F417415

General Info

Members Datasets Scaffolds Average Seq Length
348 200 344 197

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100204533|Ga0070669_1002045333
Length 218
Sequence MDDRNENSLNHNSYPHNPVMLICISMHNQNLIQLFYSSNLVSLSKAEEIATHFSHKTIPKNGFHLTEGNHSNEYLFLEKGFMRSFAHDTEGAEVTTNFYSERQVVFEVSSFFNRTISRENIQALTDCEGWYITYEQLNMLFHSLPEFRDFGRSVLVKGFAALKNRMLSLITETAEERYAQLLKTAPEIFQHAPLKTIASYLGITDTSLSRIRKEFAKK

Samples

Sample ID Description Type Environment
1 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
2 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
3 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
172 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
189 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
190 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
193 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
194 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.46
Nodule 0
Rhizoplane 1.15
Rhizosphere 87.36
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c006421 3300000041 Bacteria 1004
2 JGI25162J39368_1000110 3300002737 Bacteria 89871
3 JGI25162J39368_1002378 3300002737 Bacteria 7423
4 JGI25157J39369_1010364 3300002741 Bacteria 1228
5 JGI25164J39214_1001333 3300002772 Bacteria 6117
6 JGI25165J46597_1002439 3300003214 Bacteria 6001
7 JGI25153J46596_10005079 3300003215 Bacteria 6958
8 rootH2_10055349 3300003320 Unclassified 1693
9 rootH2_10089680 3300003320 Bacteria 1512
10 rootL2_10049756 3300003322 Bacteria 2120
11 rootL2_10333206 3300003322 Bacteria 2283
12 rootH1_10034882 3300003316 Bacteria 7746
13 rootH1_10034882 3300003323 Bacteria 3545
14 Ga0065704_10308021 3300005289 Bacteria 873
15 Ga0065707_10229608 3300005295 Bacteria 1194
16 Ga0070658_10000215 3300005327 Bacteria 51284
17 Ga0070676_10000692 3300005328 Bacteria 16529
18 Ga0070676_10028799 3300005328 Bacteria 3155
19 Ga0070676_10077682 3300005328 Bacteria 2007
20 Ga0070683_100304125 3300005329 Bacteria 1517
21 Ga0070670_100022423 3300005331 Bacteria 5435
22 Ga0070670_100048227 3300005331 Bacteria 3665
23 Ga0070666_10005779 3300005335 Bacteria 7602
24 Ga0068868_100002775 3300005338 Bacteria 12137
25 Ga0068868_100003602 3300005338 Bacteria 10796
26 Ga0068868_100194419 3300005338 Bacteria 1688
27 Ga0070668_100000106 3300005347 Bacteria 51244
28 Ga0070668_100163239 3300005347 Bacteria 1809
29 Ga0070669_100204533 3300005353 Bacteria 1555
30 Ga0070669_100512297 3300005353 Bacteria 996
31 Ga0070675_100043029 3300005354 Bacteria 3690
32 Ga0070675_100201794 3300005354 Bacteria 1726
33 Ga0070671_100073520 3300005355 Bacteria 2855
34 Ga0070674_100046264 3300005356 Unclassified 2976
35 Ga0070674_100371285 3300005356 Unclassified 1161
36 Ga0070673_100000391 3300005364 Bacteria 23145
37 Ga0070673_100208273 3300005364 Bacteria 1687
38 Ga0070673_100557135 3300005364 Bacteria 1042
39 Ga0070667_100000931 3300005367 Bacteria 27021
40 Ga0070700_100124106 3300005441 Bacteria 1734
41 Ga0070678_100108615 3300005456 Unclassified 2166
42 Ga0070662_100022427 3300005457 Bacteria 4323
43 Ga0068867_100006834 3300005459 Bacteria 8067
44 Ga0068867_100023420 3300005459 Bacteria 4420
45 Ga0068867_100182286 3300005459 Bacteria 1670
46 Ga0070684_100005891 3300005535 Bacteria 9436
47 Ga0070684_100550054 3300005535 Unclassified 1071
48 Ga0068853_100055182 3300005539 Bacteria 3424
49 Ga0068853_100146663 3300005539 Bacteria 2121
50 Ga0068853_100765546 3300005539 Unclassified 923
51 Ga0070672_100000585 3300005543 Bacteria 21389
52 Ga0070672_100081878 3300005543 Bacteria 2589
53 Ga0070672_100403184 3300005543 Bacteria 1172
54 Ga0070665_100000570 3300005548 Bacteria 51526
55 Ga0068855_100004484 3300005563 Bacteria 17064
56 Ga0068855_100029322 3300005563 Bacteria 6580
57 Ga0068855_100125043 3300005563 Bacteria 2941
58 Ga0068855_100272182 3300005563 Unclassified 1883
59 Ga0068855_100384003 3300005563 Bacteria 1541
60 Ga0068855_100416357 3300005563 Unclassified 1470
61 Ga0070664_100001600 3300005564 Bacteria 18107
62 Ga0070664_100287302 3300005564 Bacteria 1484
63 Ga0070664_101350664 3300005564 Bacteria 673
64 Ga0068857_100038944 3300005577 Bacteria 4209
65 Ga0068857_100043133 3300005577 Bacteria 4001
66 Ga0068854_100205091 3300005578 Unclassified 1552
67 Ga0068854_100853536 3300005578 Bacteria 797
68 Ga0068856_100018732 3300005614 Bacteria 6711
69 Ga0068856_100049274 3300005614 Bacteria 4151
70 Ga0068856_100073137 3300005614 Bacteria 3394
71 Ga0068852_100025051 3300005616 Bacteria 4829
72 Ga0068852_100074658 3300005616 Bacteria 2987
73 Ga0068852_100449851 3300005616 Bacteria 1275
74 Ga0068852_100699794 3300005616 Bacteria 1023
75 Ga0068859_100145939 3300005617 Unclassified 2441
76 Ga0068864_100002921 3300005618 Bacteria 14132
77 Ga0068864_100532006 3300005618 Unclassified 1134
78 Ga0068864_100679094 3300005618 Bacteria 1005
79 Ga0068864_101158504 3300005618 Bacteria 771
80 Ga0068866_10046801 3300005718 Bacteria 2177
81 Ga0068861_100277363 3300005719 Bacteria 1442
82 Ga0068851_10002528 3300005834 Bacteria 8052
