427 3300009094 Bacteria 5463
130 Ga0111539_10279349 3300009094 Bacteria 1943
131 Ga0105245_10081267 3300009098 Bacteria 2962
132 Ga0105247_10002504 3300009101 Bacteria 12484
133 Ga0105247_10002788 3300009101 Bacteria 11697
134 Ga0105247_10491348 3300009101 Bacteria 893
135 Ga0114129_10010951 3300009147 Bacteria 12918
136 Ga0114129_10013026 3300009147 Bacteria 11846
137 Ga0114129_10020723 3300009147 Bacteria 9342
138 Ga0114129_10028567 3300009147 Bacteria 7903
139 Ga0114129_10167250 3300009147 Unclassified 3000
140 Ga0105243_10314832 3300009148 Bacteria 1424
141 Ga0105243_11259268 3300009148 Bacteria 755
142 Ga0105241_10395447 3300009174 Bacteria 1211
143 Ga0105242_10001908 3300009176 Bacteria 16383
144 Ga0105242_10008504 3300009176 Bacteria 7879
145 Ga0105242_10166850 3300009176 Unclassified 1932
146 Ga0105242_10228189 3300009176 Unclassified 1667
147 Ga0105242_10242579 3300009176 Bacteria 1621
148 Ga0105242_10717285 3300009176 Bacteria 980
149 Ga0105248_10023414 3300009177 Bacteria 6861
150 Ga0105248_10041606 3300009177 Bacteria 5152
151 Ga0105248_10086817 3300009177 Bacteria 3520
152 Ga0105248_10350715 3300009177 Bacteria 1661
153 Ga0105249_10020171 3300009553 Bacteria 5956
154 Ga0105249_10563472 3300009553 Unclassified 1191
155 Ga0105246_10573817 3300011119 Bacteria 970
156 Ga0157374_10082552 3300013296 Bacteria 3052
157 Ga0157374_10272295 3300013296 Bacteria 1670
158 Ga0157375_10211721 3300013308 Bacteria 2096
159 Ga0163163_10167860 3300014325 Bacteria 2241
160 Ga0163163_10489793 3300014325 Unclassified 1291
161 Ga0157380_10862311 3300014326 Unclassified 928
162 Ga0157379_10008630 3300014968 Bacteria 8871
163 Ga0157376_10032865 3300014969 Bacteria 4170
164 Ga0157376_10039094 3300014969 Bacteria 3866
165 Ga0163161_10654591 3300017792 Unclassified 871
166 Ga0213874_10040407 3300021377 Bacteria 1393
167 Ga0207653_10064767 3300025885 Bacteria 1239
168 Ga0207682_10133600 3300025893 Bacteria 1109
169 Ga0207642_10043525 3300025899 Unclassified 1981
170 Ga0207710_10009990 3300025900 Bacteria 3992
171 Ga0207710_10019796 3300025900 Unclassified 2873
172 Ga0207680_10186141 3300025903 Bacteria 1407
173 Ga0207699_10049155 3300025906 Bacteria 2482
174 Ga0207645_10006075 3300025907 Bacteria 8685
175 Ga0207645_10151897 3300025907 Unclassified 1512
176 Ga0207707_10035729 3300025912 Bacteria 4346
177 Ga0207707_10491278 3300025912 Bacteria 1048
178 Ga0207695_10049535 3300025913 Unclassified 4427
179 Ga0207695_10605081 3300025913 Bacteria 977
180 Ga0207663_10487200 3300025916 Unclassified 956
181 Ga0207662_10049899 3300025918 Bacteria 2484
182 Ga0207657_10001907 3300025919 Bacteria 22534
183 Ga0207649_10117802 3300025920 Bacteria 1786
184 Ga0207646_10340368 3300025922 Bacteria 1355
185 Ga0207646_10481901 3300025922 Unclassified 1118
186 Ga0207681_10020638 3300025923 Bacteria 4178
187 Ga0207681_10211457 3300025923 Unclassified 1495
