F417193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 347 | 200 | 347 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10004029|Ga0265338_1000402914 |
| Length | 308 |
| Sequence | MVTTASTEGSSLRILGVSKSFPAPGNAAVHNLALDTITLSVAAGELIAIIGPSGCGKSTMLRLVAGLDAPDSGELWVGNDPITAPSAERGLVFQDPNLFPWLTVSRNIQAGLIARGLLHKKRPEVNEFMRLVGLEAFAHAYPHHLSGGMAQRVALARALINHPKVLLLDEPLGALDAFTRMRMQDEVLRLWQARRTTMLLVTHDIDEAIYMADRIVIMTPHPGRIERTISVTLDRPRQRNSPEFLRLRSDILEQLHFAGNAKGETNGRTSLDNNVDVDSVGKSNKPPFSPPDEPTTAPIMSGMTGTQD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 10.09 |
| Rhizosphere | 88.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000270 | 3300000545 | Bacteria | 5476 |
| 2 | JGI24737J22298_10043678 | 3300001990 | Bacteria | 1372 |
| 3 | JGI24035J26624_1000458 | 3300002126 | Bacteria | 3851 |
| 4 | rootH2_10081500 | 3300003320 | Bacteria | 23617 |
| 5 | Ga0065704_10164461 | 3300005289 | Bacteria | 1332 |
| 6 | Ga0065712_10001257 | 3300005290 | Bacteria | 6492 |
| 7 | Ga0065712_10001389 | 3300005290 | Bacteria | 6709 |
| 8 | Ga0065712_10026242 | 3300005290 | Unclassified | 1552 |
| 9 | Ga0065712_10118525 | 3300005290 | Bacteria | 1705 |
| 10 | Ga0065712_10184779 | 3300005290 | Bacteria | 1165 |
| 11 | Ga0065715_10004361 | 3300005293 | Bacteria | 5044 |
| 12 | Ga0070658_10047526 | 3300005327 | Bacteria | 3473 |
| 13 | Ga0070658_10052530 | 3300005327 | Bacteria | 3306 |
| 14 | Ga0070676_10022201 | 3300005328 | Bacteria | 3558 |
| 15 | Ga0070676_10132976 | 3300005328 | Bacteria | 1575 |
| 16 | Ga0070683_100047898 | 3300005329 | Bacteria | 3951 |
| 17 | Ga0070683_100200102 | 3300005329 | Bacteria | 1897 |
| 18 | Ga0070690_100056419 | 3300005330 | Bacteria | 2519 |
| 19 | Ga0070690_100156376 | 3300005330 | Bacteria | 1559 |
| 20 | Ga0070670_100013961 | 3300005331 | Bacteria | 6889 |
| 21 | Ga0070666_10041424 | 3300005335 | Bacteria | 3078 |
| 22 | Ga0070666_10402539 | 3300005335 | Bacteria | 984 |
| 23 | Ga0068868_100103537 | 3300005338 | Bacteria | 2306 |
| 24 | Ga0068868_100148483 | 3300005338 | Bacteria | 1929 |
| 25 | Ga0070660_100040877 | 3300005339 | Bacteria | 3532 |
| 26 | Ga0070689_100001173 | 3300005340 | Bacteria | 16583 |
| 27 | Ga0070689_100009773 | 3300005340 | Bacteria | 6815 |
| 28 | Ga0070689_100033366 | 3300005340 | Bacteria | 3922 |
| 29 | Ga0070689_100043704 | 3300005340 | Bacteria | 3444 |
| 30 | Ga0070691_10024540 | 3300005341 | Bacteria | 2802 |
| 31 | Ga0070687_100015735 | 3300005343 | Bacteria | 3428 |
| 32 | Ga0070668_100003335 | 3300005347 | Bacteria | 11844 |
| 33 | Ga0070668_100024812 | 3300005347 | Bacteria | 4544 |
| 34 | Ga0070668_100063794 | 3300005347 | Bacteria | 2856 |
| 35 | Ga0070669_100006544 | 3300005353 | Bacteria | 8386 |
| 36 | Ga0070675_100002575 | 3300005354 | Bacteria | 13589 |
| 37 | Ga0070675_100004050 | 3300005354 | Bacteria | 11125 |
| 38 | Ga0070675_100018222 | 3300005354 | Bacteria | 5589 |
| 39 | Ga0070675_100042460 | 3300005354 | Bacteria | 3715 |
| 40 | Ga0070671_100004202 | 3300005355 | Bacteria | 11390 |
| 41 | Ga0070674_100010770 | 3300005356 | Bacteria | 5544 |
| 42 | Ga0070674_100398965 | 3300005356 | Bacteria | 1123 |
| 43 | Ga0070673_100010948 | 3300005364 | Bacteria | 6170 |
| 44 | Ga0070673_100034437 | 3300005364 | Bacteria | 3833 |
| 45 | Ga0070673_100038191 | 3300005364 | Bacteria | 3665 |
| 46 | Ga0070688_100001014 | 3300005365 | Bacteria | 14119 |
| 47 | Ga0070688_100008722 | 3300005365 | Bacteria | 5514 |
| 48 | Ga0070688_100034619 | 3300005365 | Bacteria | 3061 |
| 49 | Ga0070688_100048049 | 3300005365 | Bacteria | 2650 |
| 50 | Ga0070659_100001236 | 3300005366 | Bacteria | 18545 |
| 51 | Ga0070659_100131269 | 3300005366 | Bacteria | 2035 |
| 52 | Ga0070667_100054866 | 3300005367 | Bacteria | 3365 |
| 53 | Ga0070667_100094904 | 3300005367 | Bacteria | 2571 |
| 54 | Ga0070667_100282911 | 3300005367 | Bacteria | 1490 |
| 55 | Ga0070709_10141885 | 3300005434 | Bacteria | 1651 |
| 56 | Ga0070714_100015980 | 3300005435 | Bacteria | 6052 |
| 57 | Ga0070713_100087586 | 3300005436 | Bacteria | 2671 |
| 58 | Ga0070710_10061639 | 3300005437 | Bacteria | 2137 |
| 59 | Ga0070710_10066793 | 3300005437 | Bacteria | 2062 |
| 60 | Ga0070711_100100283 | 3300005439 | Bacteria | 2105 |
| 61 | Ga0070705_100006791 | 3300005440 | Bacteria | 5629 |
| 62 | Ga0070705_100210103 | 3300005440 | Bacteria | 1341 |
| 63 | Ga0070700_100045670 | 3300005441 | Bacteria | 2703 |
| 64 | Ga0070694_100362617 | 3300005444 | Bacteria | 1126 |
| 65 | Ga0070708_100368945 | 3300005445 | Bacteria | 1353 |
| 66 | Ga0070678_100036038 | 3300005456 | Bacteria | 3460 |
| 67 | Ga0070662_100018238 | 3300005457 | Bacteria | 4744 |
| 68 | Ga0070662_100281081 | 3300005457 | Bacteria | 1347 |
| 69 | Ga0070681_10128272 | 3300005458 | Bacteria | 2469 |
| 70 | Ga0068867_100009796 | 3300005459 | Bacteria | 6752 |
| 71 | Ga0070685_10035454 | 3300005466 | Bacteria | 2814 |
| 72 | Ga0070707_100011499 | 3300005468 | Bacteria | 8253 |
| 73 | Ga0070698_100009010 | 3300005471 | Bacteria | 10728 |
| 74 | Ga0070698_100207175 | 3300005471 | Bacteria | 1896 |
| 75 | Ga0070698_100436827 | 3300005471 | Bacteria | 1244 |
| 76 | Ga0070684_100000426 | 3300005535 | Bacteria | 28892 |
| 77 | Ga0070684_100072181 | 3300005535 | Bacteria | 3038 |
| 78 | Ga0070697_100373092 | 3300005536 | Bacteria | 1235 |
| 79 | Ga0070672_100005133 | 3300005543 | Bacteria | 8642 |
| 80 | Ga0070672_100204809 | 3300005543 | Bacteria | 1651 |
| 81 | Ga0070693_100147378 | 3300005547 | Bacteria | 1487 |
| 82 | Ga0070665_100012850 | 3300005548 | Bacteria | 8429 |
| 83 | Ga0070665_100031648 | 3300005548 | Bacteria | 5325 |
| 84 | Ga0070704_100009471 | 3300005549 | Bacteria | 5886 |
| 85 | Ga0070664_100160327 | 3300005564 | Bacteria | 1990 |
| 86 | Ga0068857_100097473 | 3300005577 | Bacteria | 2636 |
| 87 | Ga0068857_100121888 | 3300005577 | Bacteria | 2348 |
| 88 | Ga0068857_100135232 | 3300005577 | Bacteria | 2225 |
| 89 | Ga0068856_100003900 | 3300005614 | Bacteria | 14959 |
| 90 | Ga0070702_100019939 | 3300005615 | Bacteria | 3506 |
