F417439

General Info

Members Datasets Scaffolds Average Seq Length
348 196 696 280

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100036631|Ga0070705_1000366312
Length 321
Sequence VNSDPIAAVTPTTPTATETAAPPPVRTRASDGGEDVLTVDAAARAARDSGLATDIPFGSTVIEVRDLGVRYSLRLTRKNTVRQTFTNMFRRRDGPKDFWALHNVSFRLVSGESLAIIGPNGAGKSTLLQVLAGIIVPSAGALSVRGRISSLLTLGAGFDGELSGRENILLAGAFMGMSDEELKDRVEHIVAFADIGEFIDAAIKTYSSGMRARLGFAIATSVDPDVLLLDEVLATGDQVFRAKSRARVGELVKQAKGIVLVTHDMTWVTEYCNRAILLEKGRIIIEGEPAEVVAVHQEHSAEAKARQAEEIARYGGAITRR

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.77
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100036631 3300005440 Bacteria 2760
2 Ga0070683_100123700 3300005329 Bacteria 2445
3 Ga0070670_100124969 3300005331 Bacteria 2220
4 Ga0070666_10385321 3300005335 Bacteria 1006
5 Ga0070682_100006743 3300005337 Bacteria 6443
6 Ga0068868_100038964 3300005338 Bacteria 3690
7 Ga0068868_100267726 3300005338 Bacteria 1443
8 Ga0070660_100054243 3300005339 Bacteria 3095
9 Ga0070689_100051021 3300005340 Bacteria 3196
10 Ga0070687_100038195 3300005343 Bacteria 2405
11 Ga0070661_100052670 3300005344 Bacteria 2979
12 Ga0070675_100010469 3300005354 Bacteria 7244
13 Ga0070674_100002428 3300005356 Bacteria 10302
14 Ga0070674_100040437 3300005356 Bacteria 3155
15 Ga0070674_100411005 3300005356 Bacteria 1108
16 Ga0070659_100003400 3300005366 Bacteria 11335
17 Ga0070659_100188671 3300005366 Bacteria 1694
18 Ga0070711_100249216 3300005439 Bacteria 1392
19 Ga0070705_100014471 3300005440 Bacteria 4059
20 Ga0070705_100215242 3300005440 Bacteria 1327
21 Ga0070700_100171135 3300005441 Bacteria 1504
22 Ga0070694_100015642 3300005444 Bacteria 4768
23 Ga0070694_100147459 3300005444 Bacteria 1715
24 Ga0070708_100000353 3300005445 Bacteria 34792
25 Ga0070708_100004903 3300005445 Bacteria 10568
26 Ga0070708_100036019 3300005445 Bacteria 4314
27 Ga0070708_100446422 3300005445 Bacteria 1220
28 Ga0070663_100005794 3300005455 Bacteria 7378
29 Ga0070678_100032196 3300005456 Bacteria 3627
30 Ga0070662_100030380 3300005457 Bacteria 3780
31 Ga0070681_10112263 3300005458 Bacteria 2665
32 Ga0070681_10172574 3300005458 Bacteria 2084
33 Ga0068867_100069088 3300005459 Bacteria 2638
34 Ga0070706_100000142 3300005467 Bacteria 90715
35 Ga0070706_100011611 3300005467 Bacteria 8186
36 Ga0070706_100081066 3300005467 Bacteria 3005
37 Ga0070706_100242577 3300005467 Bacteria 1682
38 Ga0070706_100267815 3300005467 Bacteria 1594
39 Ga0070707_100002530 3300005468 Bacteria 17394
40 Ga0070707_100005062 3300005468 Bacteria 12357
41 Ga0070707_100018847 3300005468 Bacteria 6498
42 Ga0070707_100022681 3300005468 Bacteria 5935
43 Ga0070707_100078140 3300005468 Bacteria 3193
44 Ga0070698_100005184 3300005471 Bacteria 14252
45 Ga0070698_100044620 3300005471 Bacteria 4538
46 Ga0070698_100048078 3300005471 Bacteria 4359
47 Ga0070698_100236100 3300005471 Bacteria 1761
48 Ga0070699_100002714 3300005518 Bacteria 15785
49 Ga0070699_100002945 3300005518 Bacteria 15137
50 Ga0070699_100004471 3300005518 Bacteria 12361
51 Ga0070679_100296165 3300005530 Bacteria 1569
52 Ga0070697_100017060 3300005536 Bacteria 5711
53 Ga0070697_100018014 3300005536 Bacteria 5565
54 Ga0070697_100020027 3300005536 Bacteria 5287
55 Ga0070697_100190731 3300005536 Bacteria 1739
56 Ga0070672_100095194 3300005543 Bacteria 2408
57 Ga0070686_100031990 3300005544 Bacteria 3223