188 Ga0207650_10780170 3300025925 Bacteria 809
189 Ga0207659_10005242 3300025926 Bacteria 7846
190 Ga0207659_10222582 3300025926 Unclassified 1518
191 Ga0207659_10302828 3300025926 Bacteria 1313
192 Ga0207687_10032512 3300025927 Bacteria 3533
193 Ga0207687_10264211 3300025927 Bacteria 1373
194 Ga0207687_10735389 3300025927 Bacteria 839
195 Ga0207700_10030725 3300025928 Bacteria 3808
196 Ga0207700_10165510 3300025928 Bacteria 1840
197 Ga0207664_10380206 3300025929 Bacteria 1253
198 Ga0207644_10249944 3300025931 Bacteria 1415
199 Ga0207690_10542618 3300025932 Bacteria 945
200 Ga0207706_10174986 3300025933 Bacteria 1886
201 Ga0207686_10064095 3300025934 Bacteria 2339
202 Ga0207686_10124402 3300025934 Unclassified 1760
203 Ga0207686_10301867 3300025934 Bacteria 1189
204 Ga0207704_10026085 3300025938 Unclassified 3200
205 Ga0207665_10137051 3300025939 Unclassified 1742
206 Ga0207711_10183206 3300025941 Bacteria 1905
207 Ga0207711_10214390 3300025941 Bacteria 1759
208 Ga0207711_10220369 3300025941 Unclassified 1735
209 Ga0207711_10264503 3300025941 Unclassified 1582
210 Ga0207711_10297043 3300025941 Bacteria 1489
211 Ga0207689_10157296 3300025942 Bacteria 1873
212 Ga0207689_10376521 3300025942 Bacteria 1182
213 Ga0207689_10398004 3300025942 Bacteria 1148
214 Ga0207679_10212005 3300025945 Bacteria 1625
215 Ga0207667_10072572 3300025949 Unclassified 3577
216 Ga0207667_10236922 3300025949 Bacteria 1868
217 Ga0207651_10010287 3300025960 Bacteria 5177
218 Ga0207651_10097809 3300025960 Bacteria 2168
219 Ga0207668_10195794 3300025972 Bacteria 1605
220 Ga0207640_10005528 3300025981 Bacteria 6888
221 Ga0207640_10053506 3300025981 Bacteria 2635
222 Ga0207640_10305991 3300025981 Unclassified 1259
223 Ga0207677_10030411 3300026023 Bacteria 3446
224 Ga0207703_10009580 3300026035 Bacteria 7605
225 Ga0207703_10040500 3300026035 Bacteria 3728
226 Ga0207703_10137905 3300026035 Bacteria 2114
227 Ga0207703_10143560 3300026035 Bacteria 2074
228 Ga0207703_10784791 3300026035 Bacteria 909
229 Ga0207708_10000441 3300026075 Bacteria 32343
230 Ga0207708_10094559 3300026075 Bacteria 2307
231 Ga0207702_10018137 3300026078 Bacteria 5822
232 Ga0207641_10073506 3300026088 Bacteria 2947
233 Ga0207648_10008974 3300026089 Bacteria 9616
234 Ga0207648_10439265 3300026089 Bacteria 1187
235 Ga0207676_10349211 3300026095 Unclassified 1367
236 Ga0207676_10408659 3300026095 Bacteria 1270
237 Ga0207674_10257822 3300026116 Bacteria 1691
238 Ga0207674_10391397 3300026116 Unclassified 1343
239 Ga0207675_100000931 3300026118 Bacteria 29237
240 Ga0207675_100070034 3300026118 Bacteria 3278
241 Ga0207683_10056611 3300026121 Bacteria 3440
242 Ga0207683_10181655 3300026121 Bacteria 1907
243 Ga0207428_10054112 3300027907 Bacteria 3197
244 Ga0207428_10078309 3300027907 Bacteria 2586
245 Ga0268266_10010160 3300028379 Bacteria 8248
246 Ga0268266_10203785 3300028379 Bacteria 1811