| 91 | Ga0070702_100122297 | 3300005615 | Bacteria | 1631 |
| 92 | Ga0068859_100021734 | 3300005617 | Bacteria | 6436 |
| 93 | Ga0068864_100056831 | 3300005618 | Bacteria | 3381 |
| 94 | Ga0068864_100551949 | 3300005618 | Bacteria | 1114 |
| 95 | Ga0068866_10015248 | 3300005718 | Bacteria | 3412 |
| 96 | Ga0068861_100680032 | 3300005719 | Bacteria | 954 |
| 97 | Ga0068863_100025667 | 3300005841 | Bacteria | 5620 |
| 98 | Ga0068858_100006052 | 3300005842 | Bacteria | 11791 |
| 99 | Ga0068860_100102060 | 3300005843 | Bacteria | 2737 |
| 100 | Ga0068860_100107102 | 3300005843 | Bacteria | 2671 |
| 101 | Ga0068860_100546006 | 3300005843 | Bacteria | 1161 |
| 102 | Ga0068862_100061677 | 3300005844 | Bacteria | 3223 |
| 103 | Ga0068862_100205789 | 3300005844 | Bacteria | 1776 |
| 104 | Ga0081455_10000805 | 3300005937 | Bacteria | 40380 |
| 105 | Ga0081455_10014179 | 3300005937 | Bacteria | 7827 |
| 106 | Ga0081455_10056238 | 3300005937 | Bacteria | 3342 |
| 107 | Ga0081455_10112998 | 3300005937 | Bacteria | 2155 |
| 108 | Ga0081455_10169063 | 3300005937 | Bacteria | 1667 |
| 109 | Ga0081539_10017546 | 3300005985 | Bacteria | 5018 |
| 110 | Ga0081539_10026445 | 3300005985 | Bacteria | 3703 |
| 111 | Ga0070717_10005932 | 3300006028 | Bacteria | 8946 |
| 112 | Ga0070717_10010649 | 3300006028 | Bacteria | 6950 |
| 113 | Ga0070717_10018229 | 3300006028 | Bacteria | 5478 |
| 114 | Ga0070717_10035678 | 3300006028 | Bacteria | 4028 |
| 115 | Ga0070715_10027426 | 3300006163 | Bacteria | 2275 |
| 116 | Ga0097621_100011254 | 3300006237 | Bacteria | 6586 |
| 117 | Ga0068871_100015382 | 3300006358 | Bacteria | 5724 |
| 118 | Ga0075431_100026070 | 3300006847 | Bacteria | 5994 |
| 119 | Ga0075434_100107983 | 3300006871 | Bacteria | 2794 |
| 120 | Ga0075434_100901947 | 3300006871 | Bacteria | 899 |
| 121 | Ga0075429_100038943 | 3300006880 | Bacteria | 4138 |
| 122 | Ga0075429_100111505 | 3300006880 | Bacteria | 2391 |
| 123 | Ga0068865_100063104 | 3300006881 | Bacteria | 2603 |
| 124 | Ga0097620_100021734 | 3300006931 | Bacteria | 6436 |
| 125 | Ga0105240_10111607 | 3300009093 | Bacteria | 3307 |
| 126 | Ga0111539_10137763 | 3300009094 | Bacteria | 2858 |
| 127 | Ga0111539_10899986 | 3300009094 | Unclassified | 1029 |
| 128 | Ga0105245_10249244 | 3300009098 | Bacteria | 1725 |
| 129 | Ga0114129_10095379 | 3300009147 | Bacteria | 4120 |
| 130 | Ga0105248_10619110 | 3300009177 | Bacteria | 1221 |
| 131 | Ga0105237_10050068 | 3300009545 | Bacteria | 4198 |
| 132 | Ga0105238_10338972 | 3300009551 | Bacteria | 1491 |
| 133 | Ga0105249_10030098 | 3300009553 | Bacteria | 4905 |
| 134 | Ga0105249_10110547 | 3300009553 | Bacteria | 2597 |
| 135 | Ga0105239_10027172 | 3300010375 | Bacteria | 6300 |
| 136 | Ga0105239_10119519 | 3300010375 | Bacteria | 2925 |
| 137 | Ga0105239_10185343 | 3300010375 | Bacteria | 2329 |
| 138 | Ga0157374_10008256 | 3300013296 | Bacteria | 8893 |
| 139 | Ga0157374_10136827 | 3300013296 | Bacteria | 2375 |
| 140 | Ga0157378_10008653 | 3300013297 | Bacteria | 8859 |
| 141 | Ga0157378_10027220 | 3300013297 | Bacteria | 5046 |
| 142 | Ga0157378_10037540 | 3300013297 | Bacteria | 4292 |
| 143 | Ga0157378_10088660 | 3300013297 | Bacteria | 2808 |
| 144 | Ga0157378_10151844 | 3300013297 | Bacteria | 2159 |
| 145 | Ga0163162_10006459 | 3300013306 | Bacteria | 11357 |
| 146 | Ga0157372_10085585 | 3300013307 | Bacteria | 3576 |
| 147 | Ga0157372_10590928 | 3300013307 | Bacteria | 1294 |
| 148 | Ga0157375_10016306 | 3300013308 | Bacteria | 6669 |
| 149 | Ga0157375_10026649 | 3300013308 | Bacteria | 5392 |
| 150 | Ga0157375_10260762 | 3300013308 | Bacteria | 1895 |
| 151 | Ga0163163_10034732 | 3300014325 | Bacteria | 4886 |
| 152 | Ga0163163_10345790 | 3300014325 | Bacteria | 1543 |
| 153 | Ga0157377_10012252 | 3300014745 | Bacteria | 4305 |
| 154 | Ga0157379_10011479 | 3300014968 | Bacteria | 7731 |
| 155 | Ga0157376_10431088 | 3300014969 | Bacteria | 1281 |
| 156 | Ga0163161_10014284 | 3300017792 | Bacteria | 5529 |
| 157 | Ga0207673_1002844 | 3300025290 | Bacteria | 1998 |
| 158 | Ga0207673_1004065 | 3300025290 | Bacteria | 1735 |
| 159 | Ga0207697_10000150 | 3300025315 | Bacteria | 34215 |
| 160 | Ga0207697_10000270 | 3300025315 | Bacteria | 28614 |
| 161 | Ga0207697_10000696 | 3300025315 | Bacteria | 19118 |
| 162 | Ga0207697_10003817 | 3300025315 | Bacteria | 7352 |
| 163 | Ga0207697_10005156 | 3300025315 | Bacteria | 6102 |
| 164 | Ga0207697_10100683 | 3300025315 | Bacteria | 1231 |
| 165 | Ga0207653_10011708 | 3300025885 | Bacteria | 2736 |
| 166 | Ga0207692_10099507 | 3300025898 | Bacteria | 1593 |
| 167 | Ga0207688_10000453 | 3300025901 | Bacteria | 19458 |
| 168 | Ga0207680_10019937 | 3300025903 | Bacteria | 3597 |
| 169 | Ga0207680_10040629 | 3300025903 | Bacteria | 2708 |
| 170 | Ga0207647_10000620 | 3300025904 | Bacteria | 27662 |
| 171 | Ga0207685_10027463 | 3300025905 | Bacteria | 1992 |
| 172 | Ga0207685_10029294 | 3300025905 | Bacteria | 1948 |
| 173 | Ga0207699_10047898 | 3300025906 | Bacteria | 2508 |
| 174 | Ga0207699_10073308 | 3300025906 | Bacteria | 2099 |
| 175 | Ga0207645_10002422 | 3300025907 | Bacteria | 14692 |
| 176 | Ga0207645_10015563 | 3300025907 | Bacteria | 5051 |
| 177 | Ga0207705_10045800 | 3300025909 | Bacteria | 3143 |
| 178 | Ga0207705_10077775 | 3300025909 | Bacteria | 2414 |
| 179 | Ga0207705_10387810 | 3300025909 | Bacteria | 1079 |
| 180 | Ga0207684_10065244 | 3300025910 | Bacteria | 3091 |
| 181 | Ga0207684_10067576 | 3300025910 | Bacteria | 3038 |
| 182 | Ga0207684_10294909 | 3300025910 | Bacteria | 1398 |
| 183 | Ga0207707_10054969 | 3300025912 | Bacteria | 3464 |
| 184 | Ga0207707_10171336 | 3300025912 | Bacteria | 1897 |
| 185 | Ga0207695_10050391 | 3300025913 | Bacteria | 4381 |
| 186 | Ga0207693_10004109 | 3300025915 | Bacteria | 12366 |
| 187 | Ga0207693_10016930 | 3300025915 | Bacteria | 5821 |
| 188 | Ga0207693_10016936 | 3300025915 | Bacteria | 5820 |
| 189 | Ga0207693_10118326 | 3300025915 | Bacteria | 2080 |