83 Ga0068870_10332368 3300005840 Bacteria 969
84 Ga0068870_10701532 3300005840 Bacteria 698
85 Ga0068863_100004661 3300005841 Bacteria 13517
86 Ga0068858_100001322 3300005842 Bacteria 25607
87 Ga0068860_100007206 3300005843 Bacteria 11119
88 Ga0068860_100014476 3300005843 Bacteria 7722
89 Ga0068860_100034175 3300005843 Bacteria 4876
90 Ga0068860_100133839 3300005843 Bacteria 2380
91 Ga0070715_10154122 3300006163 Bacteria 1129
92 Ga0097621_100003507 3300006237 Bacteria 10832
93 Ga0097621_100618973 3300006237 Bacteria 991
94 Ga0068871_100009709 3300006358 Bacteria 6987
95 Ga0068871_100011313 3300006358 Bacteria 6543
96 Ga0068871_100213884 3300006358 Bacteria 1668
97 Ga0068871_100390759 3300006358 Bacteria 1237
98 Ga0068865_100008368 3300006881 Bacteria 6394
99 Ga0097620_100145939 3300006931 Unclassified 2441
100 Ga0105240_10000716 3300009093 Bacteria 60717
101 Ga0105240_10010052 3300009093 Bacteria 13325
102 Ga0105240_10023067 3300009093 Bacteria 8242
103 Ga0105240_10181728 3300009093 Unclassified 2481
104 Ga0105240_10210446 3300009093 Unclassified 2273
105 Ga0105240_10302677 3300009093 Bacteria 1829
106 Ga0105240_10413618 3300009093 Bacteria 1516
107 Ga0105240_10592272 3300009093 Unclassified 1222
108 Ga0105247_10018121 3300009101 Unclassified 4224
109 Ga0105243_10316861 3300009148 Bacteria 1420
110 Ga0105241_10085351 3300009174 Bacteria 2481
111 Ga0105241_10140337 3300009174 Bacteria 1967
112 Ga0105241_10368661 3300009174 Bacteria 1251
113 Ga0105242_10136482 3300009176 Bacteria 2124
114 Ga0105237_10002234 3300009545 Bacteria 24181
115 Ga0105237_10014875 3300009545 Bacteria 8115
116 Ga0105237_10032046 3300009545 Bacteria 5323
117 Ga0105237_10033935 3300009545 Bacteria 5170
118 Ga0105237_10037576 3300009545 Unclassified 4893
119 Ga0105237_10094260 3300009545 Bacteria 2983
120 Ga0105237_10130862 3300009545 Bacteria 2504
121 Ga0105237_10273904 3300009545 Bacteria 1690
122 Ga0105238_10001000 3300009551 Bacteria 28850
123 Ga0105238_10198246 3300009551 Unclassified 1983
124 Ga0105238_10291293 3300009551 Bacteria 1615
125 Ga0105249_10007289 3300009553 Bacteria 9643
126 Ga0105239_10000806 3300010375 Bacteria 44388
127 Ga0105239_10001641 3300010375 Bacteria 29489
128 Ga0105239_10002363 3300010375 Bacteria 24058
129 Ga0105239_10012383 3300010375 Bacteria 9497
130 Ga0105239_10018887 3300010375 Bacteria 7616
131 Ga0105239_10056081 3300010375 Bacteria 4322
132 Ga0105239_10083624 3300010375 Bacteria 3515
133 Ga0105239_10159554 3300010375 Bacteria 2519
134 Ga0105239_10520727 3300010375 Bacteria 1353
135 Ga0105239_11069304 3300010375 Bacteria 928
136 Ga0157373_10162201 3300013100 Bacteria 1573
137 Ga0157371_10392698 3300013102 Bacteria 1014
138 Ga0157370_10003298 3300013104 Bacteria 19028
139 Ga0157370_10296844 3300013104 Unclassified 1492
140 Ga0157370_10564568 3300013104 Bacteria 1043
141 Ga0157369_10123359 3300013105 Unclassified 2748
142 Ga0157369_10290569 3300013105 Bacteria 1702
143 Ga0157374_10000089 3300013296 Bacteria 89250
144 Ga0157374_10085650 3300013296 Bacteria 2997
145 Ga0157374_10112385 3300013296 Bacteria 2621
146 Ga0157374_10678674 3300013296 Bacteria 1043
147 Ga0157374_11199021 3300013296 Bacteria 780
148 Ga0157378_10004918 3300013297 Bacteria 11712
149 Ga0157378_10443868 3300013297 Bacteria 1287
150 Ga0163162_10002201 3300013306 Bacteria 18307
151 Ga0163162_10016132 3300013306 Bacteria 7302
152 Ga0163162_10022808 3300013306 Bacteria 6172
153 Ga0163162_10273000 3300013306 Bacteria 1823
154 Ga0163162_10365093 3300013306 Bacteria 1577
155 Ga0157372_10012208 3300013307 Bacteria 9151
156 Ga0157372_10043310 3300013307 Bacteria 4983
157 Ga0157372_10049274 3300013307 Bacteria 4683
158 Ga0157372_10376392 3300013307 Bacteria 1655
159 Ga0157372_10545708 3300013307 Unclassified 1351
160 Ga0157375_10000057 3300013308 Bacteria 122654
161 Ga0157375_10276647 3300013308 Bacteria 1841
162 Ga0157375_10355819 3300013308 Bacteria 1630
163 Ga0163163_10005273 3300014325 Bacteria 11155
164 Ga0157380_10005764 3300014326 Bacteria 8670
165 Ga0157379_10000032 3300014968 Bacteria 83845
166 Ga0157379_10054103 3300014968 Bacteria 3587
167 Ga0157379_10224396 3300014968 Bacteria 1703
168 Ga0157379_10761726 3300014968 Unclassified 912
169 Ga0157376_10000090 3300014969 Bacteria 68904
170 Ga0157376_10031703 3300014969 Bacteria 4236
171 Ga0157376_10035400 3300014969 Bacteria 4038
172 Ga0157376_10228302 3300014969 Bacteria 1728
173 Ga0157376_10949642 3300014969 Bacteria 880
174 Ga0163161_10003904 3300017792 Bacteria 10454
175 Ga0163161_10294923 3300017792 Bacteria 1276
176 Ga0209563_105700 3300025230 Bacteria 2224
177 Ga0207427_100186 3300025231 Bacteria 63344
178 Ga0209437_100026 3300025233 Bacteria 542698
179 Ga0209437_100077 3300025233 Bacteria 286656
180 Ga0209646_1000004 3300025246 Bacteria 786587
181 Ga0209026_1000132 3300025250 Bacteria 119048
182 Ga0209026_1000239 3300025250 Bacteria 71740
183 Ga0209233_1000206 3300025261 Bacteria 117820