58 Ga0070695_100009975 3300005545 Bacteria 5663
59 Ga0070695_100052936 3300005545 Bacteria 2610
60 Ga0070696_100004169 3300005546 Bacteria 9632
61 Ga0070696_100020563 3300005546 Bacteria 4472
62 Ga0070696_100034938 3300005546 Bacteria 3460
63 Ga0070696_100039341 3300005546 Bacteria 3265
64 Ga0070696_100062304 3300005546 Bacteria 2610
65 Ga0070693_100037413 3300005547 Bacteria 2706
66 Ga0070665_100693860 3300005548 Bacteria 1031
67 Ga0070704_100041419 3300005549 Bacteria 3178
68 Ga0070704_100041671 3300005549 Bacteria 3171
69 Ga0070704_100217964 3300005549 Bacteria 1550
70 Ga0068855_100018792 3300005563 Bacteria 8307
71 Ga0070664_100035537 3300005564 Bacteria 4183
72 Ga0068854_100118812 3300005578 Bacteria 2004
73 Ga0070702_100015087 3300005615 Bacteria 3936
74 Ga0068859_100097201 3300005617 Bacteria 2998
75 Ga0068859_100116822 3300005617 Bacteria 2732
76 Ga0068864_100011903 3300005618 Bacteria 7183
77 Ga0068864_100057285 3300005618 Bacteria 3366
78 Ga0068866_10113771 3300005718 Bacteria 1514
79 Ga0068861_100477178 3300005719 Bacteria 1123
80 Ga0068870_10039025 3300005840 Bacteria 2455
81 Ga0068863_100059100 3300005841 Bacteria 3628
82 Ga0068858_100129645 3300005842 Bacteria 2364
83 Ga0068858_100383436 3300005842 Bacteria 1349
84 Ga0068860_100069448 3300005843 Bacteria 3348
85 Ga0068860_100080300 3300005843 Bacteria 3102
86 Ga0068862_100184250 3300005844 Bacteria 1875
87 Ga0081539_10032518 3300005985 Bacteria 3194
88 Ga0070716_100089315 3300006173 Bacteria 1861
89 Ga0097621_100534031 3300006237 Bacteria 1066
90 Ga0075428_100277979 3300006844 Bacteria 1802
91 Ga0075433_10075190 3300006852 Bacteria 2972
92 Ga0075433_10097236 3300006852 Bacteria 2606
93 Ga0075434_100178922 3300006871 Bacteria 2140
94 Ga0068865_100006886 3300006881 Bacteria 6966
95 Ga0068865_100292736 3300006881 Bacteria 1300
96 Ga0097620_100097201 3300006931 Bacteria 2998
97 Ga0097620_100116819 3300006931 Bacteria 2732
98 Ga0075435_100020220 3300007076 Bacteria 5096
99 Ga0105244_10046881 3300009036 Bacteria 2218
100 Ga0111539_10127581 3300009094 Bacteria 2980
101 Ga0105245_10005805 3300009098 Bacteria 10830
102 Ga0105245_10031510 3300009098 Bacteria 4693
103 Ga0105245_10082197 3300009098 Bacteria 2946
104 Ga0114129_10104403 3300009147 Bacteria 3916
105 Ga0114129_10174612 3300009147 Bacteria 2927
106 Ga0114129_10188826 3300009147 Bacteria 2799
107 Ga0114129_10221276 3300009147 Bacteria 2553
108 Ga0114129_10222400 3300009147 Bacteria 2546
109 Ga0114129_10329007 3300009147 Bacteria 2029
110 Ga0105243_10138808 3300009148 Bacteria 2071
111 Ga0105243_10150287 3300009148 Bacteria 1997
112 Ga0105243_10558936 3300009148 Bacteria 1095
113 Ga0105241_10574652 3300009174 Bacteria 1015
114 Ga0105242_10278104 3300009176 Bacteria 1519
115 Ga0105242_10356403 3300009176 Bacteria 1353
116 Ga0105238_10032892 3300009551 Bacteria 5280
117 Ga0105249_10025690 3300009553 Bacteria 5304
118 Ga0105249_10232744 3300009553 Bacteria 1818
119 Ga0105249_10282886 3300009553 Bacteria 1657
120 Ga0105239_10005359 3300010375 Bacteria 15056
121 Ga0105239_10123495 3300010375 Bacteria 2877
122 Ga0105246_10010621 3300011119 Bacteria 5704
123 Ga0105246_10043509 3300011119 Bacteria 3048
124 Ga0157378_10135384 3300013297 Bacteria 2284
125 Ga0157378_10410002 3300013297 Bacteria 1337
126 Ga0163162_10090375 3300013306 Bacteria 3143
127 Ga0163162_10590845 3300013306 Bacteria 1237