| 190 | Ga0207660_10036397 | 3300025917 | Bacteria | 3421 |
| 191 | Ga0207662_10000246 | 3300025918 | Bacteria | 25081 |
| 192 | Ga0207657_10043905 | 3300025919 | Bacteria | 3934 |
| 193 | Ga0207646_10079036 | 3300025922 | Bacteria | 2941 |
| 194 | Ga0207646_10129938 | 3300025922 | Bacteria | 2266 |
| 195 | Ga0207646_10241506 | 3300025922 | Bacteria | 1632 |
| 196 | Ga0207681_10019984 | 3300025923 | Bacteria | 4242 |
| 197 | Ga0207694_10256559 | 3300025924 | Bacteria | 1432 |
| 198 | Ga0207650_10064547 | 3300025925 | Bacteria | 2741 |
| 199 | Ga0207650_10143125 | 3300025925 | Bacteria | 1881 |
| 200 | Ga0207659_10008854 | 3300025926 | Bacteria | 6271 |
| 201 | Ga0207659_10024207 | 3300025926 | Bacteria | 4065 |
| 202 | Ga0207659_10034615 | 3300025926 | Bacteria | 3485 |
| 203 | Ga0207687_10372573 | 3300025927 | Bacteria | 1168 |
| 204 | Ga0207700_10024658 | 3300025928 | Bacteria | 4166 |
| 205 | Ga0207700_10028591 | 3300025928 | Bacteria | 3922 |
| 206 | Ga0207700_10087585 | 3300025928 | Bacteria | 2449 |
| 207 | Ga0207664_10011675 | 3300025929 | Bacteria | 6258 |
| 208 | Ga0207644_10033695 | 3300025931 | Bacteria | 3582 |
| 209 | Ga0207644_10036121 | 3300025931 | Bacteria | 3467 |
| 210 | Ga0207644_10102595 | 3300025931 | Bacteria | 2151 |
| 211 | Ga0207644_10249176 | 3300025931 | Bacteria | 1417 |
| 212 | Ga0207690_10005851 | 3300025932 | Bacteria | 7277 |
| 213 | Ga0207706_10004464 | 3300025933 | Bacteria | 13140 |
| 214 | Ga0207706_10265218 | 3300025933 | Bacteria | 1499 |
| 215 | Ga0207706_10379597 | 3300025933 | Bacteria | 1227 |
| 216 | Ga0207709_10069132 | 3300025935 | Bacteria | 2234 |
| 217 | Ga0207670_10000514 | 3300025936 | Bacteria | 21331 |
| 218 | Ga0207670_10006658 | 3300025936 | Bacteria | 6427 |
| 219 | Ga0207670_10019538 | 3300025936 | Bacteria | 4140 |
| 220 | Ga0207669_10070588 | 3300025937 | Bacteria | 2190 |
| 221 | Ga0207704_10122426 | 3300025938 | Bacteria | 1783 |
| 222 | Ga0207704_10232250 | 3300025938 | Bacteria | 1372 |
| 223 | Ga0207665_10009063 | 3300025939 | Bacteria | 6532 |
| 224 | Ga0207665_10025115 | 3300025939 | Bacteria | 3930 |
| 225 | Ga0207691_10000689 | 3300025940 | Bacteria | 33393 |
| 226 | Ga0207691_10007657 | 3300025940 | Bacteria | 10394 |
| 227 | Ga0207661_10022386 | 3300025944 | Bacteria | 4759 |
| 228 | Ga0207661_10060178 | 3300025944 | Bacteria | 3063 |
| 229 | Ga0207679_10044828 | 3300025945 | Bacteria | 3194 |
| 230 | Ga0207651_10034289 | 3300025960 | Bacteria | 3285 |
| 231 | Ga0207651_10067602 | 3300025960 | Bacteria | 2515 |
| 232 | Ga0207651_10111514 | 3300025960 | Bacteria | 2054 |
| 233 | Ga0207712_10007661 | 3300025961 | Bacteria | 6829 |
| 234 | Ga0207668_10026329 | 3300025972 | Bacteria | 3775 |
| 235 | Ga0207668_10108528 | 3300025972 | Bacteria | 2077 |
| 236 | Ga0207668_10148440 | 3300025972 | Bacteria | 1812 |
| 237 | Ga0207658_10040639 | 3300025986 | Bacteria | 3363 |
| 238 | Ga0207677_10026375 | 3300026023 | Bacteria | 3643 |
| 239 | Ga0207708_10063714 | 3300026075 | Bacteria | 2816 |
| 240 | Ga0207708_10443269 | 3300026075 | Bacteria | 1080 |
| 241 | Ga0207702_10000106 | 3300026078 | Bacteria | 97204 |
| 242 | Ga0207702_10094630 | 3300026078 | Bacteria | 2623 |
| 243 | Ga0207641_10044912 | 3300026088 | Bacteria | 3717 |
| 244 | Ga0207641_10660540 | 3300026088 | Bacteria | 1027 |
| 245 | Ga0207648_10119909 | 3300026089 | Bacteria | 2313 |
| 246 | Ga0207676_10031567 | 3300026095 | Bacteria | 3985 |
| 247 | Ga0207674_10002133 | 3300026116 | Bacteria | 24993 |
| 248 | Ga0207674_10053240 | 3300026116 | Bacteria | 4126 |
| 249 | Ga0207674_10180472 | 3300026116 | Bacteria | 2063 |
| 250 | Ga0207675_100450666 | 3300026118 | Bacteria | 1275 |
| 251 | Ga0207683_10390276 | 3300026121 | Bacteria | 1280 |
| 252 | Ga0268266_10030292 | 3300028379 | Bacteria | 4598 |
| 253 | Ga0268266_10047755 | 3300028379 | Bacteria | 3668 |
| 254 | Ga0268266_10121616 | 3300028379 | Bacteria | 2324 |
| 255 | Ga0268264_10007471 | 3300028381 | Bacteria | 9118 |
| 256 | Ga0268264_10078244 | 3300028381 | Bacteria | 2819 |
| 257 | Ga0268264_10156601 | 3300028381 | Bacteria | 2048 |
| 258 | Ga0265326_10003623 | 3300028558 | Bacteria | 5047 |
| 259 | Ga0265338_10000050 | 3300028800 | Bacteria | 213659 |
| 260 | Ga0265338_10000237 | 3300028800 | Bacteria | 101850 |
| 261 | Ga0265338_10000556 | 3300028800 | Bacteria | 65347 |
| 262 | Ga0265338_10004029 | 3300028800 | Bacteria | 20160 |
| 263 | Ga0265324_10000734 | 3300029957 | Bacteria | 21854 |
| 264 | Ga0265340_10021561 | 3300031247 | Bacteria | 3304 |
| 265 | Ga0307513_10007924 | 3300031456 | Bacteria | 13672 |
| 266 | Ga0373945_0099911 | 3300035116 | Bacteria | 1134 |
| 267 | Ga0373943_0072481 | 3300035170 | Bacteria | 1747 |
| 268 | Ga0373943_0119273 | 3300035170 | Bacteria | 1400 |
| 269 | Ga0373943_0221041 | 3300035170 | Bacteria | 1055 |
| 270 | Ga0373935_0046808 | 3300035692 | Bacteria | 2733 |
| 271 | Ga0373947_0056230 | 3300035725 | Bacteria | 2378 |
| 272 | Ga0373947_0074908 | 3300035725 | Bacteria | 2084 |
| 273 | Ga0373937_0207348 | 3300036401 | Bacteria | 1843 |
| 274 | Ga0373925_0219594 | 3300037068 | Bacteria | 1517 |
| 275 | Ga0436363_1654682 | 3300039450 | Bacteria | 2018 |
| 276 | Ga0453683_0306885 | 3300044673 | Bacteria | 1016 |
| 277 | Ga0466971_0066170 | 3300044719 | Bacteria | 1637 |
| 278 | Ga0466967_0051348 | 3300045976 | Bacteria | 3613 |
| 279 | Ga0495592_0135753 | 3300046454 | Bacteria | 1716 |
| 280 | Ga0495592_0169872 | 3300046454 | Bacteria | 1494 |
| 281 | Ga0495603_0152000 | 3300046455 | Bacteria | 1344 |
| 282 | Ga0495651_0023166 | 3300046462 | Bacteria | 4829 |
| 283 | Ga0495580_0213476 | 3300046472 | Bacteria | 1327 |
| 284 | Ga0495639_0103513 | 3300046475 | Bacteria | 1346 |
| 285 | Ga0495608_0113816 | 3300046511 | Bacteria | 1738 |
| 286 | Ga0495608_0241453 | 3300046511 | Bacteria | 1129 |
| 287 | Ga0495628_0000013 | 3300046516 | Bacteria | 211823 |
| 288 | Ga0495628_0148685 | 3300046516 | Bacteria | 1785 |
| 289 | Ga0495630_0005296 | 3300046517 | Bacteria | 9103 |