184 Ga0207666_1027529 3300025271 Bacteria 860
185 Ga0209455_1001480 3300025272 Bacteria 10559
186 Ga0209758_1005545 3300025297 Bacteria 9628
187 Ga0207426_1000316 3300025302 Bacteria 94148
188 Ga0207656_10002405 3300025321 Bacteria 6299
189 Ga0207710_10027142 3300025900 Bacteria 2477
190 Ga0207680_10008679 3300025903 Bacteria 5002
191 Ga0207647_10033357 3300025904 Bacteria 3297
192 Ga0207647_10140180 3300025904 Bacteria 1417
193 Ga0207685_10108231 3300025905 Bacteria 1200
194 Ga0207645_10001629 3300025907 Bacteria 18308
195 Ga0207645_10056798 3300025907 Bacteria 2499
196 Ga0207705_10011063 3300025909 Bacteria 6541
197 Ga0207654_10028312 3300025911 Bacteria 3054
198 Ga0207654_10130648 3300025911 Unclassified 1589
199 Ga0207695_10006540 3300025913 Bacteria 15089
200 Ga0207695_10084580 3300025913 Bacteria 3203
201 Ga0207695_10181476 3300025913 Bacteria 2026
202 Ga0207695_10188926 3300025913 Bacteria 1978
203 Ga0207695_10206518 3300025913 Unclassified 1877
204 Ga0207695_10408980 3300025913 Unclassified 1241
205 Ga0207671_10002893 3300025914 Bacteria 17762
206 Ga0207671_10004117 3300025914 Bacteria 14060
207 Ga0207671_10006986 3300025914 Bacteria 9905
208 Ga0207671_10013421 3300025914 Bacteria 6522
209 Ga0207671_10019897 3300025914 Bacteria 5121
210 Ga0207649_10079395 3300025920 Bacteria 2120
211 Ga0207649_10103562 3300025920 Bacteria 1888
212 Ga0207681_10448623 3300025923 Bacteria 1049
213 Ga0207694_10482557 3300025924 Bacteria 1037
214 Ga0207650_10017374 3300025925 Bacteria 5037
215 Ga0207659_10020445 3300025926 Bacteria 4377
216 Ga0207659_10059669 3300025926 Bacteria 2743
217 Ga0207644_10149667 3300025931 Bacteria 1805
218 Ga0207706_10033448 3300025933 Bacteria 4576
219 Ga0207686_10116867 3300025934 Bacteria 1809
220 Ga0207709_10209008 3300025935 Bacteria 1399
221 Ga0207669_10190374 3300025937 Unclassified 1479
222 Ga0207704_10003542 3300025938 Bacteria 7101
223 Ga0207704_10663849 3300025938 Bacteria 860
224 Ga0207691_10000014 3300025940 Bacteria 142542
225 Ga0207691_10102904 3300025940 Bacteria 2547
226 Ga0207691_10238889 3300025940 Bacteria 1571
227 Ga0207691_10297212 3300025940 Unclassified 1388
228 Ga0207689_10045485 3300025942 Bacteria 3629
229 Ga0207661_10088835 3300025944 Bacteria 2570
230 Ga0207679_10283860 3300025945 Bacteria 1421
231 Ga0207679_10316465 3300025945 Bacteria 1350
232 Ga0207679_10422132 3300025945 Bacteria 1177
233 Ga0207667_10000915 3300025949 Bacteria 37602
234 Ga0207667_10003946 3300025949 Bacteria 18252
235 Ga0207667_10075885 3300025949 Unclassified 3489
236 Ga0207651_10000380 3300025960 Bacteria 18895
237 Ga0207651_10084457 3300025960 Bacteria 2300
238 Ga0207668_10000124 3300025972 Bacteria 54437
239 Ga0207640_10096513 3300025981 Bacteria 2061
240 Ga0207658_10000242 3300025986 Bacteria 57191
241 Ga0207677_10002935 3300026023 Bacteria 9006
242 Ga0207677_10144462 3300026023 Bacteria 1826
243 Ga0207703_10000735 3300026035 Bacteria 32229
244 Ga0207639_10059009 3300026041 Unclassified 2954
245 Ga0207639_10121247 3300026041 Bacteria 2149
246 Ga0207639_10678208 3300026041 Unclassified 955
247 Ga0207708_10139416 3300026075 Unclassified 1901
248 Ga0207702_10052564 3300026078 Unclassified 3448
249 Ga0207702_10536680 3300026078 Unclassified 1143
250 Ga0207641_10024053 3300026088 Bacteria 5019
251 Ga0207648_10001033 3300026089 Bacteria 31260
252 Ga0207648_10004167 3300026089 Bacteria 14951
253 Ga0207648_10262594 3300026089 Bacteria 1541
254 Ga0207676_10015320 3300026095 Bacteria 5528
255 Ga0207676_10476491 3300026095 Unclassified 1181
256 Ga0207674_10008074 3300026116 Bacteria 12203
257 Ga0207674_10432110 3300026116 Bacteria 1273
258 Ga0207675_100124756 3300026118 Bacteria 2438
259 Ga0207698_10267351 3300026142 Bacteria 1574
260 Ga0207698_11068257 3300026142 Bacteria 819
261 Ga0268266_10003437 3300028379 Bacteria 15808
262 Ga0268265_10296403 3300028380 Bacteria 1454
263 Ga0268264_10000658 3300028381 Bacteria 40585
264 Ga0268264_10004395 3300028381 Bacteria 12025
265 Ga0268264_10006049 3300028381 Bacteria 10228
266 Ga0307515_10000135 3300028794 Bacteria 175323
267 Ga0307515_10265001 3300028794 Bacteria 1448
268 Ga0307515_10522297 3300028794 Unclassified 797
269 Ga0307509_10026077 3300031507 Bacteria 6522
270 Ga0307509_10072696 3300031507 Bacteria 3582
271 Ga0307509_10308808 3300031507 Bacteria 1325
272 Ga0307514_10068507 3300031649 Bacteria 2674
273 Ga0307410_10170435 3300031852 Unclassified 1640
274 Ga0307412_10838340 3300031911 Bacteria 801
275 Ga0307411_10280660 3300032005 Bacteria 1326
276 Ga0307510_10083890 3300033180 Bacteria 3073
277 Ga0373957_0330008 3300035120 Unclassified 650
278 Ga0373924_0063685 3300035410 Unclassified 1547
279 Ga0373937_0105078 3300036401 Bacteria 2624
280 Ga0395905_0077627 3300037471 Bacteria 3112
281 Ga0466972_0036736 3300044658 Bacteria 2395
282 Ga0466960_0422714 3300044901 Unclassified 771
283 Ga0495638_0378992 3300046460 Bacteria 739
284 Ga0495606_0000213 3300046507 Bacteria 103305
285 Ga0495606_0005390 3300046507 Bacteria 12265