247 Ga0268265_10430322 3300028380 Bacteria 1228
248 Ga0268265_10515069 3300028380 Unclassified 1130
249 Ga0268264_10099920 3300028381 Bacteria 2519
250 Ga0268264_10274040 3300028381 Unclassified 1577
251 Ga0307416_100171950 3300032002 Bacteria 2018
252 Ga0373948_0002515 3300034817 Bacteria 2723
253 Ga0373948_0025486 3300034817 Bacteria 1160
254 Ga0373959_0002447 3300034820 Bacteria 2952
255 Ga0373938_0001204 3300034957 Bacteria 4167
256 Ga0373928_0018576 3300035084 Unclassified 1442
257 Ga0373929_0003705 3300035085 Bacteria 2742
258 Ga0373940_0000561 3300035088 Bacteria 5874
259 Ga0373949_0003799 3300035090 Bacteria 3521
260 Ga0373951_0002304 3300035091 Bacteria 4845
261 Ga0373952_0002653 3300035092 Bacteria 3226
262 Ga0373932_0001211 3300035112 Bacteria 7339
263 Ga0373936_0000007 3300035113 Bacteria 290641
264 Ga0373936_0174265 3300035113 Bacteria 942
265 Ga0373939_0003557 3300035114 Bacteria 3657
266 Ga0373941_0001700 3300035115 Bacteria 4716
267 Ga0373953_0402156 3300035117 Unclassified 603
268 Ga0373954_0222642 3300035118 Unclassified 928
269 Ga0373956_0053110 3300035119 Bacteria 1824
270 Ga0373960_0001225 3300035121 Bacteria 5620
271 Ga0373946_0060258 3300035171 Unclassified 1613
272 Ga0373955_0067734 3300035172 Bacteria 1988
273 Ga0373942_0030412 3300035207 Unclassified 1422
274 Ga0373961_0001442 3300035241 Bacteria 7015
275 Ga0373962_0025584 3300035242 Unclassified 1585
276 Ga0373931_0114432 3300035691 Unclassified 1534
277 Ga0373931_0321529 3300035691 Bacteria 961
278 Ga0373933_0113804 3300035724 Bacteria 1690
279 Ga0373947_0181456 3300035725 Bacteria 1370
280 Ga0373937_0029551 3300036401 Bacteria 4964
281 Ga0373937_0248879 3300036401 Bacteria 1675
282 Ga0373937_0500714 3300036401 Bacteria 1154
283 Ga0436363_0229679 3300039450 Bacteria 2110
284 Ga0453683_0134984 3300044673 Bacteria 1556
285 Ga0451576_0048598 3300045051 Bacteria 4455
286 Ga0495629_0276002 3300046459 Bacteria 1154
287 Ga0495580_0203482 3300046472 Bacteria 1364
288 Ga0495639_0207372 3300046475 Bacteria 961
289 Ga0495618_0138992 3300046514 Bacteria 1554
290 Ga0495630_0261287 3300046517 Bacteria 1323
291 Ga0495642_0182791 3300046528 Archaea 913
292 Ga0495652_0114707 3300046529 Bacteria 2161
293 Ga0495640_0095241 3300046533 Unclassified 1960
294 Ga0495586_0178833 3300046535 Bacteria 1200
295 Ga0495621_0012321 3300046539 Bacteria 2665
296 Ga0495645_0010931 3300046543 Bacteria 6377
297 Ga0495645_0083636 3300046543 Bacteria 2287
298 Ga0495667_0146866 3300046559 Bacteria 1519
299 Ga0495635_0094910 3300046663 Unclassified 2039
300 Ga0495658_0102794 3300046683 Bacteria 1708
301 Ga0495658_0177916 3300046683 Bacteria 1319
302 Ga0495613_0170878 3300046689 Bacteria 1543
303 Ga0495674_0371217 3300047319 Unclassified 1159
304 Ga0496100_0041943 3300048903 Bacteria 2920
305 Ga0496100_0079009 3300048903 Bacteria 2216