| 290 | Ga0495630_0037430 | 3300046517 | Bacteria | 3628 |
| 291 | Ga0495665_0187380 | 3300046531 | Bacteria | 1074 |
| 292 | Ga0495640_0116659 | 3300046533 | Bacteria | 1739 |
| 293 | Ga0495587_0080799 | 3300046536 | Bacteria | 1884 |
| 294 | Ga0495645_0213422 | 3300046543 | Bacteria | 1302 |
| 295 | Ga0495667_0046613 | 3300046559 | Bacteria | 2866 |
| 296 | Ga0495658_0184420 | 3300046683 | Bacteria | 1295 |
| 297 | Ga0495613_0169308 | 3300046689 | Bacteria | 1551 |
| 298 | Ga0495624_0009044 | 3300046690 | Bacteria | 6916 |
| 299 | Ga0495624_0109182 | 3300046690 | Bacteria | 1702 |
| 300 | Ga0495680_0058010 | 3300047322 | Bacteria | 2993 |
| 301 | Ga0495675_0141248 | 3300047444 | Bacteria | 1492 |
| 302 | Ga0495684_0000524 | 3300047471 | Bacteria | 31157 |
| 303 | Ga0495684_0003158 | 3300047471 | Bacteria | 12915 |
| 304 | Ga0495684_0042204 | 3300047471 | Bacteria | 3494 |
| 305 | Ga0496100_0019858 | 3300048903 | Bacteria | 4018 |
| 306 | Ga0496101_0028385 | 3300048904 | Bacteria | 3905 |
| 307 | Ga0496102_0010349 | 3300048905 | Bacteria | 8023 |
| 308 | Ga0496102_0012258 | 3300048905 | Bacteria | 7413 |
| 309 | Ga0496102_0019329 | 3300048905 | Bacteria | 6001 |
| 310 | Ga0496103_0013290 | 3300048906 | Bacteria | 4880 |
| 311 | Ga0496104_0080271 | 3300048907 | Bacteria | 3110 |
| 312 | Ga0496104_0184949 | 3300048907 | Bacteria | 1994 |
| 313 | Ga0496105_0044561 | 3300048908 | Bacteria | 3659 |
| 314 | Ga0496106_0036968 | 3300048909 | Bacteria | 3652 |
| 315 | Ga0496106_0040936 | 3300048909 | Bacteria | 3471 |
| 316 | Ga0496106_0464239 | 3300048909 | Bacteria | 1017 |
| 317 | Ga0496107_0001627 | 3300048910 | Bacteria | 14003 |
| 318 | Ga0496107_0041249 | 3300048910 | Bacteria | 3314 |
| 319 | Ga0496107_0271701 | 3300048910 | Bacteria | 1262 |
| 320 | Ga0496108_0008065 | 3300048911 | Bacteria | 8544 |
| 321 | Ga0496108_0207874 | 3300048911 | Bacteria | 1699 |
| 322 | Ga0496108_0546715 | 3300048911 | Bacteria | 1010 |
| 323 | Ga0496109_0021642 | 3300048912 | Bacteria | 5689 |
| 324 | Ga0496110_0065471 | 3300048913 | Bacteria | 3213 |
| 325 | Ga0496110_0152148 | 3300048913 | Bacteria | 2095 |
| 326 | Ga0496110_0362245 | 3300048913 | Bacteria | 1321 |
| 327 | Ga0496111_0167481 | 3300048914 | Bacteria | 1632 |
| 328 | Ga0496112_0032590 | 3300048915 | Bacteria | 5060 |
| 329 | Ga0496112_0070411 | 3300048915 | Bacteria | 3457 |
| 330 | Ga0496112_0127179 | 3300048915 | Bacteria | 2519 |
| 331 | Ga0496112_0308264 | 3300048915 | Bacteria | 1528 |
| 332 | Ga0496113_0036152 | 3300048916 | Bacteria | 3617 |
| 333 | Ga0496113_0323037 | 3300048916 | Unclassified | 1237 |
| 334 | Ga0496114_0000807 | 3300048917 | Bacteria | 23477 |
| 335 | Ga0496114_0207564 | 3300048917 | Bacteria | 1717 |
| 336 | Ga0496115_0001541 | 3300048918 | Bacteria | 16534 |
| 337 | Ga0496115_0067560 | 3300048918 | Bacteria | 2891 |
| 338 | Ga0496115_0071296 | 3300048918 | Bacteria | 2818 |
| 339 | Ga0496115_0206507 | 3300048918 | Bacteria | 1623 |
| 340 | Ga0501083_0140527 | 3300049744 | Bacteria | 1581 |
| 341 | nmdc:mga09592_191578_c1 | 3300050508 | Bacteria | 1770 |
| 342 | nmdc:mga09592_67263_c1 | 3300050508 | Bacteria | 3038 |
| 343 | nmdc:mga06r32_110279_c1 | 3300050510 | Bacteria | 2707 |
| 344 | nmdc:mga0n895_625223_c1 | 3300050512 | Bacteria | 1077 |
| 345 | nmdc:mga08x19_126563_c1 | 3300050514 | Bacteria | 1716 |
| 346 | nmdc:mga0a205_514278_c1 | 3300050515 | Bacteria | 1054 |
| 347 | Ga0500616_0001701 | 3300053153 | Bacteria | 20234 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005468 | Ga0070707_100011499 | Ga0070707_1000114994 | 258 |
| 2 | 3300025910 | Ga0207684_10065244 | Ga0207684_100652442 | 258 |
| 3 | 3300025910 | Ga0207684_10294909 | Ga0207684_102949092 | 258 |
| 4 | 3300025922 | Ga0207646_10079036 | Ga0207646_100790363 | 258 |
| 5 | 3300050508 | nmdc:mga09592_67263_c1 | nmdc:mga09592_67263_c1_1490_2266 | 258 |
| 6 | 3300009094 | Ga0111539_10899986 | Ga0111539_108999862 | 259 |
| 7 | 3300046472 | Ga0495580_0213476 | Ga0495580_0213476_466_1275 | 259 |
| 8 | 3300046475 | Ga0495639_0103513 | Ga0495639_0103513_181_990 | 259 |
| 9 | 3300046511 | Ga0495608_0113816 | Ga0495608_0113816_26_835 | 259 |
| 10 | 3300046517 | Ga0495630_0005296 | Ga0495630_0005296_388_1197 | 259 |
| 11 | 3300046531 | Ga0495665_0187380 | Ga0495665_0187380_198_1007 | 259 |
| 12 | 3300046690 | Ga0495624_0009044 | Ga0495624_0009044_1073_1882 | 259 |
| 13 | 3300047471 | Ga0495684_0000524 | Ga0495684_0000524_15531_16340 | 259 |
| 14 | 3300005290 | Ga0065712_10184779 | Ga0065712_101847791 | 260 |
| 15 | 3300005327 | Ga0070658_10052530 | Ga0070658_100525304 | 261 |
| 16 | 3300005341 | Ga0070691_10024540 | Ga0070691_100245402 | 261 |
| 17 | 3300005435 | Ga0070714_100015980 | Ga0070714_1000159803 | 261 |
| 18 | 3300005458 | Ga0070681_10128272 | Ga0070681_101282722 | 261 |
| 19 | 3300005471 | Ga0070698_100009010 | Ga0070698_1000090107 | 261 |
| 20 | 3300005577 | Ga0068857_100097473 | Ga0068857_1000974732 | 261 |
| 21 | 3300006847 | Ga0075431_100026070 | Ga0075431_1000260702 | 261 |
| 22 | 3300006880 | Ga0075429_100038943 | Ga0075429_1000389432 | 261 |
| 23 | 3300009093 | Ga0105240_10111607 | Ga0105240_101116073 | 261 |
| 24 | 3300010375 | Ga0105239_10027172 | Ga0105239_100271722 | 261 |
| 25 | 3300025909 | Ga0207705_10077775 | Ga0207705_100777752 | 261 |
| 26 | 3300025912 | Ga0207707_10171336 | Ga0207707_101713362 | 261 |
| 27 | 3300025913 | Ga0207695_10050391 | Ga0207695_100503913 | 261 |
| 28 | 3300025929 | Ga0207664_10011675 | Ga0207664_100116755 | 261 |
| 29 | 3300026116 | Ga0207674_10002133 | Ga0207674_100021333 | 261 |
| 30 | 3300039450 | Ga0436363_1654682 | Ga0436363_1654682_1156_1950 | 261 |
| 31 | 3300048918 | Ga0496115_0071296 | Ga0496115_0071296_186_980 | 261 |
| 32 | 3300050508 | nmdc:mga09592_191578_c1 | nmdc:mga09592_191578_c1_185_973 | 261 |
| 33 | 3300050510 | nmdc:mga06r32_110279_c1 | nmdc:mga06r32_110279_c1_1310_2098 | 261 |
| 34 | 3300050514 | nmdc:mga08x19_126563_c1 | nmdc:mga08x19_126563_c1_846_1631 | 261 |