286 Ga0495637_0108121 3300046520 Bacteria 1080
287 Ga0495648_0038223 3300046524 Bacteria 3072
288 Ga0495652_0232226 3300046529 Bacteria 1379
289 Ga0495586_0181430 3300046535 Bacteria 1191
290 Ga0495645_0596867 3300046543 Bacteria 680
291 Ga0495633_0000167 3300046558 Bacteria 86373
292 Ga0495633_0060558 3300046558 Bacteria 1774
293 Ga0495634_0493858 3300046642 Unclassified 718
294 Ga0495611_0001427 3300046648 Bacteria 11926
295 Ga0495625_0032397 3300046660 Bacteria 3874
296 Ga0495658_0355018 3300046683 Unclassified 932
297 Ga0495613_0389713 3300046689 Bacteria 952
298 Ga0495670_0041523 3300046691 Bacteria 2295
299 Ga0495660_0004006 3300046810 Bacteria 8991
300 Ga0495674_0079545 3300047319 Bacteria 2815
301 Ga0495672_0003995 3300047320 Bacteria 12338
302 Ga0495672_0132003 3300047320 Unclassified 1313
303 Ga0495686_0001691 3300047472 Bacteria 22859
304 Ga0495686_0002976 3300047472 Bacteria 15095
305 Ga0495602_0231242 3300048088 Bacteria 1389
306 Ga0496104_0952660 3300048907 Unclassified 763
307 Ga0496109_0077970 3300048912 Unclassified 3050
308 Ga0496114_0000721 3300048917 Bacteria 24623
309 Ga0496115_0550080 3300048918 Bacteria 923
310 Ga0501297_011953 3300049520 Bacteria 1004
311 Ga0501298_000289 3300049521 Bacteria 6655
312 Ga0501299_000532 3300049522 Unclassified 4548
313 Ga0501300_004267 3300049523 Bacteria 2120
314 Ga0501202_008746 3300049652 Bacteria 1850
315 Ga0501202_020266 3300049652 Unclassified 1320
316 Ga0501207_015915 3300049654 Bacteria 1162
317 Ga0501210_001460 3300049657 Bacteria 1350
318 Ga0501217_001194 3300049661 Unclassified 4787
319 Ga0501223_002974 3300049663 Bacteria 3720
320 Ga0501224_026220 3300049664 Bacteria 871
321 Ga0501235_001779 3300049669 Bacteria 4618
322 Ga0501236_001312 3300049670 Bacteria 2821
323 Ga0501243_000215 3300049675 Bacteria 7095
324 Ga0501249_036178 3300049679 Unclassified 1112
325 Ga0501257_050943 3300049686 Bacteria 1032
326 Ga0501259_000181 3300049688 Bacteria 9543
327 Ga0501261_000718 3300049690 Bacteria 4154
328 Ga0501221_000080 3300049704 Bacteria 10925
329 Ga0501225_0001083 3300049705 Bacteria 8547
330 Ga0501234_000581 3300049707 Bacteria 5611
331 Ga0501234_017075 3300049707 Unclassified 1147
332 Ga0501245_002547 3300049708 Bacteria 2439
333 Ga0501245_018241 3300049708 Bacteria 1078
334 Ga0501264_000044 3300049761 Bacteria 17523
335 Ga0501268_040187 3300049765 Bacteria 878
336 Ga0501200_01010 3300049849 Bacteria 1034
337 Ga0501212_006958 3300049851 Bacteria 1538
338 Ga0501226_011147 3300049853 Bacteria 995
339 nmdc:mga0k408_16119_c1 3300050493 Bacteria 4141
340 Ga0495619_0074433 3300053085 Bacteria 2278
341 Ga0500559_0211513 3300053136 Bacteria 915
342 Ga0500616_0085347 3300053153 Bacteria 1577
343 Ga0500616_0244559 3300053153 Bacteria 769
344 Ga0500622_0000512 3300053156 Bacteria 36041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100618973 Ga0097621_1006189732 175
2 3300014969 Ga0157376_10035400 Ga0157376_100354003 175
3 3300005356 Ga0070674_100371285 Ga0070674_1003712852 178
4 3300005456 Ga0070678_100108615 Ga0070678_1001086152 178
5 3300005459 Ga0068867_100182286 Ga0068867_1001822862 178
6 3300006358 Ga0068871_100390759 Ga0068871_1003907592 178
7 3300013296 Ga0157374_11199021 Ga0157374_111990212 178
8 3300025940 Ga0207691_10297212 Ga0207691_102972122 178
9 3300026089 Ga0207648_10262594 Ga0207648_102625941 178
10 3300010375 Ga0105239_10520727 Ga0105239_105207272 181
11 3300048907 Ga0496104_0952660 Ga0496104_0952660_73_687 182
12 3300009545 Ga0105237_10014875 Ga0105237_100148753 185
13 3300013104 Ga0157370_10296844 Ga0157370_102968441 185
14 3300013306 Ga0163162_10273000 Ga0163162_102730003 185
15 3300013308 Ga0157375_10355819 Ga0157375_103558192 185
16 3300014968 Ga0157379_10054103 Ga0157379_100541034 185
17 3300025914 Ga0207671_10013421 Ga0207671_100134213 185
18 iso_pu_bacteria 2929921140 2929922202 188
19 iso_pu_bacteria 8003151029 8003154838 188
20 iso_pu_bacteria 2739367857 2740001191 189
21 iso_pu_bacteria 2739367858 2740006007 189
22 3300046558 Ga0495633_0000167 Ga0495633_0000167_15404_15976 190
23 3300048917 Ga0496114_0000721 Ga0496114_0000721_9044_9631 191
24 3300002741 JGI25157J39369_1010364 JGI25157J39369_10103642 192
25 3300003215 JGI25153J46596_10005079 JGI25153J46596_100050797 192
26 3300003320 rootH2_10055349 rootH2_100553492 192
27 3300003323 rootH1_10034882 rootH1_100348822 192
28 3300005840 Ga0068870_10332368 Ga0068870_103323681 192
29 3300013296 Ga0157374_10678674 Ga0157374_106786742 192
30 3300025246 Ga0209646_1000004 Ga0209646_1000004121 192
31 3300025250 Ga0209026_1000132 Ga0209026_100013271 192
32 3300025250 Ga0209026_1000239 Ga0209026_10002399 192
33 3300025297 Ga0209758_1005545 Ga0209758_10055452 192
34 3300025302 Ga0207426_1000316 Ga0207426_10003162 192
35 3300031507 Ga0307509_10308808 Ga0307509_103088081 192
36 3300053156 Ga0500622_0000512 Ga0500622_0000512_9018_9602 192
37 3300000041 ARcpr5oldR_c006421 ARcpr5oldR_0064211 193
38 3300002737 JGI25162J39368_1000110 JGI25162J39368_100011059 193
39 3300002737 JGI25162J39368_1002378 JGI25162J39368_10023783 193
40 3300002772 JGI25164J39214_1001333 JGI25164J39214_10013332 193
41 3300003214 JGI25165J46597_1002439 JGI25165J46597_10024393 193
42 3300003320 rootH2_10089680 rootH2_100896802 193
43 3300003322 rootL2_10049756 rootL2_100497562 193
44 3300003322 rootL2_10333206 rootL2_103332062 193
45 3300005289 Ga0065704_10308021 Ga0065704_103080212 193
46 3300005295 Ga0065707_10229608 Ga0065707_102296082 193
47 3300005327 Ga0070658_10000215 Ga0070658_1000021522 193
48 3300005328 Ga0070676_10000692 Ga0070676_1000069211 193
49 3300005328 Ga0070676_10028799 Ga0070676_100287992 193
50 3300005328 Ga0070676_10077682 Ga0070676_100776823 193
51 3300005329 Ga0070683_100304125 Ga0070683_1003041254 193
52 3300005331 Ga0070670_100022423 Ga0070670_1000224232 193
53 3300005331 Ga0070670_100048227 Ga0070670_1000482273 193
54 3300005335 Ga0070666_10005779 Ga0070666_100057794 193
55 3300005338 Ga0068868_100002775 Ga0068868_1000027752 193
56 3300005338 Ga0068868_100003602 Ga0068868_1000036029 193
57 3300005338 Ga0068868_100194419 Ga0068868_1001944192 193
58 3300005347 Ga0070668_100000106 Ga0070668_1000001069 193
59 3300005347 Ga0070668_100163239 Ga0070668_1001632392 193
60 3300005353 Ga0070669_100204533 Ga0070669_1002045333 193
61 3300005353 Ga0070669_100512297 Ga0070669_1005122972 193
62 3300005354 Ga0070675_100043029 Ga0070675_1000430294 193
63 3300005354 Ga0070675_100201794 Ga0070675_1002017941 193
64 3300005355 Ga0070671_100073520 Ga0070671_1000735202 193
65 3300005356 Ga0070674_100046264 Ga0070674_1000462641 193
66 3300005364 Ga0070673_100000391 Ga0070673_10000039110 193
67 3300005364 Ga0070673_100208273 Ga0070673_1002082732 193
68 3300005364 Ga0070673_100557135 Ga0070673_1005571351 193
69 3300005367 Ga0070667_100000931 Ga0070667_1000009313 193
70 3300005441 Ga0070700_100124106 Ga0070700_1001241062 193
71 3300005457 Ga0070662_100022427 Ga0070662_1000224272 193
72 3300005459 Ga0068867_100006834 Ga0068867_1000068346 193
73 3300005459 Ga0068867_100023420 Ga0068867_1000234202 193
74 3300005535 Ga0070684_100005891 Ga0070684_1000058918 193
75 3300005535 Ga0070684_100550054 Ga0070684_1005500541 193
76 3300005539 Ga0068853_100055182 Ga0068853_1000551825 193
77 3300005539 Ga0068853_100146663 Ga0068853_1001466632 193
78 3300005539 Ga0068853_100765546 Ga0068853_1007655462 193
79 3300005543 Ga0070672_100000585 Ga0070672_1000005856 193
80 3300005543 Ga0070672_100081878 Ga0070672_1000818782 193
81 3300005543 Ga0070672_100403184 Ga0070672_1004031841 193
82 3300005548 Ga0070665_100000570 Ga0070665_1000005702 193
83 3300005563 Ga0068855_100004484 Ga0068855_10000448413 193
84 3300005563 Ga0068855_100029322 Ga0068855_1000293222 193
85 3300005563 Ga0068855_100125043 Ga0068855_1001250432 193
86 3300005563 Ga0068855_100272182 Ga0068855_1002721821 193
87 3300005563 Ga0068855_100384003 Ga0068855_1003840035 193
88 3300005563 Ga0068855_100416357 Ga0068855_1004163572 193
89 3300005564 Ga0070664_100001600 Ga0070664_10000160014 193
90 3300005564 Ga0070664_100287302 Ga0070664_1002873022 193
91 3300005564 Ga0070664_101350664 Ga0070664_1013506641 193
92 3300005577 Ga0068857_100038944 Ga0068857_1000389444 193
93 3300005577 Ga0068857_100043133 Ga0068857_1000431334 193
94 3300005578 Ga0068854_100205091 Ga0068854_1002050912 193
95 3300005578 Ga0068854_100853536 Ga0068854_1008535361 193
96 3300005614 Ga0068856_100018732 Ga0068856_1000187329 193
97 3300005614 Ga0068856_100049274 Ga0068856_1000492744 193
98 3300005614 Ga0068856_100073137 Ga0068856_1000731375 193
99 3300005616 Ga0068852_100025051 Ga0068852_1000250514 193
100 3300005616 Ga0068852_100074658 Ga0068852_1000746583 193
101 3300005616 Ga0068852_100449851 Ga0068852_1004498511 193
102 3300005616 Ga0068852_100699794 Ga0068852_1006997942 193
103 3300005617 Ga0068859_100145939 Ga0068859_1001459392 193
104 3300005618 Ga0068864_100002921 Ga0068864_1000029212 193
105 3300005618 Ga0068864_100532006 Ga0068864_1005320062 193
106 3300005618 Ga0068864_100679094 Ga0068864_1006790943 193
107 3300005618 Ga0068864_101158504 Ga0068864_1011585041 193
108 3300005718 Ga0068866_10046801 Ga0068866_100468012 193
109 3300005719 Ga0068861_100277363 Ga0068861_1002773631 193
110 3300005834 Ga0068851_10002528 Ga0068851_100025282 193
111 3300005840 Ga0068870_10701532 Ga0068870_107015321 193
112 3300005841 Ga0068863_100004661 Ga0068863_1000046616 193
113 3300005842 Ga0068858_100001322 Ga0068858_1000013222 193
114 3300005843 Ga0068860_100007206 Ga0068860_1000072068 193
115 3300005843 Ga0068860_100014476 Ga0068860_1000144766 193
116 3300005843 Ga0068860_100034175 Ga0068860_1000341752 193
117 3300005843 Ga0068860_100133839 Ga0068860_1001338394 193
118 3300006163 Ga0070715_10154122 Ga0070715_101541222 193
119 3300006237 Ga0097621_100003507 Ga0097621_1000035074 193
120 3300006358 Ga0068871_100009709 Ga0068871_1000097097 193
121 3300006358 Ga0068871_100011313 Ga0068871_1000113132 193
122 3300006358 Ga0068871_100213884 Ga0068871_1002138842 193
123 3300006881 Ga0068865_100008368 Ga0068865_1000083685 193
124 3300006931 Ga0097620_100145939 Ga0097620_1001459392 193
125 3300009093 Ga0105240_10000716 Ga0105240_1000071651 193
126 3300009093 Ga0105240_10010052 Ga0105240_1001005214 193
127 3300009093 Ga0105240_10023067 Ga0105240_100230672 193
128 3300009093 Ga0105240_10181728 Ga0105240_101817282 193
129 3300009093 Ga0105240_10210446 Ga0105240_102104462 193
130 3300009093 Ga0105240_10302677 Ga0105240_103026772 193
131 3300009093 Ga0105240_10413618 Ga0105240_104136182 193
132 3300009093 Ga0105240_10592272 Ga0105240_105922722 193
133 3300009101 Ga0105247_10018121 Ga0105247_100181213 193
134 3300009148 Ga0105243_10316861 Ga0105243_103168612 193
135 3300009174 Ga0105241_10085351 Ga0105241_100853512 193
136 3300009174 Ga0105241_10140337 Ga0105241_101403372 193
137 3300009174 Ga0105241_10368661 Ga0105241_103686612 193
138 3300009176 Ga0105242_10136482 Ga0105242_101364822 193
139 3300009545 Ga0105237_10002234 Ga0105237_1000223417 193
140 3300009545 Ga0105237_10032046 Ga0105237_100320462 193
141 3300009545 Ga0105237_10033935 Ga0105237_100339355 193
142 3300009545 Ga0105237_10037576 Ga0105237_100375766 193
143 3300009545 Ga0105237_10094260 Ga0105237_100942604 193
144 3300009545 Ga0105237_10130862 Ga0105237_101308622 193
145 3300009545 Ga0105237_10273904 Ga0105237_102739042 193
146 3300009551 Ga0105238_10001000 Ga0105238_1000100028 193
147 3300009551 Ga0105238_10198246 Ga0105238_101982462 193
148 3300009551 Ga0105238_10291293 Ga0105238_102912932 193
149 3300009553 Ga0105249_10007289 Ga0105249_100072896 193
150 3300010375 Ga0105239_10000806 Ga0105239_1000080618 193
151 3300010375 Ga0105239_10001641 Ga0105239_100016416 193
152 3300010375 Ga0105239_10002363 Ga0105239_1000236319 193
153 3300010375 Ga0105239_10012383 Ga0105239_100123833 193
154 3300010375 Ga0105239_10018887 Ga0105239_100188875 193
155 3300010375 Ga0105239_10056081 Ga0105239_100560813 193
156 3300010375 Ga0105239_10083624 Ga0105239_100836244 193
157 3300010375 Ga0105239_10159554 Ga0105239_101595542 193
158 3300010375 Ga0105239_11069304 Ga0105239_110693041 193
159 3300013100 Ga0157373_10162201 Ga0157373_101622011 193
160 3300013102 Ga0157371_10392698 Ga0157371_103926981 193
161 3300013104 Ga0157370_10003298 Ga0157370_100032989 193
162 3300013104 Ga0157370_10564568 Ga0157370_105645681 193
163 3300013105 Ga0157369_10123359 Ga0157369_101233592 193
164 3300013105 Ga0157369_10290569 Ga0157369_102905692 193
165 3300013296 Ga0157374_10000089 Ga0157374_1000008912 193
166 3300013296 Ga0157374_10085650 Ga0157374_100856504 193
167 3300013296 Ga0157374_10112385 Ga0157374_101123853 193
168 3300013297 Ga0157378_10004918 Ga0157378_100049185 193
169 3300013297 Ga0157378_10443868 Ga0157378_104438682 193
170 3300013306 Ga0163162_10002201 Ga0163162_1000220115 193
171 3300013306 Ga0163162_10016132 Ga0163162_100161324 193
172 3300013306 Ga0163162_10022808 Ga0163162_100228082 193
173 3300013306 Ga0163162_10365093 Ga0163162_103650932 193
174 3300013307 Ga0157372_10012208 Ga0157372_100122084 193
175 3300013307 Ga0157372_10043310 Ga0157372_100433103 193
176 3300013307 Ga0157372_10049274 Ga0157372_100492745 193
177 3300013307 Ga0157372_10376392 Ga0157372_103763922 193
178 3300013307 Ga0157372_10545708 Ga0157372_105457082 193
179 3300013308 Ga0157375_10000057 Ga0157375_1000005731 193
180 3300013308 Ga0157375_10276647 Ga0157375_102766473 193
181 3300014325 Ga0163163_10005273 Ga0163163_100052739 193
182 3300014326 Ga0157380_10005764 Ga0157380_100057647 193
183 3300014968 Ga0157379_10000032 Ga0157379_1000003244 193
184 3300014968 Ga0157379_10224396 Ga0157379_102243962 193
185 3300014968 Ga0157379_10761726 Ga0157379_107617262 193
186 3300014969 Ga0157376_10000090 Ga0157376_1000009050 193
187 3300014969 Ga0157376_10031703 Ga0157376_100317033 193
188 3300014969 Ga0157376_10228302 Ga0157376_102283023 193
189 3300014969 Ga0157376_10949642 Ga0157376_109496421 193
190 3300017792 Ga0163161_10003904 Ga0163161_100039049 193
191 3300017792 Ga0163161_10294923 Ga0163161_102949232 193
192 3300025230 Ga0209563_105700 Ga0209563_1057002 193
193 3300025231 Ga0207427_100186 Ga0207427_10018649 193
194 3300025233 Ga0209437_100026 Ga0209437_100026379 193
195 3300025233 Ga0209437_100026 Ga0209437_10002649 193
196 3300025233 Ga0209437_100077 Ga0209437_100077117 193
197 3300025261 Ga0209233_1000206 Ga0209233_100020630 193
198 3300025271 Ga0207666_1027529 Ga0207666_10275291 193
199 3300025272 Ga0209455_1001480 Ga0209455_10014803 193
200 3300025321 Ga0207656_10002405 Ga0207656_100024052 193
201 3300025900 Ga0207710_10027142 Ga0207710_100271423 193
202 3300025903 Ga0207680_10008679 Ga0207680_100086794 193
203 3300025904 Ga0207647_10033357 Ga0207647_100333572 193
204 3300025904 Ga0207647_10140180 Ga0207647_101401802 193
205 3300025905 Ga0207685_10108231 Ga0207685_101082312 193
206 3300025907 Ga0207645_10001629 Ga0207645_100016292 193
207 3300025907 Ga0207645_10056798 Ga0207645_100567983 193