306 Ga0496101_0004060 3300048904 Bacteria 9149
307 Ga0496102_0140151 3300048905 Bacteria 2267
308 Ga0496102_0147509 3300048905 Bacteria 2209
309 Ga0496102_0251390 3300048905 Bacteria 1667
310 Ga0496104_0039457 3300048907 Bacteria 4421
311 Ga0496105_0029628 3300048908 Bacteria 4481
312 Ga0496108_0016040 3300048911 Bacteria 6109
313 Ga0496109_0666343 3300048912 Bacteria 978
314 Ga0496112_0013902 3300048915 Bacteria 7447
315 Ga0496112_0619169 3300048915 Bacteria 1014
316 Ga0496112_0693801 3300048915 Bacteria 946
317 Ga0496114_0000095 3300048917 Bacteria 63591
318 Ga0496115_0321968 3300048918 Bacteria 1264
319 Ga0501069_0512222 3300049585 Bacteria 716
320 nmdc:mga05p37_207080_c1 3300050507 Unclassified 2372
321 nmdc:mga05p37_44056_c1 3300050507 Bacteria 5490
322 nmdc:mga05p37_92418_c1 3300050507 Unclassified 3728
323 nmdc:mga09592_418873_c1 3300050508 Bacteria 1157
324 nmdc:mga06r32_171366_c1 3300050510 Unclassified 2154
325 nmdc:mga06r32_436375_c1 3300050510 Bacteria 1290
326 nmdc:mga06r32_71354_c1 3300050510 Bacteria 3360
327 nmdc:mga08y16_20954_c1 3300050511 Bacteria 6901
328 nmdc:mga08y16_224729_c1 3300050511 Bacteria 1943
329 nmdc:mga08y16_90334_c1 3300050511 Bacteria 3193
330 nmdc:mga0n895_60_c1 3300050512 Bacteria 63557
331 nmdc:mga0n895_9089_c1 3300050512 Bacteria 8669
332 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
333 nmdc:mga0rr50_301835_c1 3300050513 Bacteria 1340
334 nmdc:mga0rr50_45763_c1 3300050513 Bacteria 3219
335 nmdc:mga0rr50_581767_c1 3300050513 Bacteria 954
336 nmdc:mga08x19_11701_c1 3300050514 Bacteria 5285
337 nmdc:mga08x19_16952_c1 3300050514 Bacteria 4451
338 nmdc:mga08x19_34859_c1 3300050514 Bacteria 3183
339 nmdc:mga08x19_797_c1 3300050514 Bacteria 20114
340 nmdc:mga0a205_228658_c1 3300050515 Bacteria 1744
341 nmdc:mga0a205_49885_c1 3300050515 Bacteria 4041
342 nmdc:mga0a205_54187_c1 3300050515 Bacteria 3872
343 Ga0495601_0105144 3300053077 Bacteria 1825
344 Ga0495601_0127696 3300053077 Bacteria 1655
345 Ga0495601_0158960 3300053077 Unclassified 1477
346 Ga0495619_0045957 3300053085 Bacteria 2870
347 Ga0495619_0381872 3300053085 Bacteria 973
348 Ga0500578_0283697 3300053086 Unclassified 987
349 Ga0068858_100049899
350 Ga0070676_10007403
351 Ga0070676_10431392
352 Ga0070683_100213709
353 Ga0070690_100133117
354 Ga0070670_100637598
355 Ga0070670_100769906
356 Ga0070677_10049316
357 Ga0068869_100185870
358 Ga0068869_100277141
359 Ga0068869_100331198
360 Ga0068868_100093875
361 Ga0068868_100484612
362 Ga0070660_100025604
363 Ga0070691_10009156
364 Ga0070687_100033779
365 Ga0070687_100062645
366 Ga0070692_10046989
367 Ga0070668_100268114
368 Ga0070668_100420870
369 Ga0070669_100015329
370 Ga0070675_100001170
371 Ga0070675_100019625
372 Ga0070674_100160073
373 Ga0070674_100570701
374 Ga0070673_100092340
375 Ga0070659_100291941
376 Ga0070709_10005873
377 Ga0070709_10035559
378 Ga0070714_100009662