| 35 | 3300005290 | Ga0065712_10001257 | Ga0065712_100012575 | 262 |
| 36 | 3300005354 | Ga0070675_100004050 | Ga0070675_1000040508 | 262 |
| 37 | 3300005364 | Ga0070673_100010948 | Ga0070673_1000109482 | 262 |
| 38 | 3300005437 | Ga0070710_10066793 | Ga0070710_100667932 | 262 |
| 39 | 3300005440 | Ga0070705_100210103 | Ga0070705_1002101032 | 262 |
| 40 | 3300005536 | Ga0070697_100373092 | Ga0070697_1003730922 | 262 |
| 41 | 3300005548 | Ga0070665_100031648 | Ga0070665_1000316485 | 262 |
| 42 | 3300006028 | Ga0070717_10010649 | Ga0070717_100106495 | 262 |
| 43 | 3300025915 | Ga0207693_10016930 | Ga0207693_100169306 | 262 |
| 44 | 3300025915 | Ga0207693_10016936 | Ga0207693_100169365 | 262 |
| 45 | 3300025933 | Ga0207706_10379597 | Ga0207706_103795972 | 262 |
| 46 | 3300025939 | Ga0207665_10025115 | Ga0207665_100251153 | 262 |
| 47 | 3300001990 | JGI24737J22298_10043678 | JGI24737J22298_100436782 | 263 |
| 48 | 3300002126 | JGI24035J26624_1000458 | JGI24035J26624_10004583 | 263 |
| 49 | 3300005290 | Ga0065712_10001389 | Ga0065712_100013895 | 263 |
| 50 | 3300005290 | Ga0065712_10026242 | Ga0065712_100262422 | 263 |
| 51 | 3300005293 | Ga0065715_10004361 | Ga0065715_100043613 | 263 |
| 52 | 3300005327 | Ga0070658_10047526 | Ga0070658_100475263 | 263 |
| 53 | 3300005329 | Ga0070683_100047898 | Ga0070683_1000478982 | 263 |
| 54 | 3300005330 | Ga0070690_100156376 | Ga0070690_1001563762 | 263 |
| 55 | 3300005335 | Ga0070666_10041424 | Ga0070666_100414243 | 263 |
| 56 | 3300005339 | Ga0070660_100040877 | Ga0070660_1000408774 | 263 |
| 57 | 3300005340 | Ga0070689_100001173 | Ga0070689_10000117317 | 263 |
| 58 | 3300005340 | Ga0070689_100033366 | Ga0070689_1000333663 | 263 |
| 59 | 3300005347 | Ga0070668_100063794 | Ga0070668_1000637943 | 263 |
| 60 | 3300005354 | Ga0070675_100002575 | Ga0070675_1000025753 | 263 |
| 61 | 3300005354 | Ga0070675_100042460 | Ga0070675_1000424603 | 263 |
| 62 | 3300005364 | Ga0070673_100038191 | Ga0070673_1000381913 | 263 |
| 63 | 3300005365 | Ga0070688_100008722 | Ga0070688_1000087223 | 263 |
| 64 | 3300005365 | Ga0070688_100034619 | Ga0070688_1000346193 | 263 |
| 65 | 3300005365 | Ga0070688_100048049 | Ga0070688_1000480492 | 263 |
| 66 | 3300005366 | Ga0070659_100001236 | Ga0070659_1000012364 | 263 |
| 67 | 3300005367 | Ga0070667_100282911 | Ga0070667_1002829112 | 263 |
| 68 | 3300005434 | Ga0070709_10141885 | Ga0070709_101418852 | 263 |
| 69 | 3300005439 | Ga0070711_100100283 | Ga0070711_1001002833 | 263 |
| 70 | 3300005440 | Ga0070705_100006791 | Ga0070705_1000067912 | 263 |
| 71 | 3300005441 | Ga0070700_100045670 | Ga0070700_1000456703 | 263 |
| 72 | 3300005457 | Ga0070662_100281081 | Ga0070662_1002810812 | 263 |
| 73 | 3300005466 | Ga0070685_10035454 | Ga0070685_100354543 | 263 |
| 74 | 3300005535 | Ga0070684_100000426 | Ga0070684_10000042628 | 263 |
| 75 | 3300005535 | Ga0070684_100072181 | Ga0070684_1000721812 | 263 |
| 76 | 3300005543 | Ga0070672_100204809 | Ga0070672_1002048092 | 263 |
| 77 | 3300005549 | Ga0070704_100009471 | Ga0070704_1000094715 | 263 |
| 78 | 3300005564 | Ga0070664_100160327 | Ga0070664_1001603273 | 263 |
| 79 | 3300005615 | Ga0070702_100019939 | Ga0070702_1000199393 | 263 |
| 80 | 3300005617 | Ga0068859_100021734 | Ga0068859_1000217343 | 263 |
| 81 | 3300005618 | Ga0068864_100056831 | Ga0068864_1000568312 | 263 |
| 82 | 3300005719 | Ga0068861_100680032 | Ga0068861_1006800321 | 263 |
| 83 | 3300005841 | Ga0068863_100025667 | Ga0068863_1000256671 | 263 |
| 84 | 3300005842 | Ga0068858_100006052 | Ga0068858_10000605215 | 263 |
| 85 | 3300005843 | Ga0068860_100102060 | Ga0068860_1001020602 | 263 |
| 86 | 3300005937 | Ga0081455_10112998 | Ga0081455_101129983 | 263 |
| 87 | 3300006163 | Ga0070715_10027426 | Ga0070715_100274262 | 263 |
| 88 | 3300006880 | Ga0075429_100111505 | Ga0075429_1001115052 | 263 |
| 89 | 3300006931 | Ga0097620_100021734 | Ga0097620_1000217343 | 263 |
| 90 | 3300009094 | Ga0111539_10137763 | Ga0111539_101377632 | 263 |
| 91 | 3300009147 | Ga0114129_10095379 | Ga0114129_100953793 | 263 |
| 92 | 3300009177 | Ga0105248_10619110 | Ga0105248_106191102 | 263 |
| 93 | 3300009545 | Ga0105237_10050068 | Ga0105237_100500682 | 263 |
| 94 | 3300009553 | Ga0105249_10030098 | Ga0105249_100300983 | 263 |
| 95 | 3300010375 | Ga0105239_10119519 | Ga0105239_101195193 | 263 |
| 96 | 3300010375 | Ga0105239_10185343 | Ga0105239_101853431 | 263 |
| 97 | 3300013297 | Ga0157378_10037540 | Ga0157378_100375403 | 263 |
| 98 | 3300013297 | Ga0157378_10151844 | Ga0157378_101518443 | 263 |
| 99 | 3300013308 | Ga0157375_10016306 | Ga0157375_100163063 | 263 |
| 100 | 3300014325 | Ga0163163_10345790 | Ga0163163_103457901 | 263 |
| 101 | 3300014745 | Ga0157377_10012252 | Ga0157377_100122523 | 263 |
| 102 | 3300014968 | Ga0157379_10011479 | Ga0157379_100114796 | 263 |
| 103 | 3300025290 | Ga0207673_1002844 | Ga0207673_10028442 | 263 |
| 104 | 3300025290 | Ga0207673_1004065 | Ga0207673_10040652 | 263 |
| 105 | 3300025315 | Ga0207697_10003817 | Ga0207697_100038174 | 263 |
| 106 | 3300025315 | Ga0207697_10005156 | Ga0207697_100051565 | 263 |
| 107 | 3300025315 | Ga0207697_10100683 | Ga0207697_101006832 | 263 |
| 108 | 3300025885 | Ga0207653_10011708 | Ga0207653_100117083 | 263 |
| 109 | 3300025903 | Ga0207680_10040629 | Ga0207680_100406293 | 263 |
| 110 | 3300025904 | Ga0207647_10000620 | Ga0207647_1000062027 | 263 |
| 111 | 3300025905 | Ga0207685_10029294 | Ga0207685_100292943 | 263 |
| 112 | 3300025906 | Ga0207699_10073308 | Ga0207699_100733083 | 263 |
| 113 | 3300025909 | Ga0207705_10045800 | Ga0207705_100458002 | 263 |
| 114 | 3300025909 | Ga0207705_10387810 | Ga0207705_103878101 | 263 |
| 115 | 3300025912 | Ga0207707_10054969 | Ga0207707_100549693 | 263 |
| 116 | 3300025915 | Ga0207693_10118326 | Ga0207693_101183262 | 263 |
| 117 | 3300025917 | Ga0207660_10036397 | Ga0207660_100363972 | 263 |
| 118 | 3300025919 | Ga0207657_10043905 | Ga0207657_100439052 | 263 |
| 119 | 3300025926 | Ga0207659_10008854 | Ga0207659_100088543 | 263 |