128 Ga0157375_10078870 3300013308 Bacteria 3327
129 Ga0157375_10389861 3300013308 Bacteria 1560
130 Ga0163163_10015197 3300014325 Bacteria 7110
131 Ga0163163_10214060 3300014325 Bacteria 1976
132 Ga0157380_10007740 3300014326 Bacteria 7649
133 Ga0157380_10576839 3300014326 Bacteria 1108
134 Ga0157377_10002374 3300014745 Bacteria 8304
135 Ga0157379_10003133 3300014968 Bacteria 13994
136 Ga0157379_10036027 3300014968 Bacteria 4412
137 Ga0157379_10089544 3300014968 Bacteria 2760
138 Ga0157379_10278450 3300014968 Bacteria 1522
139 Ga0163161_10039004 3300017792 Bacteria 3408
140 Ga0207688_10011540 3300025901 Bacteria 4808
141 Ga0207643_10019583 3300025908 Bacteria 3710
142 Ga0207684_10001858 3300025910 Bacteria 21997
143 Ga0207684_10010135 3300025910 Bacteria 8300
144 Ga0207684_10036149 3300025910 Bacteria 4192
145 Ga0207684_10122030 3300025910 Bacteria 2234
146 Ga0207660_10000003 3300025917 Bacteria 675759
147 Ga0207662_10022078 3300025918 Bacteria 3643
148 Ga0207657_10058072 3300025919 Bacteria 3331
149 Ga0207649_10112035 3300025920 Bacteria 1825
150 Ga0207646_10003606 3300025922 Bacteria 17359
151 Ga0207646_10029770 3300025922 Bacteria 4957
152 Ga0207646_10034186 3300025922 Bacteria 4595
153 Ga0207646_10038045 3300025922 Bacteria 4335
154 Ga0207646_10113356 3300025922 Bacteria 2434
155 Ga0207659_10011167 3300025926 Bacteria 5666
156 Ga0207687_10047690 3300025927 Bacteria 2970
157 Ga0207706_10014967 3300025933 Bacteria 7024
158 Ga0207706_10132677 3300025933 Bacteria 2191
159 Ga0207686_10386541 3300025934 Bacteria 1063
160 Ga0207709_10112931 3300025935 Bacteria 1820
161 Ga0207709_10118152 3300025935 Bacteria 1786
162 Ga0207709_10119960 3300025935 Bacteria 1774
163 Ga0207670_10119773 3300025936 Bacteria 1911
164 Ga0207669_10000991 3300025937 Bacteria 12084
165 Ga0207669_10065713 3300025937 Bacteria 2251
166 Ga0207704_10017870 3300025938 Bacteria 3688
167 Ga0207665_10115907 3300025939 Bacteria 1888
168 Ga0207691_10111932 3300025940 Bacteria 2427
169 Ga0207711_10039884 3300025941 Bacteria 3995
170 Ga0207689_10055782 3300025942 Bacteria 3251
171 Ga0207667_10056722 3300025949 Bacteria 4114
172 Ga0207712_10005580 3300025961 Bacteria 7935
173 Ga0207712_10288966 3300025961 Bacteria 1341
174 Ga0207640_10202924 3300025981 Bacteria 1504
175 Ga0207677_10018048 3300026023 Bacteria 4226
176 Ga0207677_10034140 3300026023 Bacteria 3291
177 Ga0207677_10147267 3300026023 Bacteria 1811
178 Ga0207677_10412796 3300026023 Bacteria 1148
179 Ga0207703_10015334 3300026035 Bacteria 5978
180 Ga0207678_10008377 3300026067 Bacteria 9121
181 Ga0207708_10298623 3300026075 Bacteria 1309
182 Ga0207708_10305218 3300026075 Bacteria 1295
183 Ga0207641_10462941 3300026088 Bacteria 1227
184 Ga0207648_10336059 3300026089 Bacteria 1360
185 Ga0207676_10068908 3300026095 Bacteria 2831
186 Ga0207674_10021555 3300026116 Bacteria 6937
187 Ga0207675_100118112 3300026118 Bacteria 2507
188 Ga0207675_100447085 3300026118 Bacteria 1280
189 Ga0207683_10019258 3300026121 Bacteria 5828
190 Ga0207428_10068857 3300027907 Bacteria 2783
191 Ga0207428_10085331 3300027907 Bacteria 2459
192 Ga0268264_10285371 3300028381 Bacteria 1548
193 Ga0265319_1035469 3300028563 Bacteria 1711
194 Ga0265318_10067369 3300028577 Bacteria 1329
195 Ga0265322_10078596 3300028654 Bacteria 936
196 Ga0265336_10076646 3300028666 Bacteria 999
197 Ga0265324_10049670 3300029957 Bacteria 1442
198 Ga0265324_10088827 3300029957 Bacteria 1051
199 Ga0265320_10016614 3300031240 Bacteria 4118
200 Ga0265325_10005367 3300031241 Bacteria 7929
201 Ga0265325_10127065 3300031241 Bacteria 1224
202 Ga0265331_10132400 3300031250 Bacteria 1137
203 Ga0265316_10116700 3300031344 Bacteria 2018
204 Ga0307408_100148915 3300031548 Bacteria 1846
205 Ga0265313_10063216 3300031595 Bacteria 1726
206 Ga0265314_10214199 3300031711 Bacteria 1129
207 Ga0307413_10153632 3300031824 Bacteria 1607
208 Ga0307412_10227964 3300031911 Bacteria 1433
209 Ga0307409_100137543 3300031995 Bacteria 2099
210 Ga0307416_100032103 3300032002 Bacteria 3963
211 Ga0307416_100356775 3300032002 Bacteria 1482
212 Ga0307416_100641243 3300032002 Bacteria 1146
213 Ga0307411_10118847 3300032005 Bacteria 1908
214 Ga0307415_100025944 3300032126 Bacteria 3688
215 Ga0307415_100032217 3300032126 Bacteria 3387
216 Ga0373941_0037308 3300035115 Bacteria 1483
217 Ga0316574_0027743 3300035398 Bacteria 3412
218 Ga0373937_0286911 3300036401 Bacteria 1555
219 Ga0373937_0410389 3300036401 Bacteria 1285
220 Ga0450920_007304 3300042122 Bacteria 2001
221 Ga0450910_001040 3300042147 Bacteria 3392
222 Ga0453683_0045420 3300044673 Bacteria 2755
223 Ga0453683_0247047 3300044673 Bacteria 1137
224 Ga0466960_0082065 3300044901 Bacteria 1627
225 Ga0451576_0392538 3300045051 Bacteria 1455
226 Ga0495641_0071957 3300046461 Bacteria 1552
227 Ga0495582_0219096 3300046473 Bacteria 1089
228 Ga0495584_0247176 3300046491 Bacteria 907
229 Ga0495618_0169076 3300046514 Bacteria 1392
230 Ga0495628_0138948 3300046516 Bacteria 1855
231 Ga0495630_0059607 3300046517 Bacteria 2864
232 Ga0495634_0169054 3300046642 Bacteria 1375
233 Ga0495634_0225157 3300046642 Bacteria 1156
234 Ga0495635_0055079 3300046663 Bacteria 2740
235 Ga0495599_0267511 3300046678 Bacteria 1038
236 Ga0495674_0363024 3300047319 Bacteria 1174
237 Ga0495684_0162913 3300047471 Bacteria 1663
238 Ga0496101_0114742 3300048904 Bacteria 2031
239 Ga0496102_0015044 3300048905 Bacteria 6735
240 Ga0496102_0046695 3300048905 Bacteria 3933
241 Ga0496102_0084966 3300048905 Bacteria 2922
242 Ga0496102_0172698 3300048905 Bacteria 2035
243 Ga0496102_0601430 3300048905 Bacteria 1023
244 Ga0496103_0030704 3300048906 Bacteria 3271
245 Ga0496105_0206613 3300048908 Bacteria 1602
246 Ga0496106_0059833 3300048909 Bacteria 2887
247 Ga0496106_0105055 3300048909 Bacteria 2194
248 Ga0496106_0159201 3300048909 Bacteria 1785
249 Ga0496106_0451420 3300048909 Bacteria 1033
250 Ga0496107_0195731 3300048910 Bacteria 1502
251 Ga0496108_0040113 3300048911 Bacteria 3902
252 Ga0496108_0050267 3300048911 Bacteria 3489
253 Ga0496109_0019504 3300048912 Bacteria 5984
254 Ga0496109_0022482 3300048912 Bacteria 5586
255 Ga0496109_0043409 3300048912 Bacteria 4075
256 Ga0496109_0208130 3300048912 Bacteria 1839
257 Ga0496109_0277066 3300048912 Bacteria 1581
258 Ga0496109_0456010 3300048912 Bacteria 1207
259 Ga0496110_0004361 3300048913 Bacteria 10953
260 Ga0496110_0074963 3300048913 Bacteria 3006
261 Ga0496110_0598230 3300048913 Bacteria 1001
262 Ga0496111_0175284 3300048914 Bacteria 1594
263 Ga0496112_0000001 3300048915 Bacteria 1346031
264 Ga0496112_0283616 3300048915 Bacteria 1603
265 Ga0496112_0310807 3300048915 Bacteria 1521
266 Ga0496112_0348663 3300048915 Bacteria 1423
267 Ga0496113_0040881 3300048916 Bacteria 3419
268 Ga0496113_0070373 3300048916 Bacteria 2659
269 Ga0496113_0309095 3300048916 Bacteria 1266
270 Ga0496114_0163155 3300048917 Bacteria 1939
271 Ga0496114_0513579 3300048917 Bacteria 1060
272 Ga0501032_0034779 3300049569 Bacteria 3447
273 Ga0501036_0025844 3300049572 Bacteria 4956
274 Ga0501036_0193675 3300049572 Bacteria 1710
275 Ga0501036_0562481 3300049572 Bacteria 947
276 Ga0501037_0018439 3300049573 Bacteria 5145
277 Ga0501037_0219248 3300049573 Bacteria 1339
278 Ga0501038_0056875 3300049574 Bacteria 3359
279 Ga0501039_0061957 3300049575 Bacteria 2897
280 Ga0501040_0031924 3300049576 Bacteria 3561
281 Ga0501040_0053339 3300049576 Bacteria 2769
282 Ga0501040_0057374 3300049576 Bacteria 2673
283 Ga0501041_0034275 3300049577 Bacteria 3073
284 Ga0501041_0270718 3300049577 Bacteria 1068
285 Ga0501042_0011356 3300049578 Bacteria 6008
286 Ga0501046_0363720 3300049580 Bacteria 1049
287 Ga0501048_0042050 3300049582 Bacteria 3273
288 Ga0501048_0231489 3300049582 Bacteria 1311
289 Ga0501067_0027816 3300049583 Bacteria 3133
290 Ga0501068_0085578 3300049584 Bacteria 1940
291 Ga0501069_0053220 3300049585 Bacteria 2254
292 Ga0501069_0085882 3300049585 Bacteria 1776
293 Ga0501069_0186141 3300049585 Bacteria 1201
294 Ga0501071_0125910 3300049587 Bacteria 1901
295 Ga0501071_0205260 3300049587 Bacteria 1481
296 Ga0501072_0025864 3300049588 Bacteria 4574
297 Ga0501072_0034361 3300049588 Bacteria 3973
298 Ga0501072_0036757 3300049588 Bacteria 3840
299 Ga0501072_0127998 3300049588 Bacteria 2023
300 Ga0501073_0083528 3300049589 Bacteria 2222
301 Ga0501074_0018320 3300049590 Bacteria 5086
302 Ga0501074_0050235 3300049590 Bacteria 3011
303 Ga0501074_0076855 3300049590 Bacteria 2396
304 Ga0501075_0042069 3300049591 Bacteria 3425
305 Ga0501075_0044290 3300049591 Bacteria 3339
306 Ga0501075_0374706 3300049591 Bacteria 1085
307 Ga0501076_0020569 3300049592 Bacteria 5052
308 Ga0501076_0133806 3300049592 Bacteria 2012
309 Ga0501076_0209004 3300049592 Bacteria 1594
310 Ga0501076_0218350 3300049592 Bacteria 1558
311 Ga0501076_0246191 3300049592 Bacteria 1462
312 Ga0501076_0429307 3300049592 Bacteria 1087
313 Ga0501079_0043103 3300049741 Bacteria 3482
314 Ga0501079_0185190 3300049741 Bacteria 1625
315 Ga0501080_0290709 3300049742 Bacteria 1484
316 Ga0501081_0064769 3300049743 Bacteria 2539
317 Ga0501081_0089306 3300049743 Bacteria 2166
318 Ga0501083_0121019 3300049744 Bacteria 1717
319 Ga0501035_0394523 3300049822 Bacteria 1152
320 Ga0501045_0010382 3300049824 Bacteria 6522
321 Ga0501045_0017218 3300049824 Bacteria 5129
322 Ga0501045_0035403 3300049824 Bacteria 3625
323 Ga0501045_0065665 3300049824 Bacteria 2664
324 nmdc:mga05p37_286059_c1 3300050507 Bacteria 1964
325 nmdc:mga05p37_82991_c1 3300050507 Unclassified 3949
326 nmdc:mga06r32_236407_c1 3300050510 Bacteria 1814
327 nmdc:mga08y16_20575_c1 3300050511 Bacteria 6966
328 nmdc:mga08y16_524702_c1 3300050511 Bacteria 1201
329 nmdc:mga08y16_94628_c1 3300050511 Bacteria 3112
330 nmdc:mga0n895_461531_c1 3300050512 Bacteria 1282
331 nmdc:mga0a205_267569_c1 3300050515 Unclassified 1586
332 nmdc:mga0a205_69432_c1 3300050515 Bacteria 3402
333 Ga0495601_0058633 3300053077 Bacteria 2440
334 Ga0495619_0139215 3300053085 Bacteria 1670
335 Ga0501084_0031906 3300054114 Bacteria 4406
336 Ga0501084_0082479 3300054114 Bacteria 2698
337 Ga0501084_0083662 3300054114 Bacteria 2678
338 Ga0501084_0184505 3300054114 Bacteria 1761
339 Ga0501084_0489824 3300054114 Bacteria 1039
340 Ga0501082_0058592 3300060353 Bacteria 3318
341 Ga0501082_0090272 3300060353 Bacteria 2645
342 Ga0501082_0103130 3300060353 Bacteria 2468
343 Ga0501082_0252887 3300060353 Bacteria 1533
344 Ga0501082_0341493 3300060353 Bacteria 1305
345 Ga0501082_0499345 3300060353 Bacteria 1063
346 Ga0530510_0002553 3300061734 Bacteria 12513
347 Ga0530510_0060113 3300061734 Bacteria 2750
348 Ga0530510_0104444 3300061734 Bacteria 2073
349 Ga0070705_100036631
350 Ga0070683_100123700
351 Ga0070670_100124969
352 Ga0070666_10385321
353 Ga0070682_100006743
354 Ga0068868_100038964
355 Ga0068868_100267726
356 Ga0070660_100054243
357 Ga0070689_100051021
358 Ga0070687_100038195
359 Ga0070661_100052670
360 Ga0070675_100010469
361 Ga0070674_100002428
362 Ga0070674_100040437
363 Ga0070674_100411005
364 Ga0070659_100003400
365 Ga0070659_100188671
366 Ga0070711_100249216
367 Ga0070705_100014471
368 Ga0070705_100215242
369 Ga0070700_100171135
370 Ga0070694_100015642
371 Ga0070694_100147459
372 Ga0070708_100000353
373 Ga0070708_100004903
374 Ga0070708_100036019
375 Ga0070708_100446422
376 Ga0070663_100005794
377 Ga0070678_100032196
378 Ga0070662_100030380
379 Ga0070681_10112263
380 Ga0070681_10172574
381 Ga0068867_100069088
382 Ga0070706_100000142
383 Ga0070706_100011611
384 Ga0070706_100081066
385 Ga0070706_100242577
386 Ga0070706_100267815
387 Ga0070707_100002530
388 Ga0070707_100005062
389 Ga0070707_100018847
390 Ga0070707_100022681
391 Ga0070707_100078140
392 Ga0070698_100005184
393 Ga0070698_100044620
394 Ga0070698_100048078
395 Ga0070698_100236100
396 Ga0070699_100002714
397 Ga0070699_100002945
398 Ga0070699_100004471
399 Ga0070679_100296165
400 Ga0070697_100017060
401 Ga0070697_100018014
402 Ga0070697_100020027
403 Ga0070697_100190731
404 Ga0070672_100095194
405 Ga0070686_100031990
406 Ga0070695_100009975
407 Ga0070695_100052936
408 Ga0070696_100004169
409 Ga0070696_100020563
410 Ga0070696_100034938
411 Ga0070696_100039341
412 Ga0070696_100062304
413 Ga0070693_100037413
414 Ga0070665_100693860
415 Ga0070704_100041419
416 Ga0070704_100041671
417 Ga0070704_100217964
418 Ga0068855_100018792
419 Ga0070664_100035537
420 Ga0068854_100118812
421 Ga0070702_100015087
422 Ga0068859_100097201
423 Ga0068859_100116822
424 Ga0068864_100011903
425 Ga0068864_100057285
426 Ga0068866_10113771
427 Ga0068861_100477178
428 Ga0068870_10039025
429 Ga0068863_100059100
430 Ga0068858_100129645
431 Ga0068858_100383436
432 Ga0068860_100069448
433 Ga0068860_100080300
434 Ga0068862_100184250
435 Ga0081539_10032518
436 Ga0070716_100089315
437 Ga0097621_100534031
438 Ga0075428_100277979
439 Ga0075433_10075190
440 Ga0075433_10097236
441 Ga0075434_100178922
442 Ga0068865_100006886
443 Ga0068865_100292736
444 Ga0097620_100097201
445 Ga0097620_100116819
446 Ga0075435_100020220
447 Ga0105244_10046881
448 Ga0111539_10127581
449 Ga0105245_10005805
450 Ga0105245_10031510
451 Ga0105245_10082197
452 Ga0114129_10104403
453 Ga0114129_10174612
454 Ga0114129_10188826
455 Ga0114129_10221276
456 Ga0114129_10222400
457 Ga0114129_10329007
458 Ga0105243_10138808
459 Ga0105243_10150287
460 Ga0105243_10558936
461 Ga0105241_10574652
462 Ga0105242_10278104
463 Ga0105242_10356403
464 Ga0105238_10032892
465 Ga0105249_10025690
466 Ga0105249_10232744
467 Ga0105249_10282886
468 Ga0105239_10005359
469 Ga0105239_10123495
470 Ga0105246_10010621
471 Ga0105246_10043509
472 Ga0157378_10135384
473 Ga0157378_10410002
474 Ga0163162_10090375
475 Ga0163162_10590845
476 Ga0157375_10078870
477 Ga0157375_10389861
478 Ga0163163_10015197
479 Ga0163163_10214060
480 Ga0157380_10007740
481 Ga0157380_10576839
482 Ga0157377_10002374
483 Ga0157379_10003133
484 Ga0157379_10036027
485 Ga0157379_10089544
486 Ga0157379_10278450
487 Ga0163161_10039004
488 Ga0207688_10011540
489 Ga0207643_10019583
490 Ga0207684_10001858
491 Ga0207684_10010135
492 Ga0207684_10036149
493 Ga0207684_10122030
494 Ga0207660_10000003
495 Ga0207662_10022078
496 Ga0207657_10058072
497 Ga0207649_10112035
498 Ga0207646_10003606
499 Ga0207646_10029770
500 Ga0207646_10034186
501 Ga0207646_10038045
502 Ga0207646_10113356
503 Ga0207659_10011167
504 Ga0207687_10047690
505 Ga0207706_10014967
506 Ga0207706_10132677
507 Ga0207686_10386541
508 Ga0207709_10112931
509 Ga0207709_10118152
510 Ga0207709_10119960
511 Ga0207670_10119773
512 Ga0207669_10000991
513 Ga0207669_10065713
514 Ga0207704_10017870
515 Ga0207665_10115907
516 Ga0207691_10111932
517 Ga0207711_10039884
518 Ga0207689_10055782
519 Ga0207667_10056722
520 Ga0207712_10005580
521 Ga0207712_10288966
522 Ga0207640_10202924
523 Ga0207677_10018048
524 Ga0207677_10034140
525 Ga0207677_10147267
526 Ga0207677_10412796
527 Ga0207703_10015334
528 Ga0207678_10008377
529 Ga0207708_10298623
530 Ga0207708_10305218
531 Ga0207641_10462941
532 Ga0207648_10336059
533 Ga0207676_10068908
534 Ga0207674_10021555
535 Ga0207675_100118112
536 Ga0207675_100447085
537 Ga0207683_10019258
538 Ga0207428_10068857
539 Ga0207428_10085331
540 Ga0268264_10285371
541 Ga0265319_1035469
542 Ga0265318_10067369
543 Ga0265322_10078596
544 Ga0265336_10076646
545 Ga0265324_10049670
546 Ga0265324_10088827
547 Ga0265320_10016614
548 Ga0265325_10005367
549 Ga0265325_10127065
550 Ga0265331_10132400
551 Ga0265316_10116700
552 Ga0307408_100148915
553 Ga0265313_10063216
554 Ga0265314_10214199
555 Ga0307413_10153632
556 Ga0307412_10227964
557 Ga0307409_100137543
558 Ga0307416_100032103
559 Ga0307416_100356775
560 Ga0307416_100641243
561 Ga0307411_10118847
562 Ga0307415_100025944
563 Ga0307415_100032217
564 Ga0373941_0037308
565 Ga0316574_0027743
566 Ga0373937_0286911
567 Ga0373937_0410389
568 Ga0450920_007304
569 Ga0450910_001040
570 Ga0453683_0045420
571 Ga0453683_0247047
572 Ga0466960_0082065
573 Ga0451576_0392538
574 Ga0495641_0071957
575 Ga0495582_0219096
576 Ga0495584_0247176
577 Ga0495618_0169076
578 Ga0495628_0138948
579 Ga0495630_0059607
580 Ga0495634_0169054
581 Ga0495634_0225157
582 Ga0495635_0055079
583 Ga0495599_0267511
584 Ga0495674_0363024
585 Ga0495684_0162913
586 Ga0496101_0114742
587 Ga0496102_0015044
588 Ga0496102_0046695
589 Ga0496102_0084966
590 Ga0496102_0172698
591 Ga0496102_0601430
592 Ga0496103_0030704
593 Ga0496105_0206613
594 Ga0496106_0059833
595 Ga0496106_0105055
596 Ga0496106_0159201
597 Ga0496106_0451420
598 Ga0496107_0195731
599 Ga0496108_0040113
600 Ga0496108_0050267
601 Ga0496109_0019504
602 Ga0496109_0022482
603 Ga0496109_0043409
604 Ga0496109_0208130
605 Ga0496109_0277066
606 Ga0496109_0456010
607 Ga0496110_0004361
608 Ga0496110_0074963
609 Ga0496110_0598230
610 Ga0496111_0175284
611 Ga0496112_0000001
612 Ga0496112_0283616
613 Ga0496112_0310807
614 Ga0496112_0348663
615 Ga0496113_0040881
616 Ga0496113_0070373
617 Ga0496113_0309095
618 Ga0496114_0163155
619 Ga0496114_0513579
620 Ga0501032_0034779
621 Ga0501036_0025844
622 Ga0501036_0193675
623 Ga0501036_0562481
624 Ga0501037_0018439
625 Ga0501037_0219248
626 Ga0501038_0056875
627 Ga0501039_0061957
628 Ga0501040_0031924
629 Ga0501040_0053339
630 Ga0501040_0057374
631 Ga0501041_0034275
632 Ga0501041_0270718
633 Ga0501042_0011356
634 Ga0501046_0363720
635 Ga0501048_0042050
636 Ga0501048_0231489
637 Ga0501067_0027816
638 Ga0501068_0085578
639 Ga0501069_0053220
640 Ga0501069_0085882
641 Ga0501069_0186141
642 Ga0501071_0125910
643 Ga0501071_0205260
644 Ga0501072_0025864
645 Ga0501072_0034361
646 Ga0501072_0036757
647 Ga0501072_0127998
648 Ga0501073_0083528
649 Ga0501074_0018320
650 Ga0501074_0050235
651 Ga0501074_0076855
652 Ga0501075_0042069
653 Ga0501075_0044290
654 Ga0501075_0374706
655 Ga0501076_0020569
656 Ga0501076_0133806
657 Ga0501076_0209004
658 Ga0501076_0218350
659 Ga0501076_0246191
660 Ga0501076_0429307
661 Ga0501079_0043103
662 Ga0501079_0185190
663 Ga0501080_0290709
664 Ga0501081_0064769
665 Ga0501081_0089306
666 Ga0501083_0121019
667 Ga0501035_0394523
668 Ga0501045_0010382
669 Ga0501045_0017218
670 Ga0501045_0035403
671 Ga0501045_0065665
672 nmdc:mga05p37_286059_c1
673 nmdc:mga05p37_82991_c1
674 nmdc:mga06r32_236407_c1
675 nmdc:mga08y16_20575_c1
676 nmdc:mga08y16_524702_c1
677 nmdc:mga08y16_94628_c1
678 nmdc:mga0n895_461531_c1
679 nmdc:mga0a205_267569_c1
680 nmdc:mga0a205_69432_c1
681 Ga0495601_0058633
682 Ga0495619_0139215
683 Ga0501084_0031906
684 Ga0501084_0082479
685 Ga0501084_0083662
686 Ga0501084_0184505
687 Ga0501084_0489824
688 Ga0501082_0058592
689 Ga0501082_0090272
690 Ga0501082_0103130
691 Ga0501082_0252887
692 Ga0501082_0341493
693 Ga0501082_0499345
694 Ga0530510_0002553
695 Ga0530510_0060113
696 Ga0530510_0104444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

101

234

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dd0-assembly1.cif.gz_A crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9122 8 250
6m96-assembly1.cif.gz_A-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8792 11 247
7k2t-assembly1.cif.gz_C mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8757 12 251
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8745 12 251
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.874 8 266
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8601 8 241 3.40.50.300
af_Q2G2H3_25_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8503 49 254 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8375 12 263 3.40.50.300
af_P72047_42_272_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8316 49 263 3.40.50.300
af_X2JG15_1642_1882_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8299 7 245 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6P0J235-F1-model_v4 ABC transporter ATP-binding protein 0.9598 49 251 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X6ZIN8-F1-model_v4 ABC transporter ATP-binding protein 0.9536 10 246 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A1B6AK36-F1-model_v4 Putative polysaccharide ABC transporter ATP-binding protein 0.9192 49 227 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A6N7ZGK5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9184 8 247 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7W3B8Q2-F1-model_v4 deleted 0.9181 8 249

Map