379 Ga0070713_100040524
380 Ga0070705_100006075
381 Ga0070705_100247224
382 Ga0070705_100273067
383 Ga0070700_100006817
384 Ga0070708_100086142
385 Ga0070678_100005063
386 Ga0070662_100320364
387 Ga0070681_10047275
388 Ga0068867_100365857
389 Ga0070685_10297360
390 Ga0070706_100562868
391 Ga0070707_100157177
392 Ga0070707_100454744
393 Ga0070707_100507821
394 Ga0070707_100581787
395 Ga0070698_100134096
396 Ga0070699_100009868
397 Ga0070699_100031862
398 Ga0070699_100063835
399 Ga0070699_100269715
400 Ga0070699_100658884
401 Ga0070679_100034560
402 Ga0070679_100126859
403 Ga0070684_100211388
404 Ga0070697_100019516
405 Ga0070697_100397438
406 Ga0068853_100096682
407 Ga0070686_100018520
408 Ga0070686_100115990
409 Ga0070695_100072891
410 Ga0070695_100166826
411 Ga0070696_100013071
412 Ga0070665_100005241
413 Ga0070665_100018833
414 Ga0070665_101261582
415 Ga0070704_100131326
416 Ga0068855_100019249
417 Ga0068855_100799293
418 Ga0070664_100566293
419 Ga0068854_100002897
420 Ga0068854_100017853
421 Ga0068856_100043810
422 Ga0068864_100007546
423 Ga0068864_100099762
424 Ga0068864_100242471
425 Ga0068864_100484804
426 Ga0068866_10061839
427 Ga0068861_100021856
428 Ga0068861_100023775
429 Ga0068861_100316148
430 Ga0068863_100145215
431 Ga0068863_100657086
432 Ga0068858_100003422
433 Ga0068858_100169868
434 Ga0068858_100629568
435 Ga0068858_100897777
436 Ga0068860_100160030
437 Ga0068860_100806937
438 Ga0068862_100061329
439 Ga0068862_100232921
440 Ga0068862_101091456
441 Ga0081455_10112737
442 Ga0081539_10012058
443 Ga0070717_10199459
444 Ga0070716_100223866
445 Ga0097621_100013567
446 Ga0097621_100043707
447 Ga0097621_101115325
448 Ga0068871_100038586
449 Ga0068871_100077888
450 Ga0068871_100291065
451 Ga0075428_100420568
452 Ga0075431_100109941
453 Ga0075431_100117832
454 Ga0075433_10010014
455 Ga0075434_100020265
456 Ga0075434_100127934
457 Ga0075434_100378348
458 Ga0075434_100413675
459 Ga0075429_100142972
460 Ga0068865_100009539
461 Ga0068865_100464430
462 Ga0075436_100001084
463 Ga0075436_100002257
464 Ga0075436_100082833
465 Ga0075436_100130183
466 Ga0075435_100000002
467 Ga0075435_100000431
468 Ga0075435_100020366
469 Ga0075435_100032091
470 Ga0075435_100082567
471 Ga0075435_100417707
472 Ga0105240_10010460
473 Ga0105240_10034458
474 Ga0105240_10638013
475 Ga0105240_10699841
476 Ga0111539_10012122
477 Ga0111539_10042427
478 Ga0111539_10279349
479 Ga0105245_10081267
480 Ga0105247_10002504
481 Ga0105247_10002788
482 Ga0105247_10491348
483 Ga0114129_10010951
484 Ga0114129_10013026
485 Ga0114129_10020723
486 Ga0114129_10028567
487 Ga0114129_10167250
488 Ga0105243_10314832
489 Ga0105243_11259268
490 Ga0105241_10395447
491 Ga0105242_10001908
492 Ga0105242_10008504
493 Ga0105242_10166850
494 Ga0105242_10228189
495 Ga0105242_10242579
496 Ga0105242_10717285
497 Ga0105248_10023414
498 Ga0105248_10041606