| 120 | 3300025928 | Ga0207700_10024658 | Ga0207700_100246583 | 263 |
| 121 | 3300025928 | Ga0207700_10087585 | Ga0207700_100875852 | 263 |
| 122 | 3300025931 | Ga0207644_10036121 | Ga0207644_100361213 | 263 |
| 123 | 3300025932 | Ga0207690_10005851 | Ga0207690_100058517 | 263 |
| 124 | 3300025933 | Ga0207706_10265218 | Ga0207706_102652182 | 263 |
| 125 | 3300025935 | Ga0207709_10069132 | Ga0207709_100691322 | 263 |
| 126 | 3300025936 | Ga0207670_10000514 | Ga0207670_1000051421 | 263 |
| 127 | 3300025936 | Ga0207670_10006658 | Ga0207670_100066581 | 263 |
| 128 | 3300025936 | Ga0207670_10019538 | Ga0207670_100195384 | 263 |
| 129 | 3300025938 | Ga0207704_10122426 | Ga0207704_101224263 | 263 |
| 130 | 3300025944 | Ga0207661_10022386 | Ga0207661_100223862 | 263 |
| 131 | 3300025944 | Ga0207661_10060178 | Ga0207661_100601783 | 263 |
| 132 | 3300025945 | Ga0207679_10044828 | Ga0207679_100448282 | 263 |
| 133 | 3300025960 | Ga0207651_10111514 | Ga0207651_101115142 | 263 |
| 134 | 3300025961 | Ga0207712_10007661 | Ga0207712_100076612 | 263 |
| 135 | 3300025972 | Ga0207668_10148440 | Ga0207668_101484402 | 263 |
| 136 | 3300026075 | Ga0207708_10063714 | Ga0207708_100637143 | 263 |
| 137 | 3300026075 | Ga0207708_10443269 | Ga0207708_104432691 | 263 |
| 138 | 3300026078 | Ga0207702_10094630 | Ga0207702_100946303 | 263 |
| 139 | 3300026088 | Ga0207641_10044912 | Ga0207641_100449123 | 263 |
| 140 | 3300026088 | Ga0207641_10660540 | Ga0207641_106605402 | 263 |
| 141 | 3300028379 | Ga0268266_10030292 | Ga0268266_100302922 | 263 |
| 142 | 3300028381 | Ga0268264_10007471 | Ga0268264_100074713 | 263 |
| 143 | 3300028800 | Ga0265338_10000556 | Ga0265338_1000055645 | 263 |
| 144 | 3300029957 | Ga0265324_10000734 | Ga0265324_100007341 | 263 |
| 145 | 3300046454 | Ga0495592_0135753 | Ga0495592_0135753_214_1098 | 263 |
| 146 | 3300046455 | Ga0495603_0152000 | Ga0495603_0152000_514_1320 | 263 |
| 147 | 3300046511 | Ga0495608_0241453 | Ga0495608_0241453_261_1067 | 263 |
| 148 | 3300046516 | Ga0495628_0148685 | Ga0495628_0148685_216_1100 | 263 |
| 149 | 3300046533 | Ga0495640_0116659 | Ga0495640_0116659_395_1201 | 263 |
| 150 | 3300046543 | Ga0495645_0213422 | Ga0495645_0213422_396_1280 | 263 |
| 151 | 3300046683 | Ga0495658_0184420 | Ga0495658_0184420_183_989 | 263 |
| 152 | 3300046690 | Ga0495624_0109182 | Ga0495624_0109182_425_1231 | 263 |
| 153 | 3300048905 | Ga0496102_0010349 | Ga0496102_0010349_3709_4509 | 263 |
| 154 | 3300048905 | Ga0496102_0019329 | Ga0496102_0019329_628_1428 | 263 |
| 155 | 3300048907 | Ga0496104_0080271 | Ga0496104_0080271_433_1233 | 263 |
| 156 | 3300048908 | Ga0496105_0044561 | Ga0496105_0044561_2362_3162 | 263 |
| 157 | 3300048909 | Ga0496106_0036968 | Ga0496106_0036968_232_1032 | 263 |
| 158 | 3300048910 | Ga0496107_0041249 | Ga0496107_0041249_571_1371 | 263 |
| 159 | 3300048910 | Ga0496107_0271701 | Ga0496107_0271701_405_1205 | 263 |
| 160 | 3300048911 | Ga0496108_0008065 | Ga0496108_0008065_2845_3645 | 263 |
| 161 | 3300048911 | Ga0496108_0546715 | Ga0496108_0546715_32_832 | 263 |
| 162 | 3300048912 | Ga0496109_0021642 | Ga0496109_0021642_4423_5223 | 263 |
| 163 | 3300048913 | Ga0496110_0152148 | Ga0496110_0152148_426_1226 | 263 |
| 164 | 3300048913 | Ga0496110_0362245 | Ga0496110_0362245_204_1004 | 263 |
| 165 | 3300048914 | Ga0496111_0167481 | Ga0496111_0167481_63_863 | 263 |
| 166 | 3300048915 | Ga0496112_0070411 | Ga0496112_0070411_2382_3173 | 263 |
| 167 | 3300048915 | Ga0496112_0127179 | Ga0496112_0127179_578_1378 | 263 |
| 168 | 3300048916 | Ga0496113_0036152 | Ga0496113_0036152_1510_2310 | 263 |
| 169 | 3300048916 | Ga0496113_0323037 | Ga0496113_0323037_72_872 | 263 |
| 170 | 3300048917 | Ga0496114_0000807 | Ga0496114_0000807_5611_6411 | 263 |
| 171 | 3300048918 | Ga0496115_0001541 | Ga0496115_0001541_13448_14248 | 263 |
| 172 | 3300048918 | Ga0496115_0206507 | Ga0496115_0206507_508_1308 | 263 |
| 173 | 3300049744 | Ga0501083_0140527 | Ga0501083_0140527_440_1246 | 263 |
| 174 | 3300000545 | CNXas_1000270 | CNXas_10002704 | 264 |
| 175 | 3300003320 | rootH2_10081500 | rootH2_100815006 | 264 |
| 176 | 3300005289 | Ga0065704_10164461 | Ga0065704_101644612 | 264 |
| 177 | 3300005290 | Ga0065712_10118525 | Ga0065712_101185252 | 264 |
| 178 | 3300005328 | Ga0070676_10022201 | Ga0070676_100222013 | 264 |
| 179 | 3300005328 | Ga0070676_10132976 | Ga0070676_101329762 | 264 |
| 180 | 3300005329 | Ga0070683_100200102 | Ga0070683_1002001022 | 264 |
| 181 | 3300005330 | Ga0070690_100056419 | Ga0070690_1000564192 | 264 |
| 182 | 3300005331 | Ga0070670_100013961 | Ga0070670_1000139613 | 264 |
| 183 | 3300005335 | Ga0070666_10402539 | Ga0070666_104025391 | 264 |
| 184 | 3300005338 | Ga0068868_100103537 | Ga0068868_1001035372 | 264 |
| 185 | 3300005338 | Ga0068868_100148483 | Ga0068868_1001484831 | 264 |
| 186 | 3300005340 | Ga0070689_100009773 | Ga0070689_1000097732 | 264 |
| 187 | 3300005340 | Ga0070689_100043704 | Ga0070689_1000437043 | 264 |
| 188 | 3300005343 | Ga0070687_100015735 | Ga0070687_1000157352 | 264 |
| 189 | 3300005347 | Ga0070668_100003335 | Ga0070668_1000033353 | 264 |
| 190 | 3300005347 | Ga0070668_100024812 | Ga0070668_1000248122 | 264 |
| 191 | 3300005353 | Ga0070669_100006544 | Ga0070669_1000065442 | 264 |
| 192 | 3300005354 | Ga0070675_100018222 | Ga0070675_1000182223 | 264 |
| 193 | 3300005355 | Ga0070671_100004202 | Ga0070671_1000042023 | 264 |
| 194 | 3300005356 | Ga0070674_100010770 | Ga0070674_1000107703 | 264 |
| 195 | 3300005356 | Ga0070674_100398965 | Ga0070674_1003989651 | 264 |
| 196 | 3300005364 | Ga0070673_100034437 | Ga0070673_1000344372 | 264 |
| 197 | 3300005365 | Ga0070688_100001014 | Ga0070688_10000101415 | 264 |
| 198 | 3300005366 | Ga0070659_100131269 | Ga0070659_1001312692 | 264 |
| 199 | 3300005367 | Ga0070667_100054866 | Ga0070667_1000548663 | 264 |
| 200 | 3300005367 | Ga0070667_100094904 | Ga0070667_1000949042 | 264 |
| 201 | 3300005436 | Ga0070713_100087586 | Ga0070713_1000875862 | 264 |
| 202 | 3300005437 | Ga0070710_10061639 | Ga0070710_100616391 | 264 |