208 3300025909 Ga0207705_10011063 Ga0207705_100110634 193
209 3300025911 Ga0207654_10028312 Ga0207654_100283123 193
210 3300025911 Ga0207654_10130648 Ga0207654_101306482 193
211 3300025913 Ga0207695_10006540 Ga0207695_100065404 193
212 3300025913 Ga0207695_10084580 Ga0207695_100845806 193
213 3300025913 Ga0207695_10181476 Ga0207695_101814763 193
214 3300025913 Ga0207695_10188926 Ga0207695_101889262 193
215 3300025913 Ga0207695_10206518 Ga0207695_102065183 193
216 3300025913 Ga0207695_10408980 Ga0207695_104089801 193
217 3300025914 Ga0207671_10002893 Ga0207671_1000289320 193
218 3300025914 Ga0207671_10004117 Ga0207671_100041174 193
219 3300025914 Ga0207671_10006986 Ga0207671_1000698610 193
220 3300025914 Ga0207671_10019897 Ga0207671_100198974 193
221 3300025920 Ga0207649_10079395 Ga0207649_100793952 193
222 3300025920 Ga0207649_10103562 Ga0207649_101035622 193
223 3300025923 Ga0207681_10448623 Ga0207681_104486231 193
224 3300025924 Ga0207694_10482557 Ga0207694_104825571 193
225 3300025925 Ga0207650_10017374 Ga0207650_100173742 193
226 3300025926 Ga0207659_10020445 Ga0207659_100204452 193
227 3300025926 Ga0207659_10059669 Ga0207659_100596691 193
228 3300025931 Ga0207644_10149667 Ga0207644_101496672 193
229 3300025933 Ga0207706_10033448 Ga0207706_100334484 193
230 3300025934 Ga0207686_10116867 Ga0207686_101168672 193
231 3300025935 Ga0207709_10209008 Ga0207709_102090082 193
232 3300025937 Ga0207669_10190374 Ga0207669_101903742 193
233 3300025938 Ga0207704_10003542 Ga0207704_100035423 193
234 3300025938 Ga0207704_10663849 Ga0207704_106638492 193
235 3300025940 Ga0207691_10000014 Ga0207691_10000014105 193
236 3300025940 Ga0207691_10102904 Ga0207691_101029042 193
237 3300025940 Ga0207691_10238889 Ga0207691_102388892 193
238 3300025942 Ga0207689_10045485 Ga0207689_100454852 193
239 3300025944 Ga0207661_10088835 Ga0207661_100888353 193
240 3300025945 Ga0207679_10283860 Ga0207679_102838602 193
241 3300025945 Ga0207679_10316465 Ga0207679_103164651 193
242 3300025945 Ga0207679_10422132 Ga0207679_104221322 193
243 3300025949 Ga0207667_10000915 Ga0207667_1000091529 193
244 3300025949 Ga0207667_10003946 Ga0207667_1000394613 193
245 3300025949 Ga0207667_10075885 Ga0207667_100758853 193
246 3300025960 Ga0207651_10000380 Ga0207651_100003809 193
247 3300025960 Ga0207651_10084457 Ga0207651_100844572 193
248 3300025972 Ga0207668_10000124 Ga0207668_1000012431 193
249 3300025981 Ga0207640_10096513 Ga0207640_100965132 193
250 3300025986 Ga0207658_10000242 Ga0207658_100002429 193
251 3300026023 Ga0207677_10002935 Ga0207677_100029352 193
252 3300026023 Ga0207677_10144462 Ga0207677_101444621 193
253 3300026035 Ga0207703_10000735 Ga0207703_1000073523 193
254 3300026041 Ga0207639_10059009 Ga0207639_100590092 193
255 3300026041 Ga0207639_10121247 Ga0207639_101212471 193
256 3300026041 Ga0207639_10678208 Ga0207639_106782082 193
257 3300026075 Ga0207708_10139416 Ga0207708_101394162 193
258 3300026078 Ga0207702_10052564 Ga0207702_100525642 193
259 3300026078 Ga0207702_10536680 Ga0207702_105366801 193
260 3300026088 Ga0207641_10024053 Ga0207641_100240532 193
261 3300026089 Ga0207648_10001033 Ga0207648_1000103324 193
262 3300026089 Ga0207648_10004167 Ga0207648_100041672 193
263 3300026095 Ga0207676_10015320 Ga0207676_100153205 193
264 3300026095 Ga0207676_10476491 Ga0207676_104764912 193
265 3300026116 Ga0207674_10008074 Ga0207674_100080743 193
266 3300026116 Ga0207674_10432110 Ga0207674_104321102 193
267 3300026118 Ga0207675_100124756 Ga0207675_1001247563 193
268 3300026142 Ga0207698_10267351 Ga0207698_102673512 193
269 3300026142 Ga0207698_11068257 Ga0207698_110682571 193
270 3300028379 Ga0268266_10003437 Ga0268266_100034376 193
271 3300028380 Ga0268265_10296403 Ga0268265_102964031 193
272 3300028381 Ga0268264_10000658 Ga0268264_100006586 193
273 3300028381 Ga0268264_10004395 Ga0268264_1000439510 193
274 3300028381 Ga0268264_10006049 Ga0268264_100060496 193
275 3300028794 Ga0307515_10000135 Ga0307515_1000013583 193
276 3300028794 Ga0307515_10265001 Ga0307515_102650012 193
277 3300028794 Ga0307515_10522297 Ga0307515_105222971 193
278 3300031507 Ga0307509_10026077 Ga0307509_100260772 193
279 3300031507 Ga0307509_10072696 Ga0307509_100726964 193
280 3300031649 Ga0307514_10068507 Ga0307514_100685074 193
281 3300031852 Ga0307410_10170435 Ga0307410_101704352 193
282 3300031911 Ga0307412_10838340 Ga0307412_108383401 193
283 3300032005 Ga0307411_10280660 Ga0307411_102806603 193
284 3300033180 Ga0307510_10083890 Ga0307510_100838901 193
285 3300035120 Ga0373957_0330008 Ga0373957_0330008_22_609 193
286 3300035410 Ga0373924_0063685 Ga0373924_0063685_48_635 193
287 3300036401 Ga0373937_0105078 Ga0373937_0105078_1807_2394 193
288 3300037471 Ga0395905_0077627 Ga0395905_0077627_1306_1893 193
289 3300044658 Ga0466972_0036736 Ga0466972_0036736_1482_2081 193
290 3300044901 Ga0466960_0422714 Ga0466960_0422714_134_733 193
291 3300046460 Ga0495638_0378992 Ga0495638_0378992_124_705 193
292 3300046507 Ga0495606_0000213 Ga0495606_0000213_31385_31966 193
293 3300046507 Ga0495606_0005390 Ga0495606_0005390_9641_10222 193
294 3300046520 Ga0495637_0108121 Ga0495637_0108121_157_738 193
295 3300046524 Ga0495648_0038223 Ga0495648_0038223_501_1082 193
296 3300046529 Ga0495652_0232226 Ga0495652_0232226_292_879 193
297 3300046535 Ga0495586_0181430 Ga0495586_0181430_585_1172 193
298 3300046543 Ga0495645_0596867 Ga0495645_0596867_74_661 193
299 3300046558 Ga0495633_0060558 Ga0495633_0060558_473_1084 193
300 3300046642 Ga0495634_0493858 Ga0495634_0493858_97_684 193
301 3300046648 Ga0495611_0001427 Ga0495611_0001427_10483_11082 193
302 3300046660 Ga0495625_0032397 Ga0495625_0032397_71_652 193
303 3300046683 Ga0495658_0355018 Ga0495658_0355018_52_639 193
304 3300046689 Ga0495613_0389713 Ga0495613_0389713_80_667 193
305 3300046691 Ga0495670_0041523 Ga0495670_0041523_317_928 193
306 3300046810 Ga0495660_0004006 Ga0495660_0004006_1421_2002 193
307 3300047319 Ga0495674_0079545 Ga0495674_0079545_304_891 193
308 3300047320 Ga0495672_0003995 Ga0495672_0003995_4331_4918 193
309 3300047320 Ga0495672_0132003 Ga0495672_0132003_388_969 193
310 3300047472 Ga0495686_0001691 Ga0495686_0001691_10431_11015 193
311 3300047472 Ga0495686_0002976 Ga0495686_0002976_4262_4843 193
312 3300048088 Ga0495602_0231242 Ga0495602_0231242_28_615 193
313 3300048912 Ga0496109_0077970 Ga0496109_0077970_1531_2139 193
314 3300048918 Ga0496115_0550080 Ga0496115_0550080_170_757 193
315 3300049520 Ga0501297_011953 Ga0501297_011953_132_713 193
316 3300049521 Ga0501298_000289 Ga0501298_000289_3923_4504 193
317 3300049522 Ga0501299_000532 Ga0501299_000532_1316_1897 193
318 3300049523 Ga0501300_004267 Ga0501300_004267_702_1283 193
319 3300049652 Ga0501202_008746 Ga0501202_008746_1219_1800 193
320 3300049652 Ga0501202_020266 Ga0501202_020266_383_964 193
321 3300049654 Ga0501207_015915 Ga0501207_015915_182_763 193
322 3300049657 Ga0501210_001460 Ga0501210_001460_420_1028 193
323 3300049661 Ga0501217_001194 Ga0501217_001194_3559_4140 193
324 3300049663 Ga0501223_002974 Ga0501223_002974_3039_3620 193
325 3300049664 Ga0501224_026220 Ga0501224_026220_271_852 193
326 3300049669 Ga0501235_001779 Ga0501235_001779_2076_2657 193
327 3300049670 Ga0501236_001312 Ga0501236_001312_1478_2059 193
328 3300049675 Ga0501243_000215 Ga0501243_000215_2711_3292 193
329 3300049679 Ga0501249_036178 Ga0501249_036178_120_701 193
330 3300049686 Ga0501257_050943 Ga0501257_050943_146_727 193
331 3300049688 Ga0501259_000181 Ga0501259_000181_8623_9204 193
332 3300049690 Ga0501261_000718 Ga0501261_000718_804_1385 193
333 3300049704 Ga0501221_000080 Ga0501221_000080_8363_8944 193
334 3300049705 Ga0501225_0001083 Ga0501225_0001083_3511_4092 193
335 3300049707 Ga0501234_000581 Ga0501234_000581_4700_5281 193
336 3300049707 Ga0501234_017075 Ga0501234_017075_134_715 193
337 3300049708 Ga0501245_002547 Ga0501245_002547_1024_1605 193
338 3300049708 Ga0501245_018241 Ga0501245_018241_278_859 193
339 3300049761 Ga0501264_000044 Ga0501264_000044_11925_12506 193
340 3300049765 Ga0501268_040187 Ga0501268_040187_175_756 193
341 3300049849 Ga0501200_01010 Ga0501200_01010_129_710 193
342 3300049851 Ga0501212_006958 Ga0501212_006958_618_1199 193
343 3300049853 Ga0501226_011147 Ga0501226_011147_375_956 193
344 3300050493 nmdc:mga0k408_16119_c1 nmdc:mga0k408_16119_c1_1076_1657 193
345 3300053085 Ga0495619_0074433 Ga0495619_0074433_676_1263 193
346 3300053136 Ga0500559_0211513 Ga0500559_0211513_25_609 193
347 3300053153 Ga0500616_0085347 Ga0500616_0085347_56_637 193
348 3300053153 Ga0500616_0244559 Ga0500616_0244559_131_712 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

55

143

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8997 2 146
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8883 2 146
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.884 13 192
4cyd-assembly2.cif.gz_A glxr bound to camp 0.8799 6 192
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8793 23 192
ID Description Score Start End Superfamily
4wbbA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9019 23 111 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8941 3 139 2.60.120.10
af_E7F4S2_593_708_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8854 24 136 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8819 29 148 2.60.120.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.878 23 146 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1H0THF9-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9923 1 193 GO:0016301
AF-A0A4Q6AWP7-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9886 25 193 GO:0003700
GO:0005829
AF-A0A1C2GQK1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.987 3 193
AF-A0A7K1TC07-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9868 4 193
AF-A0A2R7MU43-F1-model_v4 Cyclic nucleotide-binding protein 0.9837 27 192

Feature Viewer

pLDDT pTM Quality
94.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map