499 Ga0105248_10086817
500 Ga0105248_10350715
501 Ga0105249_10020171
502 Ga0105249_10563472
503 Ga0105246_10573817
504 Ga0157374_10082552
505 Ga0157374_10272295
506 Ga0157375_10211721
507 Ga0163163_10167860
508 Ga0163163_10489793
509 Ga0157380_10862311
510 Ga0157379_10008630
511 Ga0157376_10032865
512 Ga0157376_10039094
513 Ga0163161_10654591
514 Ga0213874_10040407
515 Ga0207653_10064767
516 Ga0207682_10133600
517 Ga0207642_10043525
518 Ga0207710_10009990
519 Ga0207710_10019796
520 Ga0207680_10186141
521 Ga0207699_10049155
522 Ga0207645_10006075
523 Ga0207645_10151897
524 Ga0207707_10035729
525 Ga0207707_10491278
526 Ga0207695_10049535
527 Ga0207695_10605081
528 Ga0207663_10487200
529 Ga0207662_10049899
530 Ga0207657_10001907
531 Ga0207649_10117802
532 Ga0207646_10340368
533 Ga0207646_10481901
534 Ga0207681_10020638
535 Ga0207681_10211457
536 Ga0207650_10780170
537 Ga0207659_10005242
538 Ga0207659_10222582
539 Ga0207659_10302828
540 Ga0207687_10032512
541 Ga0207687_10264211
542 Ga0207687_10735389
543 Ga0207700_10030725
544 Ga0207700_10165510
545 Ga0207664_10380206
546 Ga0207644_10249944
547 Ga0207690_10542618
548 Ga0207706_10174986
549 Ga0207686_10064095
550 Ga0207686_10124402
551 Ga0207686_10301867
552 Ga0207704_10026085
553 Ga0207665_10137051
554 Ga0207711_10183206
555 Ga0207711_10214390
556 Ga0207711_10220369
557 Ga0207711_10264503
558 Ga0207711_10297043
559 Ga0207689_10157296
560 Ga0207689_10376521
561 Ga0207689_10398004
562 Ga0207679_10212005
563 Ga0207667_10072572
564 Ga0207667_10236922
565 Ga0207651_10010287
566 Ga0207651_10097809
567 Ga0207668_10195794
568 Ga0207640_10005528
569 Ga0207640_10053506
570 Ga0207640_10305991
571 Ga0207677_10030411
572 Ga0207703_10009580
573 Ga0207703_10040500
574 Ga0207703_10137905
575 Ga0207703_10143560
576 Ga0207703_10784791
577 Ga0207708_10000441
578 Ga0207708_10094559
579 Ga0207702_10018137
580 Ga0207641_10073506
581 Ga0207648_10008974
582 Ga0207648_10439265
583 Ga0207676_10349211
584 Ga0207676_10408659
585 Ga0207674_10257822
586 Ga0207674_10391397
587 Ga0207675_100000931
588 Ga0207675_100070034
589 Ga0207683_10056611
590 Ga0207683_10181655
591 Ga0207428_10054112
592 Ga0207428_10078309
593 Ga0268266_10010160
594 Ga0268266_10203785
595 Ga0268265_10430322
596 Ga0268265_10515069
597 Ga0268264_10099920
598 Ga0268264_10274040
599 Ga0307416_100171950
600 Ga0373948_0002515
601 Ga0373948_0025486
602 Ga0373959_0002447
603 Ga0373938_0001204
604 Ga0373928_0018576
605 Ga0373929_0003705
606 Ga0373940_0000561
607 Ga0373949_0003799
608 Ga0373951_0002304
609 Ga0373952_0002653
610 Ga0373932_0001211
611 Ga0373936_0000007
612 Ga0373936_0174265
613 Ga0373939_0003557
614 Ga0373941_0001700
615 Ga0373953_0402156
616 Ga0373954_0222642
617 Ga0373956_0053110
618 Ga0373960_0001225
619 Ga0373946_0060258
620 Ga0373955_0067734
621 Ga0373942_0030412
622 Ga0373961_0001442
623 Ga0373962_0025584
624 Ga0373931_0114432
625 Ga0373931_0321529
626 Ga0373933_0113804
627 Ga0373947_0181456
628 Ga0373937_0029551
629 Ga0373937_0248879
630 Ga0373937_0500714
631 Ga0436363_0229679
632 Ga0453683_0134984
633 Ga0451576_0048598
634 Ga0495629_0276002
635 Ga0495580_0203482
636 Ga0495639_0207372
637 Ga0495618_0138992
638 Ga0495630_0261287
639 Ga0495642_0182791
640 Ga0495652_0114707
641 Ga0495640_0095241
642 Ga0495586_0178833
643 Ga0495621_0012321
644 Ga0495645_0010931
645 Ga0495645_0083636
646 Ga0495667_0146866
647 Ga0495635_0094910
648 Ga0495658_0102794
649 Ga0495658_0177916
650 Ga0495613_0170878
651 Ga0495674_0371217
652 Ga0496100_0041943
653 Ga0496100_0079009
654 Ga0496101_0004060
655 Ga0496102_0140151
656 Ga0496102_0147509
657 Ga0496102_0251390
658 Ga0496104_0039457
659 Ga0496105_0029628
660 Ga0496108_0016040
661 Ga0496109_0666343
662 Ga0496112_0013902
663 Ga0496112_0619169
664 Ga0496112_0693801
665 Ga0496114_0000095
666 Ga0496115_0321968
667 Ga0501069_0512222
668 nmdc:mga05p37_207080_c1
669 nmdc:mga05p37_44056_c1
670 nmdc:mga05p37_92418_c1
671 nmdc:mga09592_418873_c1
672 nmdc:mga06r32_171366_c1
673 nmdc:mga06r32_436375_c1
674 nmdc:mga06r32_71354_c1
675 nmdc:mga08y16_20954_c1
676 nmdc:mga08y16_224729_c1
677 nmdc:mga08y16_90334_c1
678 nmdc:mga0n895_60_c1
679 nmdc:mga0n895_9089_c1
680 nmdc:mga0rr50_27_c1
681 nmdc:mga0rr50_301835_c1
682 nmdc:mga0rr50_45763_c1
683 nmdc:mga0rr50_581767_c1
684 nmdc:mga08x19_11701_c1
685 nmdc:mga08x19_16952_c1
686 nmdc:mga08x19_34859_c1
687 nmdc:mga08x19_797_c1
688 nmdc:mga0a205_228658_c1
689 nmdc:mga0a205_49885_c1
690 nmdc:mga0a205_54187_c1
691 Ga0495601_0105144
692 Ga0495601_0127696
693 Ga0495601_0158960
694 Ga0495619_0045957
695 Ga0495619_0381872
696 Ga0500578_0283697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5217 9 214
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.5017 9 214
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.4891 6 215
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.4835 5 215
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.4722 5 215
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6328 39 209 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6204 39 209 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5776 7 212 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5408 7 212 1.20.1250.20
af_A0A1D8PNP7_69_490_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5118 40 216 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A538R6L9-F1-model_v4 Urease accessory protein UreH 0.9254 7 176 GO:0016020
AF-A0A538R071-F1-model_v4 Nickel/cobalt efflux system 0.922 7 214 GO:0016020
AF-A0A3G3K0P7-F1-model_v4 Urease accessory protein UreH 0.9211 5 215 GO:0016020
AF-A0A5R9FCZ3-F1-model_v4 Urease accessory protein UreH 0.9198 6 215 GO:0016020
AF-A0A554L1I8-F1-model_v4 Nickel/cobalt efflux system 0.916 6 214 GO:0005886
GO:0012505
GO:0015099

Map