| 203 | 3300005444 | Ga0070694_100362617 | Ga0070694_1003626171 | 264 |
| 204 | 3300005445 | Ga0070708_100368945 | Ga0070708_1003689451 | 264 |
| 205 | 3300005456 | Ga0070678_100036038 | Ga0070678_1000360383 | 264 |
| 206 | 3300005457 | Ga0070662_100018238 | Ga0070662_1000182384 | 264 |
| 207 | 3300005459 | Ga0068867_100009796 | Ga0068867_1000097964 | 264 |
| 208 | 3300005471 | Ga0070698_100207175 | Ga0070698_1002071752 | 264 |
| 209 | 3300005471 | Ga0070698_100436827 | Ga0070698_1004368272 | 264 |
| 210 | 3300005543 | Ga0070672_100005133 | Ga0070672_1000051339 | 264 |
| 211 | 3300005547 | Ga0070693_100147378 | Ga0070693_1001473782 | 264 |
| 212 | 3300005548 | Ga0070665_100012850 | Ga0070665_1000128507 | 264 |
| 213 | 3300005577 | Ga0068857_100121888 | Ga0068857_1001218882 | 264 |
| 214 | 3300005577 | Ga0068857_100135232 | Ga0068857_1001352321 | 264 |
| 215 | 3300005614 | Ga0068856_100003900 | Ga0068856_1000039006 | 264 |
| 216 | 3300005615 | Ga0070702_100122297 | Ga0070702_1001222972 | 264 |
| 217 | 3300005618 | Ga0068864_100551949 | Ga0068864_1005519492 | 264 |
| 218 | 3300005718 | Ga0068866_10015248 | Ga0068866_100152483 | 264 |
| 219 | 3300005843 | Ga0068860_100107102 | Ga0068860_1001071022 | 264 |
| 220 | 3300005843 | Ga0068860_100546006 | Ga0068860_1005460062 | 264 |
| 221 | 3300005844 | Ga0068862_100061677 | Ga0068862_1000616771 | 264 |
| 222 | 3300005844 | Ga0068862_100205789 | Ga0068862_1002057892 | 264 |
| 223 | 3300005937 | Ga0081455_10000805 | Ga0081455_1000080513 | 264 |
| 224 | 3300005937 | Ga0081455_10014179 | Ga0081455_100141796 | 264 |
| 225 | 3300005937 | Ga0081455_10056238 | Ga0081455_100562383 | 264 |
| 226 | 3300005937 | Ga0081455_10169063 | Ga0081455_101690632 | 264 |
| 227 | 3300005985 | Ga0081539_10017546 | Ga0081539_100175465 | 264 |
| 228 | 3300005985 | Ga0081539_10026445 | Ga0081539_100264454 | 264 |
| 229 | 3300006028 | Ga0070717_10005932 | Ga0070717_100059323 | 264 |
| 230 | 3300006028 | Ga0070717_10018229 | Ga0070717_100182293 | 264 |
| 231 | 3300006028 | Ga0070717_10035678 | Ga0070717_100356783 | 264 |
| 232 | 3300006237 | Ga0097621_100011254 | Ga0097621_1000112543 | 264 |
| 233 | 3300006358 | Ga0068871_100015382 | Ga0068871_1000153825 | 264 |
| 234 | 3300006871 | Ga0075434_100107983 | Ga0075434_1001079833 | 264 |
| 235 | 3300006871 | Ga0075434_100901947 | Ga0075434_1009019471 | 264 |
| 236 | 3300006881 | Ga0068865_100063104 | Ga0068865_1000631043 | 264 |
| 237 | 3300009098 | Ga0105245_10249244 | Ga0105245_102492442 | 264 |
| 238 | 3300009551 | Ga0105238_10338972 | Ga0105238_103389722 | 264 |
| 239 | 3300009553 | Ga0105249_10110547 | Ga0105249_101105473 | 264 |
| 240 | 3300013296 | Ga0157374_10008256 | Ga0157374_100082567 | 264 |
| 241 | 3300013296 | Ga0157374_10136827 | Ga0157374_101368272 | 264 |
| 242 | 3300013297 | Ga0157378_10008653 | Ga0157378_100086532 | 264 |
| 243 | 3300013297 | Ga0157378_10027220 | Ga0157378_100272203 | 264 |
| 244 | 3300013297 | Ga0157378_10088660 | Ga0157378_100886602 | 264 |
| 245 | 3300013306 | Ga0163162_10006459 | Ga0163162_100064599 | 264 |
| 246 | 3300013307 | Ga0157372_10085585 | Ga0157372_100855852 | 264 |
| 247 | 3300013307 | Ga0157372_10590928 | Ga0157372_105909282 | 264 |
| 248 | 3300013308 | Ga0157375_10026649 | Ga0157375_100266493 | 264 |
| 249 | 3300013308 | Ga0157375_10260762 | Ga0157375_102607621 | 264 |
| 250 | 3300014325 | Ga0163163_10034732 | Ga0163163_100347322 | 264 |
| 251 | 3300014969 | Ga0157376_10431088 | Ga0157376_104310882 | 264 |
| 252 | 3300017792 | Ga0163161_10014284 | Ga0163161_100142844 | 264 |
| 253 | 3300025315 | Ga0207697_10000150 | Ga0207697_1000015015 | 264 |
| 254 | 3300025315 | Ga0207697_10000270 | Ga0207697_100002702 | 264 |
| 255 | 3300025315 | Ga0207697_10000696 | Ga0207697_100006964 | 264 |
| 256 | 3300025898 | Ga0207692_10099507 | Ga0207692_100995072 | 264 |
| 257 | 3300025901 | Ga0207688_10000453 | Ga0207688_1000045317 | 264 |
| 258 | 3300025903 | Ga0207680_10019937 | Ga0207680_100199373 | 264 |
| 259 | 3300025905 | Ga0207685_10027463 | Ga0207685_100274632 | 264 |
| 260 | 3300025906 | Ga0207699_10047898 | Ga0207699_100478982 | 264 |
| 261 | 3300025907 | Ga0207645_10002422 | Ga0207645_100024223 | 264 |
| 262 | 3300025907 | Ga0207645_10015563 | Ga0207645_100155633 | 264 |
| 263 | 3300025910 | Ga0207684_10067576 | Ga0207684_100675762 | 264 |
| 264 | 3300025915 | Ga0207693_10004109 | Ga0207693_100041097 | 264 |
| 265 | 3300025918 | Ga0207662_10000246 | Ga0207662_100002463 | 264 |
| 266 | 3300025922 | Ga0207646_10129938 | Ga0207646_101299382 | 264 |
| 267 | 3300025922 | Ga0207646_10241506 | Ga0207646_102415062 | 264 |
| 268 | 3300025923 | Ga0207681_10019984 | Ga0207681_100199843 | 264 |
| 269 | 3300025924 | Ga0207694_10256559 | Ga0207694_102565592 | 264 |
| 270 | 3300025925 | Ga0207650_10064547 | Ga0207650_100645472 | 264 |
| 271 | 3300025925 | Ga0207650_10143125 | Ga0207650_101431252 | 264 |
| 272 | 3300025926 | Ga0207659_10024207 | Ga0207659_100242073 | 264 |
| 273 | 3300025926 | Ga0207659_10034615 | Ga0207659_100346151 | 264 |
| 274 | 3300025927 | Ga0207687_10372573 | Ga0207687_103725731 | 264 |
| 275 | 3300025928 | Ga0207700_10028591 | Ga0207700_100285913 | 264 |
| 276 | 3300025931 | Ga0207644_10033695 | Ga0207644_100336951 | 264 |
| 277 | 3300025931 | Ga0207644_10102595 | Ga0207644_101025952 | 264 |
| 278 | 3300025931 | Ga0207644_10249176 | Ga0207644_102491762 | 264 |
| 279 | 3300025933 | Ga0207706_10004464 | Ga0207706_1000446412 | 264 |
| 280 | 3300025937 | Ga0207669_10070588 | Ga0207669_100705883 | 264 |
| 281 | 3300025938 | Ga0207704_10232250 | Ga0207704_102322502 | 264 |
| 282 | 3300025939 | Ga0207665_10009063 | Ga0207665_100090635 | 264 |
| 283 | 3300025940 | Ga0207691_10000689 | Ga0207691_1000068929 | 264 |
| 284 | 3300025940 | Ga0207691_10007657 | Ga0207691_100076576 | 264 |
| 285 | 3300025960 | Ga0207651_10034289 | Ga0207651_100342891 | 264 |
| 286 | 3300025960 | Ga0207651_10067602 | Ga0207651_100676022 | 264 |
| 287 | 3300025972 | Ga0207668_10026329 | Ga0207668_100263293 | 264 |
| 288 | 3300025972 | Ga0207668_10108528 | Ga0207668_101085282 | 264 |
| 289 | 3300025986 | Ga0207658_10040639 | Ga0207658_100406393 | 264 |
| 290 | 3300026023 | Ga0207677_10026375 | Ga0207677_100263754 | 264 |
| 291 | 3300026078 | Ga0207702_10000106 | Ga0207702_1000010637 | 264 |
| 292 | 3300026089 | Ga0207648_10119909 | Ga0207648_101199092 | 264 |
| 293 | 3300026095 | Ga0207676_10031567 | Ga0207676_100315671 | 264 |
| 294 | 3300026116 | Ga0207674_10053240 | Ga0207674_100532403 | 264 |
| 295 | 3300026116 | Ga0207674_10180472 | Ga0207674_101804723 | 264 |
| 296 | 3300026118 | Ga0207675_100450666 | Ga0207675_1004506662 | 264 |
| 297 | 3300026121 | Ga0207683_10390276 | Ga0207683_103902762 | 264 |
| 298 | 3300028379 | Ga0268266_10047755 | Ga0268266_100477553 | 264 |
| 299 | 3300028379 | Ga0268266_10121616 | Ga0268266_101216163 | 264 |
| 300 | 3300028381 | Ga0268264_10078244 | Ga0268264_100782443 | 264 |
| 301 | 3300028381 | Ga0268264_10156601 | Ga0268264_101566012 | 264 |
| 302 | 3300028558 | Ga0265326_10003623 | Ga0265326_100036232 | 264 |
| 303 | 3300028800 | Ga0265338_10000050 | Ga0265338_100000508 | 264 |
| 304 | 3300028800 | Ga0265338_10000237 | Ga0265338_1000023780 | 264 |
| 305 | 3300028800 | Ga0265338_10004029 | Ga0265338_1000402914 | 264 |
| 306 | 3300031247 | Ga0265340_10021561 | Ga0265340_100215613 | 264 |
| 307 | 3300031456 | Ga0307513_10007924 | Ga0307513_1000792412 | 264 |
| 308 | 3300035116 | Ga0373945_0099911 | Ga0373945_0099911_85_879 | 264 |
| 309 | 3300035170 | Ga0373943_0072481 | Ga0373943_0072481_673_1470 | 264 |
| 310 | 3300035170 | Ga0373943_0119273 | Ga0373943_0119273_309_1112 | 264 |
| 311 | 3300035170 | Ga0373943_0221041 | Ga0373943_0221041_52_849 | 264 |
| 312 | 3300035692 | Ga0373935_0046808 | Ga0373935_0046808_969_1763 | 264 |
| 313 | 3300035725 | Ga0373947_0056230 | Ga0373947_0056230_538_1335 | 264 |
| 314 | 3300035725 | Ga0373947_0074908 | Ga0373947_0074908_479_1276 | 264 |
| 315 | 3300036401 | Ga0373937_0207348 | Ga0373937_0207348_100_918 | 264 |
| 316 | 3300037068 | Ga0373925_0219594 | Ga0373925_0219594_48_851 | 264 |
| 317 | 3300044673 | Ga0453683_0306885 | Ga0453683_0306885_64_885 | 264 |
| 318 | 3300044719 | Ga0466971_0066170 | Ga0466971_0066170_806_1615 | 264 |
| 319 | 3300045976 | Ga0466967_0051348 | Ga0466967_0051348_722_1531 | 264 |
| 320 | 3300046454 | Ga0495592_0169872 | Ga0495592_0169872_406_1224 | 264 |
| 321 | 3300046462 | Ga0495651_0023166 | Ga0495651_0023166_1015_1833 | 264 |
| 322 | 3300046516 | Ga0495628_0000013 | Ga0495628_0000013_57079_57885 | 264 |
| 323 | 3300046517 | Ga0495630_0037430 | Ga0495630_0037430_2705_3523 | 264 |
| 324 | 3300046536 | Ga0495587_0080799 | Ga0495587_0080799_793_1611 | 264 |
| 325 | 3300046559 | Ga0495667_0046613 | Ga0495667_0046613_816_1634 | 264 |
| 326 | 3300046689 | Ga0495613_0169308 | Ga0495613_0169308_557_1366 | 264 |
| 327 | 3300047322 | Ga0495680_0058010 | Ga0495680_0058010_1448_2263 | 264 |
| 328 | 3300047444 | Ga0495675_0141248 | Ga0495675_0141248_369_1187 | 264 |
| 329 | 3300047471 | Ga0495684_0003158 | Ga0495684_0003158_11926_12732 | 264 |
| 330 | 3300047471 | Ga0495684_0042204 | Ga0495684_0042204_1615_2433 | 264 |
| 331 | 3300048903 | Ga0496100_0019858 | Ga0496100_0019858_1949_2752 | 264 |
| 332 | 3300048904 | Ga0496101_0028385 | Ga0496101_0028385_2853_3656 | 264 |
| 333 | 3300048905 | Ga0496102_0012258 | Ga0496102_0012258_1792_2595 | 264 |
| 334 | 3300048906 | Ga0496103_0013290 | Ga0496103_0013290_1027_1830 | 264 |
| 335 | 3300048907 | Ga0496104_0184949 | Ga0496104_0184949_921_1724 | 264 |
| 336 | 3300048909 | Ga0496106_0040936 | Ga0496106_0040936_1144_1947 | 264 |
| 337 | 3300048909 | Ga0496106_0464239 | Ga0496106_0464239_52_873 | 264 |
| 338 | 3300048910 | Ga0496107_0001627 | Ga0496107_0001627_2458_3261 | 264 |
| 339 | 3300048911 | Ga0496108_0207874 | Ga0496108_0207874_523_1326 | 264 |
| 340 | 3300048913 | Ga0496110_0065471 | Ga0496110_0065471_1308_2111 | 264 |
| 341 | 3300048915 | Ga0496112_0032590 | Ga0496112_0032590_1989_2792 | 264 |
| 342 | 3300048915 | Ga0496112_0308264 | Ga0496112_0308264_111_911 | 264 |
| 343 | 3300048917 | Ga0496114_0207564 | Ga0496114_0207564_695_1498 | 264 |
| 344 | 3300048918 | Ga0496115_0067560 | Ga0496115_0067560_1864_2667 | 264 |
| 345 | 3300050512 | nmdc:mga0n895_625223_c1 | nmdc:mga0n895_625223_c1_190_1011 | 264 |
| 346 | 3300050515 | nmdc:mga0a205_514278_c1 | nmdc:mga0a205_514278_c1_127_948 | 264 |
| 347 | 3300053153 | Ga0500616_0001701 | Ga0500616_0001701_18940_19761 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pux-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 | 0.9347 | 11 | 230 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.9309 | 11 | 228 |
| 3rlf-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.9306 | 11 | 228 |
| 2r6g-assembly1.cif.gz_A | the crystal structure of the e. coli maltose transporter | 0.9299 | 11 | 228 |
| 8hpr-assembly1.cif.gz_D | lpqy-sugabc in state 4 | 0.9166 | 11 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9471 | 8 | 230 | 3.40.50.300 |
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.941 | 12 | 258 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9403 | 12 | 252 | 3.40.50.300 |
| af_Q57855_15_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9253 | 12 | 252 | 3.40.50.300 |
| af_Q2G1I6_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9219 | 12 | 258 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z9J2N6-F1-model_v4 | Nitrate ABC transporter ATP-binding protein | 0.9599 | 11 | 258 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7C6CYV5-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9523 | 15 | 229 |
GO:0005524
GO:0016887 |
| AF-A0A7V4SRL2-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9523 | 12 | 177 |
GO:0005524
GO:0016887 |
| AF-A0A259DVR4-F1-model_v4 | deleted | 0.9516 | 7 | 261 |
|
| AF-A0A7W4J802-F1-model_v4 | ABC transporter ATP-binding protein | 0.9464 | 10 | 259 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar