F417193

General Info

Members Datasets Scaffolds Average Seq Length
347 200 347 269

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10004029|Ga0265338_1000402914
Length 308
Sequence MVTTASTEGSSLRILGVSKSFPAPGNAAVHNLALDTITLSVAAGELIAIIGPSGCGKSTMLRLVAGLDAPDSGELWVGNDPITAPSAERGLVFQDPNLFPWLTVSRNIQAGLIARGLLHKKRPEVNEFMRLVGLEAFAHAYPHHLSGGMAQRVALARALINHPKVLLLDEPLGALDAFTRMRMQDEVLRLWQARRTTMLLVTHDIDEAIYMADRIVIMTPHPGRIERTISVTLDRPRQRNSPEFLRLRSDILEQLHFAGNAKGETNGRTSLDNNVDVDSVGKSNKPPFSPPDEPTTAPIMSGMTGTQD

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 10.09
Rhizosphere 88.76
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000270 3300000545 Bacteria 5476
2 JGI24737J22298_10043678 3300001990 Bacteria 1372
3 JGI24035J26624_1000458 3300002126 Bacteria 3851
4 rootH2_10081500 3300003320 Bacteria 23617
5 Ga0065704_10164461 3300005289 Bacteria 1332
6 Ga0065712_10001257 3300005290 Bacteria 6492
7 Ga0065712_10001389 3300005290 Bacteria 6709
8 Ga0065712_10026242 3300005290 Unclassified 1552
9 Ga0065712_10118525 3300005290 Bacteria 1705
10 Ga0065712_10184779 3300005290 Bacteria 1165
11 Ga0065715_10004361 3300005293 Bacteria 5044
12 Ga0070658_10047526 3300005327 Bacteria 3473
13 Ga0070658_10052530 3300005327 Bacteria 3306
14 Ga0070676_10022201 3300005328 Bacteria 3558
15 Ga0070676_10132976 3300005328 Bacteria 1575
16 Ga0070683_100047898 3300005329 Bacteria 3951
17 Ga0070683_100200102 3300005329 Bacteria 1897
18 Ga0070690_100056419 3300005330 Bacteria 2519
19 Ga0070690_100156376 3300005330 Bacteria 1559
20 Ga0070670_100013961 3300005331 Bacteria 6889
21 Ga0070666_10041424 3300005335 Bacteria 3078
22 Ga0070666_10402539 3300005335 Bacteria 984
23 Ga0068868_100103537 3300005338 Bacteria 2306
24 Ga0068868_100148483 3300005338 Bacteria 1929
25 Ga0070660_100040877 3300005339 Bacteria 3532
26 Ga0070689_100001173 3300005340 Bacteria 16583
27 Ga0070689_100009773 3300005340 Bacteria 6815
28 Ga0070689_100033366 3300005340 Bacteria 3922
29 Ga0070689_100043704 3300005340 Bacteria 3444
30 Ga0070691_10024540 3300005341 Bacteria 2802
31 Ga0070687_100015735 3300005343 Bacteria 3428
32 Ga0070668_100003335 3300005347 Bacteria 11844
33 Ga0070668_100024812 3300005347 Bacteria 4544
34 Ga0070668_100063794 3300005347 Bacteria 2856
35 Ga0070669_100006544 3300005353 Bacteria 8386
36 Ga0070675_100002575 3300005354 Bacteria 13589
37 Ga0070675_100004050 3300005354 Bacteria 11125
38 Ga0070675_100018222 3300005354 Bacteria 5589
39 Ga0070675_100042460 3300005354 Bacteria 3715
40 Ga0070671_100004202 3300005355 Bacteria 11390
41 Ga0070674_100010770 3300005356 Bacteria 5544
42 Ga0070674_100398965 3300005356 Bacteria 1123
43 Ga0070673_100010948 3300005364 Bacteria 6170
44 Ga0070673_100034437 3300005364 Bacteria 3833
45 Ga0070673_100038191 3300005364 Bacteria 3665
46 Ga0070688_100001014 3300005365 Bacteria 14119
47 Ga0070688_100008722 3300005365 Bacteria 5514
48 Ga0070688_100034619 3300005365 Bacteria 3061
49 Ga0070688_100048049 3300005365 Bacteria 2650
50 Ga0070659_100001236 3300005366 Bacteria 18545
51 Ga0070659_100131269 3300005366 Bacteria 2035
52 Ga0070667_100054866 3300005367 Bacteria 3365
53 Ga0070667_100094904 3300005367 Bacteria 2571
54 Ga0070667_100282911 3300005367 Bacteria 1490
55 Ga0070709_10141885 3300005434 Bacteria 1651
56 Ga0070714_100015980 3300005435 Bacteria 6052
57 Ga0070713_100087586 3300005436 Bacteria 2671
58 Ga0070710_10061639 3300005437 Bacteria 2137
59 Ga0070710_10066793 3300005437 Bacteria 2062
60 Ga0070711_100100283 3300005439 Bacteria 2105
61 Ga0070705_100006791 3300005440 Bacteria 5629
62 Ga0070705_100210103 3300005440 Bacteria 1341
63 Ga0070700_100045670 3300005441 Bacteria 2703
64 Ga0070694_100362617 3300005444 Bacteria 1126
65 Ga0070708_100368945 3300005445 Bacteria 1353
66 Ga0070678_100036038 3300005456 Bacteria 3460
67 Ga0070662_100018238 3300005457 Bacteria 4744
68 Ga0070662_100281081 3300005457 Bacteria 1347
69 Ga0070681_10128272 3300005458 Bacteria 2469
70 Ga0068867_100009796 3300005459 Bacteria 6752
71 Ga0070685_10035454 3300005466 Bacteria 2814
72 Ga0070707_100011499 3300005468 Bacteria 8253
73 Ga0070698_100009010 3300005471 Bacteria 10728
74 Ga0070698_100207175 3300005471 Bacteria 1896
75 Ga0070698_100436827 3300005471 Bacteria 1244
76 Ga0070684_100000426 3300005535 Bacteria 28892
77 Ga0070684_100072181 3300005535 Bacteria 3038
78 Ga0070697_100373092 3300005536 Bacteria 1235
79 Ga0070672_100005133 3300005543 Bacteria 8642
80 Ga0070672_100204809 3300005543 Bacteria 1651
81 Ga0070693_100147378 3300005547 Bacteria 1487
82 Ga0070665_100012850 3300005548 Bacteria 8429
83 Ga0070665_100031648 3300005548 Bacteria 5325
84 Ga0070704_100009471 3300005549 Bacteria 5886
85 Ga0070664_100160327 3300005564 Bacteria 1990
86 Ga0068857_100097473 3300005577 Bacteria 2636
87 Ga0068857_100121888 3300005577 Bacteria 2348
88 Ga0068857_100135232 3300005577 Bacteria 2225
89 Ga0068856_100003900 3300005614 Bacteria 14959
90 Ga0070702_100019939 3300005615 Bacteria 3506
91 Ga0070702_100122297 3300005615 Bacteria 1631
92 Ga0068859_100021734 3300005617 Bacteria 6436
93 Ga0068864_100056831 3300005618 Bacteria 3381
94 Ga0068864_100551949 3300005618 Bacteria 1114
95 Ga0068866_10015248 3300005718 Bacteria 3412
96 Ga0068861_100680032 3300005719 Bacteria 954
97 Ga0068863_100025667 3300005841 Bacteria 5620
98 Ga0068858_100006052 3300005842 Bacteria 11791
99 Ga0068860_100102060 3300005843 Bacteria 2737
100 Ga0068860_100107102 3300005843 Bacteria 2671
101 Ga0068860_100546006 3300005843 Bacteria 1161
102 Ga0068862_100061677 3300005844 Bacteria 3223
103 Ga0068862_100205789 3300005844 Bacteria 1776
104 Ga0081455_10000805 3300005937 Bacteria 40380
105 Ga0081455_10014179 3300005937 Bacteria 7827
106 Ga0081455_10056238 3300005937 Bacteria 3342
107 Ga0081455_10112998 3300005937 Bacteria 2155
108 Ga0081455_10169063 3300005937 Bacteria 1667
109 Ga0081539_10017546 3300005985 Bacteria 5018
110 Ga0081539_10026445 3300005985 Bacteria 3703
111 Ga0070717_10005932 3300006028 Bacteria 8946
112 Ga0070717_10010649 3300006028 Bacteria 6950
113 Ga0070717_10018229 3300006028 Bacteria 5478
114 Ga0070717_10035678 3300006028 Bacteria 4028
115 Ga0070715_10027426 3300006163 Bacteria 2275
116 Ga0097621_100011254 3300006237 Bacteria 6586
117 Ga0068871_100015382 3300006358 Bacteria 5724
118 Ga0075431_100026070 3300006847 Bacteria 5994
119 Ga0075434_100107983 3300006871 Bacteria 2794
120 Ga0075434_100901947 3300006871 Bacteria 899
121 Ga0075429_100038943 3300006880 Bacteria 4138
122 Ga0075429_100111505 3300006880 Bacteria 2391
123 Ga0068865_100063104 3300006881 Bacteria 2603
124 Ga0097620_100021734 3300006931 Bacteria 6436
125 Ga0105240_10111607 3300009093 Bacteria 3307
126 Ga0111539_10137763 3300009094 Bacteria 2858
127 Ga0111539_10899986 3300009094 Unclassified 1029
128 Ga0105245_10249244 3300009098 Bacteria 1725
129 Ga0114129_10095379 3300009147 Bacteria 4120
130 Ga0105248_10619110 3300009177 Bacteria 1221
131 Ga0105237_10050068 3300009545 Bacteria 4198
132 Ga0105238_10338972 3300009551 Bacteria 1491
133 Ga0105249_10030098 3300009553 Bacteria 4905
134 Ga0105249_10110547 3300009553 Bacteria 2597
135 Ga0105239_10027172 3300010375 Bacteria 6300
136 Ga0105239_10119519 3300010375 Bacteria 2925
137 Ga0105239_10185343 3300010375 Bacteria 2329
138 Ga0157374_10008256 3300013296 Bacteria 8893
139 Ga0157374_10136827 3300013296 Bacteria 2375
140 Ga0157378_10008653 3300013297 Bacteria 8859
141 Ga0157378_10027220 3300013297 Bacteria 5046
142 Ga0157378_10037540 3300013297 Bacteria 4292
143 Ga0157378_10088660 3300013297 Bacteria 2808
144 Ga0157378_10151844 3300013297 Bacteria 2159
145 Ga0163162_10006459 3300013306 Bacteria 11357
146 Ga0157372_10085585 3300013307 Bacteria 3576
147 Ga0157372_10590928 3300013307 Bacteria 1294
148 Ga0157375_10016306 3300013308 Bacteria 6669
149 Ga0157375_10026649 3300013308 Bacteria 5392
150 Ga0157375_10260762 3300013308 Bacteria 1895
151 Ga0163163_10034732 3300014325 Bacteria 4886
152 Ga0163163_10345790 3300014325 Bacteria 1543
153 Ga0157377_10012252 3300014745 Bacteria 4305
154 Ga0157379_10011479 3300014968 Bacteria 7731
155 Ga0157376_10431088 3300014969 Bacteria 1281
156 Ga0163161_10014284 3300017792 Bacteria 5529
157 Ga0207673_1002844 3300025290 Bacteria 1998
158 Ga0207673_1004065 3300025290 Bacteria 1735
159 Ga0207697_10000150 3300025315 Bacteria 34215
160 Ga0207697_10000270 3300025315 Bacteria 28614
161 Ga0207697_10000696 3300025315 Bacteria 19118
162 Ga0207697_10003817 3300025315 Bacteria 7352
163 Ga0207697_10005156 3300025315 Bacteria 6102
164 Ga0207697_10100683 3300025315 Bacteria 1231
165 Ga0207653_10011708 3300025885 Bacteria 2736
166 Ga0207692_10099507 3300025898 Bacteria 1593
167 Ga0207688_10000453 3300025901 Bacteria 19458
168 Ga0207680_10019937 3300025903 Bacteria 3597
169 Ga0207680_10040629 3300025903 Bacteria 2708
170 Ga0207647_10000620 3300025904 Bacteria 27662
171 Ga0207685_10027463 3300025905 Bacteria 1992
172 Ga0207685_10029294 3300025905 Bacteria 1948
173 Ga0207699_10047898 3300025906 Bacteria 2508
174 Ga0207699_10073308 3300025906 Bacteria 2099
175 Ga0207645_10002422 3300025907 Bacteria 14692
176 Ga0207645_10015563 3300025907 Bacteria 5051
177 Ga0207705_10045800 3300025909 Bacteria 3143
178 Ga0207705_10077775 3300025909 Bacteria 2414
179 Ga0207705_10387810 3300025909 Bacteria 1079
180 Ga0207684_10065244 3300025910 Bacteria 3091
181 Ga0207684_10067576 3300025910 Bacteria 3038
182 Ga0207684_10294909 3300025910 Bacteria 1398
183 Ga0207707_10054969 3300025912 Bacteria 3464
184 Ga0207707_10171336 3300025912 Bacteria 1897
185 Ga0207695_10050391 3300025913 Bacteria 4381
186 Ga0207693_10004109 3300025915 Bacteria 12366
187 Ga0207693_10016930 3300025915 Bacteria 5821
188 Ga0207693_10016936 3300025915 Bacteria 5820
189 Ga0207693_10118326 3300025915 Bacteria 2080
190 Ga0207660_10036397 3300025917 Bacteria 3421
191 Ga0207662_10000246 3300025918 Bacteria 25081
192 Ga0207657_10043905 3300025919 Bacteria 3934
193 Ga0207646_10079036 3300025922 Bacteria 2941
194 Ga0207646_10129938 3300025922 Bacteria 2266
195 Ga0207646_10241506 3300025922 Bacteria 1632
196 Ga0207681_10019984 3300025923 Bacteria 4242
197 Ga0207694_10256559 3300025924 Bacteria 1432
198 Ga0207650_10064547 3300025925 Bacteria 2741
199 Ga0207650_10143125 3300025925 Bacteria 1881
200 Ga0207659_10008854 3300025926 Bacteria 6271
201 Ga0207659_10024207 3300025926 Bacteria 4065
202 Ga0207659_10034615 3300025926 Bacteria 3485
203 Ga0207687_10372573 3300025927 Bacteria 1168
204 Ga0207700_10024658 3300025928 Bacteria 4166
205 Ga0207700_10028591 3300025928 Bacteria 3922
206 Ga0207700_10087585 3300025928 Bacteria 2449
207 Ga0207664_10011675 3300025929 Bacteria 6258
208 Ga0207644_10033695 3300025931 Bacteria 3582
209 Ga0207644_10036121 3300025931 Bacteria 3467
210 Ga0207644_10102595 3300025931 Bacteria 2151
211 Ga0207644_10249176 3300025931 Bacteria 1417
212 Ga0207690_10005851 3300025932 Bacteria 7277
213 Ga0207706_10004464 3300025933 Bacteria 13140
214 Ga0207706_10265218 3300025933 Bacteria 1499
215 Ga0207706_10379597 3300025933 Bacteria 1227
216 Ga0207709_10069132 3300025935 Bacteria 2234
217 Ga0207670_10000514 3300025936 Bacteria 21331
218 Ga0207670_10006658 3300025936 Bacteria 6427
219 Ga0207670_10019538 3300025936 Bacteria 4140
220 Ga0207669_10070588 3300025937 Bacteria 2190
221 Ga0207704_10122426 3300025938 Bacteria 1783
222 Ga0207704_10232250 3300025938 Bacteria 1372
223 Ga0207665_10009063 3300025939 Bacteria 6532
224 Ga0207665_10025115 3300025939 Bacteria 3930
225 Ga0207691_10000689 3300025940 Bacteria 33393
226 Ga0207691_10007657 3300025940 Bacteria 10394
227 Ga0207661_10022386 3300025944 Bacteria 4759
228 Ga0207661_10060178 3300025944 Bacteria 3063
229 Ga0207679_10044828 3300025945 Bacteria 3194
230 Ga0207651_10034289 3300025960 Bacteria 3285
231 Ga0207651_10067602 3300025960 Bacteria 2515
232 Ga0207651_10111514 3300025960 Bacteria 2054
233 Ga0207712_10007661 3300025961 Bacteria 6829
234 Ga0207668_10026329 3300025972 Bacteria 3775
235 Ga0207668_10108528 3300025972 Bacteria 2077
236 Ga0207668_10148440 3300025972 Bacteria 1812
237 Ga0207658_10040639 3300025986 Bacteria 3363
238 Ga0207677_10026375 3300026023 Bacteria 3643
239 Ga0207708_10063714 3300026075 Bacteria 2816
240 Ga0207708_10443269 3300026075 Bacteria 1080
241 Ga0207702_10000106 3300026078 Bacteria 97204
242 Ga0207702_10094630 3300026078 Bacteria 2623
243 Ga0207641_10044912 3300026088 Bacteria 3717
244 Ga0207641_10660540 3300026088 Bacteria 1027
245 Ga0207648_10119909 3300026089 Bacteria 2313
246 Ga0207676_10031567 3300026095 Bacteria 3985
247 Ga0207674_10002133 3300026116 Bacteria 24993
248 Ga0207674_10053240 3300026116 Bacteria 4126
249 Ga0207674_10180472 3300026116 Bacteria 2063
250 Ga0207675_100450666 3300026118 Bacteria 1275
251 Ga0207683_10390276 3300026121 Bacteria 1280
252 Ga0268266_10030292 3300028379 Bacteria 4598
253 Ga0268266_10047755 3300028379 Bacteria 3668
254 Ga0268266_10121616 3300028379 Bacteria 2324
255 Ga0268264_10007471 3300028381 Bacteria 9118
256 Ga0268264_10078244 3300028381 Bacteria 2819
257 Ga0268264_10156601 3300028381 Bacteria 2048
258 Ga0265326_10003623 3300028558 Bacteria 5047
259 Ga0265338_10000050 3300028800 Bacteria 213659
260 Ga0265338_10000237 3300028800 Bacteria 101850
261 Ga0265338_10000556 3300028800 Bacteria 65347
262 Ga0265338_10004029 3300028800 Bacteria 20160
263 Ga0265324_10000734 3300029957 Bacteria 21854
264 Ga0265340_10021561 3300031247 Bacteria 3304
265 Ga0307513_10007924 3300031456 Bacteria 13672
266 Ga0373945_0099911 3300035116 Bacteria 1134
267 Ga0373943_0072481 3300035170 Bacteria 1747
268 Ga0373943_0119273 3300035170 Bacteria 1400
269 Ga0373943_0221041 3300035170 Bacteria 1055
270 Ga0373935_0046808 3300035692 Bacteria 2733
271 Ga0373947_0056230 3300035725 Bacteria 2378
272 Ga0373947_0074908 3300035725 Bacteria 2084
273 Ga0373937_0207348 3300036401 Bacteria 1843
274 Ga0373925_0219594 3300037068 Bacteria 1517
275 Ga0436363_1654682 3300039450 Bacteria 2018
276 Ga0453683_0306885 3300044673 Bacteria 1016
277 Ga0466971_0066170 3300044719 Bacteria 1637
278 Ga0466967_0051348 3300045976 Bacteria 3613
279 Ga0495592_0135753 3300046454 Bacteria 1716
280 Ga0495592_0169872 3300046454 Bacteria 1494
281 Ga0495603_0152000 3300046455 Bacteria 1344
282 Ga0495651_0023166 3300046462 Bacteria 4829
283 Ga0495580_0213476 3300046472 Bacteria 1327
284 Ga0495639_0103513 3300046475 Bacteria 1346
285 Ga0495608_0113816 3300046511 Bacteria 1738
286 Ga0495608_0241453 3300046511 Bacteria 1129
287 Ga0495628_0000013 3300046516 Bacteria 211823
288 Ga0495628_0148685 3300046516 Bacteria 1785
289 Ga0495630_0005296 3300046517 Bacteria 9103
290 Ga0495630_0037430 3300046517 Bacteria 3628
291 Ga0495665_0187380 3300046531 Bacteria 1074
292 Ga0495640_0116659 3300046533 Bacteria 1739
293 Ga0495587_0080799 3300046536 Bacteria 1884
294 Ga0495645_0213422 3300046543 Bacteria 1302
295 Ga0495667_0046613 3300046559 Bacteria 2866
296 Ga0495658_0184420 3300046683 Bacteria 1295
297 Ga0495613_0169308 3300046689 Bacteria 1551
298 Ga0495624_0009044 3300046690 Bacteria 6916
299 Ga0495624_0109182 3300046690 Bacteria 1702
300 Ga0495680_0058010 3300047322 Bacteria 2993
301 Ga0495675_0141248 3300047444 Bacteria 1492
302 Ga0495684_0000524 3300047471 Bacteria 31157
303 Ga0495684_0003158 3300047471 Bacteria 12915
304 Ga0495684_0042204 3300047471 Bacteria 3494
305 Ga0496100_0019858 3300048903 Bacteria 4018
306 Ga0496101_0028385 3300048904 Bacteria 3905
307 Ga0496102_0010349 3300048905 Bacteria 8023
308 Ga0496102_0012258 3300048905 Bacteria 7413
309 Ga0496102_0019329 3300048905 Bacteria 6001
310 Ga0496103_0013290 3300048906 Bacteria 4880
311 Ga0496104_0080271 3300048907 Bacteria 3110
312 Ga0496104_0184949 3300048907 Bacteria 1994
313 Ga0496105_0044561 3300048908 Bacteria 3659
314 Ga0496106_0036968 3300048909 Bacteria 3652
315 Ga0496106_0040936 3300048909 Bacteria 3471
316 Ga0496106_0464239 3300048909 Bacteria 1017
317 Ga0496107_0001627 3300048910 Bacteria 14003
318 Ga0496107_0041249 3300048910 Bacteria 3314
319 Ga0496107_0271701 3300048910 Bacteria 1262
320 Ga0496108_0008065 3300048911 Bacteria 8544
321 Ga0496108_0207874 3300048911 Bacteria 1699
322 Ga0496108_0546715 3300048911 Bacteria 1010
323 Ga0496109_0021642 3300048912 Bacteria 5689
324 Ga0496110_0065471 3300048913 Bacteria 3213
325 Ga0496110_0152148 3300048913 Bacteria 2095
326 Ga0496110_0362245 3300048913 Bacteria 1321
327 Ga0496111_0167481 3300048914 Bacteria 1632
328 Ga0496112_0032590 3300048915 Bacteria 5060
329 Ga0496112_0070411 3300048915 Bacteria 3457
330 Ga0496112_0127179 3300048915 Bacteria 2519
331 Ga0496112_0308264 3300048915 Bacteria 1528
332 Ga0496113_0036152 3300048916 Bacteria 3617
333 Ga0496113_0323037 3300048916 Unclassified 1237
334 Ga0496114_0000807 3300048917 Bacteria 23477
335 Ga0496114_0207564 3300048917 Bacteria 1717
336 Ga0496115_0001541 3300048918 Bacteria 16534
337 Ga0496115_0067560 3300048918 Bacteria 2891
338 Ga0496115_0071296 3300048918 Bacteria 2818
339 Ga0496115_0206507 3300048918 Bacteria 1623
340 Ga0501083_0140527 3300049744 Bacteria 1581
341 nmdc:mga09592_191578_c1 3300050508 Bacteria 1770
342 nmdc:mga09592_67263_c1 3300050508 Bacteria 3038
343 nmdc:mga06r32_110279_c1 3300050510 Bacteria 2707
344 nmdc:mga0n895_625223_c1 3300050512 Bacteria 1077
345 nmdc:mga08x19_126563_c1 3300050514 Bacteria 1716
346 nmdc:mga0a205_514278_c1 3300050515 Bacteria 1054
347 Ga0500616_0001701 3300053153 Bacteria 20234

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100011499 Ga0070707_1000114994 258
2 3300025910 Ga0207684_10065244 Ga0207684_100652442 258
3 3300025910 Ga0207684_10294909 Ga0207684_102949092 258
4 3300025922 Ga0207646_10079036 Ga0207646_100790363 258
5 3300050508 nmdc:mga09592_67263_c1 nmdc:mga09592_67263_c1_1490_2266 258
6 3300009094 Ga0111539_10899986 Ga0111539_108999862 259
7 3300046472 Ga0495580_0213476 Ga0495580_0213476_466_1275 259
8 3300046475 Ga0495639_0103513 Ga0495639_0103513_181_990 259
9 3300046511 Ga0495608_0113816 Ga0495608_0113816_26_835 259
10 3300046517 Ga0495630_0005296 Ga0495630_0005296_388_1197 259
11 3300046531 Ga0495665_0187380 Ga0495665_0187380_198_1007 259
12 3300046690 Ga0495624_0009044 Ga0495624_0009044_1073_1882 259
13 3300047471 Ga0495684_0000524 Ga0495684_0000524_15531_16340 259
14 3300005290 Ga0065712_10184779 Ga0065712_101847791 260
15 3300005327 Ga0070658_10052530 Ga0070658_100525304 261
16 3300005341 Ga0070691_10024540 Ga0070691_100245402 261
17 3300005435 Ga0070714_100015980 Ga0070714_1000159803 261
18 3300005458 Ga0070681_10128272 Ga0070681_101282722 261
19 3300005471 Ga0070698_100009010 Ga0070698_1000090107 261
20 3300005577 Ga0068857_100097473 Ga0068857_1000974732 261
21 3300006847 Ga0075431_100026070 Ga0075431_1000260702 261
22 3300006880 Ga0075429_100038943 Ga0075429_1000389432 261
23 3300009093 Ga0105240_10111607 Ga0105240_101116073 261
24 3300010375 Ga0105239_10027172 Ga0105239_100271722 261
25 3300025909 Ga0207705_10077775 Ga0207705_100777752 261
26 3300025912 Ga0207707_10171336 Ga0207707_101713362 261
27 3300025913 Ga0207695_10050391 Ga0207695_100503913 261
28 3300025929 Ga0207664_10011675 Ga0207664_100116755 261
29 3300026116 Ga0207674_10002133 Ga0207674_100021333 261
30 3300039450 Ga0436363_1654682 Ga0436363_1654682_1156_1950 261
31 3300048918 Ga0496115_0071296 Ga0496115_0071296_186_980 261
32 3300050508 nmdc:mga09592_191578_c1 nmdc:mga09592_191578_c1_185_973 261
33 3300050510 nmdc:mga06r32_110279_c1 nmdc:mga06r32_110279_c1_1310_2098 261
34 3300050514 nmdc:mga08x19_126563_c1 nmdc:mga08x19_126563_c1_846_1631 261
35 3300005290 Ga0065712_10001257 Ga0065712_100012575 262
36 3300005354 Ga0070675_100004050 Ga0070675_1000040508 262
37 3300005364 Ga0070673_100010948 Ga0070673_1000109482 262
38 3300005437 Ga0070710_10066793 Ga0070710_100667932 262
39 3300005440 Ga0070705_100210103 Ga0070705_1002101032 262
40 3300005536 Ga0070697_100373092 Ga0070697_1003730922 262
41 3300005548 Ga0070665_100031648 Ga0070665_1000316485 262
42 3300006028 Ga0070717_10010649 Ga0070717_100106495 262
43 3300025915 Ga0207693_10016930 Ga0207693_100169306 262
44 3300025915 Ga0207693_10016936 Ga0207693_100169365 262
45 3300025933 Ga0207706_10379597 Ga0207706_103795972 262
46 3300025939 Ga0207665_10025115 Ga0207665_100251153 262
47 3300001990 JGI24737J22298_10043678 JGI24737J22298_100436782 263
48 3300002126 JGI24035J26624_1000458 JGI24035J26624_10004583 263
49 3300005290 Ga0065712_10001389 Ga0065712_100013895 263
50 3300005290 Ga0065712_10026242 Ga0065712_100262422 263
51 3300005293 Ga0065715_10004361 Ga0065715_100043613 263
52 3300005327 Ga0070658_10047526 Ga0070658_100475263 263
53 3300005329 Ga0070683_100047898 Ga0070683_1000478982 263
54 3300005330 Ga0070690_100156376 Ga0070690_1001563762 263
55 3300005335 Ga0070666_10041424 Ga0070666_100414243 263
56 3300005339 Ga0070660_100040877 Ga0070660_1000408774 263
57 3300005340 Ga0070689_100001173 Ga0070689_10000117317 263
58 3300005340 Ga0070689_100033366 Ga0070689_1000333663 263
59 3300005347 Ga0070668_100063794 Ga0070668_1000637943 263
60 3300005354 Ga0070675_100002575 Ga0070675_1000025753 263
61 3300005354 Ga0070675_100042460 Ga0070675_1000424603 263
62 3300005364 Ga0070673_100038191 Ga0070673_1000381913 263
63 3300005365 Ga0070688_100008722 Ga0070688_1000087223 263
64 3300005365 Ga0070688_100034619 Ga0070688_1000346193 263
65 3300005365 Ga0070688_100048049 Ga0070688_1000480492 263
66 3300005366 Ga0070659_100001236 Ga0070659_1000012364 263
67 3300005367 Ga0070667_100282911 Ga0070667_1002829112 263
68 3300005434 Ga0070709_10141885 Ga0070709_101418852 263
69 3300005439 Ga0070711_100100283 Ga0070711_1001002833 263
70 3300005440 Ga0070705_100006791 Ga0070705_1000067912 263
71 3300005441 Ga0070700_100045670 Ga0070700_1000456703 263
72 3300005457 Ga0070662_100281081 Ga0070662_1002810812 263
73 3300005466 Ga0070685_10035454 Ga0070685_100354543 263
74 3300005535 Ga0070684_100000426 Ga0070684_10000042628 263
75 3300005535 Ga0070684_100072181 Ga0070684_1000721812 263
76 3300005543 Ga0070672_100204809 Ga0070672_1002048092 263
77 3300005549 Ga0070704_100009471 Ga0070704_1000094715 263
78 3300005564 Ga0070664_100160327 Ga0070664_1001603273 263
79 3300005615 Ga0070702_100019939 Ga0070702_1000199393 263
80 3300005617 Ga0068859_100021734 Ga0068859_1000217343 263
81 3300005618 Ga0068864_100056831 Ga0068864_1000568312 263
82 3300005719 Ga0068861_100680032 Ga0068861_1006800321 263
83 3300005841 Ga0068863_100025667 Ga0068863_1000256671 263
84 3300005842 Ga0068858_100006052 Ga0068858_10000605215 263
85 3300005843 Ga0068860_100102060 Ga0068860_1001020602 263
86 3300005937 Ga0081455_10112998 Ga0081455_101129983 263
87 3300006163 Ga0070715_10027426 Ga0070715_100274262 263
88 3300006880 Ga0075429_100111505 Ga0075429_1001115052 263
89 3300006931 Ga0097620_100021734 Ga0097620_1000217343 263
90 3300009094 Ga0111539_10137763 Ga0111539_101377632 263
91 3300009147 Ga0114129_10095379 Ga0114129_100953793 263
92 3300009177 Ga0105248_10619110 Ga0105248_106191102 263
93 3300009545 Ga0105237_10050068 Ga0105237_100500682 263
94 3300009553 Ga0105249_10030098 Ga0105249_100300983 263
95 3300010375 Ga0105239_10119519 Ga0105239_101195193 263
96 3300010375 Ga0105239_10185343 Ga0105239_101853431 263
97 3300013297 Ga0157378_10037540 Ga0157378_100375403 263
98 3300013297 Ga0157378_10151844 Ga0157378_101518443 263
99 3300013308 Ga0157375_10016306 Ga0157375_100163063 263
100 3300014325 Ga0163163_10345790 Ga0163163_103457901 263
101 3300014745 Ga0157377_10012252 Ga0157377_100122523 263
102 3300014968 Ga0157379_10011479 Ga0157379_100114796 263
103 3300025290 Ga0207673_1002844 Ga0207673_10028442 263
104 3300025290 Ga0207673_1004065 Ga0207673_10040652 263
105 3300025315 Ga0207697_10003817 Ga0207697_100038174 263
106 3300025315 Ga0207697_10005156 Ga0207697_100051565 263
107 3300025315 Ga0207697_10100683 Ga0207697_101006832 263
108 3300025885 Ga0207653_10011708 Ga0207653_100117083 263
109 3300025903 Ga0207680_10040629 Ga0207680_100406293 263
110 3300025904 Ga0207647_10000620 Ga0207647_1000062027 263
111 3300025905 Ga0207685_10029294 Ga0207685_100292943 263
112 3300025906 Ga0207699_10073308 Ga0207699_100733083 263
113 3300025909 Ga0207705_10045800 Ga0207705_100458002 263
114 3300025909 Ga0207705_10387810 Ga0207705_103878101 263
115 3300025912 Ga0207707_10054969 Ga0207707_100549693 263
116 3300025915 Ga0207693_10118326 Ga0207693_101183262 263
117 3300025917 Ga0207660_10036397 Ga0207660_100363972 263
118 3300025919 Ga0207657_10043905 Ga0207657_100439052 263
119 3300025926 Ga0207659_10008854 Ga0207659_100088543 263
120 3300025928 Ga0207700_10024658 Ga0207700_100246583 263
121 3300025928 Ga0207700_10087585 Ga0207700_100875852 263
122 3300025931 Ga0207644_10036121 Ga0207644_100361213 263
123 3300025932 Ga0207690_10005851 Ga0207690_100058517 263
124 3300025933 Ga0207706_10265218 Ga0207706_102652182 263
125 3300025935 Ga0207709_10069132 Ga0207709_100691322 263
126 3300025936 Ga0207670_10000514 Ga0207670_1000051421 263
127 3300025936 Ga0207670_10006658 Ga0207670_100066581 263
128 3300025936 Ga0207670_10019538 Ga0207670_100195384 263
129 3300025938 Ga0207704_10122426 Ga0207704_101224263 263
130 3300025944 Ga0207661_10022386 Ga0207661_100223862 263
131 3300025944 Ga0207661_10060178 Ga0207661_100601783 263
132 3300025945 Ga0207679_10044828 Ga0207679_100448282 263
133 3300025960 Ga0207651_10111514 Ga0207651_101115142 263
134 3300025961 Ga0207712_10007661 Ga0207712_100076612 263
135 3300025972 Ga0207668_10148440 Ga0207668_101484402 263
136 3300026075 Ga0207708_10063714 Ga0207708_100637143 263
137 3300026075 Ga0207708_10443269 Ga0207708_104432691 263
138 3300026078 Ga0207702_10094630 Ga0207702_100946303 263
139 3300026088 Ga0207641_10044912 Ga0207641_100449123 263
140 3300026088 Ga0207641_10660540 Ga0207641_106605402 263
141 3300028379 Ga0268266_10030292 Ga0268266_100302922 263
142 3300028381 Ga0268264_10007471 Ga0268264_100074713 263
143 3300028800 Ga0265338_10000556 Ga0265338_1000055645 263
144 3300029957 Ga0265324_10000734 Ga0265324_100007341 263
145 3300046454 Ga0495592_0135753 Ga0495592_0135753_214_1098 263
146 3300046455 Ga0495603_0152000 Ga0495603_0152000_514_1320 263
147 3300046511 Ga0495608_0241453 Ga0495608_0241453_261_1067 263
148 3300046516 Ga0495628_0148685 Ga0495628_0148685_216_1100 263
149 3300046533 Ga0495640_0116659 Ga0495640_0116659_395_1201 263
150 3300046543 Ga0495645_0213422 Ga0495645_0213422_396_1280 263
151 3300046683 Ga0495658_0184420 Ga0495658_0184420_183_989 263
152 3300046690 Ga0495624_0109182 Ga0495624_0109182_425_1231 263
153 3300048905 Ga0496102_0010349 Ga0496102_0010349_3709_4509 263
154 3300048905 Ga0496102_0019329 Ga0496102_0019329_628_1428 263
155 3300048907 Ga0496104_0080271 Ga0496104_0080271_433_1233 263
156 3300048908 Ga0496105_0044561 Ga0496105_0044561_2362_3162 263
157 3300048909 Ga0496106_0036968 Ga0496106_0036968_232_1032 263
158 3300048910 Ga0496107_0041249 Ga0496107_0041249_571_1371 263
159 3300048910 Ga0496107_0271701 Ga0496107_0271701_405_1205 263
160 3300048911 Ga0496108_0008065 Ga0496108_0008065_2845_3645 263
161 3300048911 Ga0496108_0546715 Ga0496108_0546715_32_832 263
162 3300048912 Ga0496109_0021642 Ga0496109_0021642_4423_5223 263
163 3300048913 Ga0496110_0152148 Ga0496110_0152148_426_1226 263
164 3300048913 Ga0496110_0362245 Ga0496110_0362245_204_1004 263
165 3300048914 Ga0496111_0167481 Ga0496111_0167481_63_863 263
166 3300048915 Ga0496112_0070411 Ga0496112_0070411_2382_3173 263
167 3300048915 Ga0496112_0127179 Ga0496112_0127179_578_1378 263
168 3300048916 Ga0496113_0036152 Ga0496113_0036152_1510_2310 263
169 3300048916 Ga0496113_0323037 Ga0496113_0323037_72_872 263
170 3300048917 Ga0496114_0000807 Ga0496114_0000807_5611_6411 263
171 3300048918 Ga0496115_0001541 Ga0496115_0001541_13448_14248 263
172 3300048918 Ga0496115_0206507 Ga0496115_0206507_508_1308 263
173 3300049744 Ga0501083_0140527 Ga0501083_0140527_440_1246 263
174 3300000545 CNXas_1000270 CNXas_10002704 264
175 3300003320 rootH2_10081500 rootH2_100815006 264
176 3300005289 Ga0065704_10164461 Ga0065704_101644612 264
177 3300005290 Ga0065712_10118525 Ga0065712_101185252 264
178 3300005328 Ga0070676_10022201 Ga0070676_100222013 264
179 3300005328 Ga0070676_10132976 Ga0070676_101329762 264
180 3300005329 Ga0070683_100200102 Ga0070683_1002001022 264
181 3300005330 Ga0070690_100056419 Ga0070690_1000564192 264
182 3300005331 Ga0070670_100013961 Ga0070670_1000139613 264
183 3300005335 Ga0070666_10402539 Ga0070666_104025391 264
184 3300005338 Ga0068868_100103537 Ga0068868_1001035372 264
185 3300005338 Ga0068868_100148483 Ga0068868_1001484831 264
186 3300005340 Ga0070689_100009773 Ga0070689_1000097732 264
187 3300005340 Ga0070689_100043704 Ga0070689_1000437043 264
188 3300005343 Ga0070687_100015735 Ga0070687_1000157352 264
189 3300005347 Ga0070668_100003335 Ga0070668_1000033353 264
190 3300005347 Ga0070668_100024812 Ga0070668_1000248122 264
191 3300005353 Ga0070669_100006544 Ga0070669_1000065442 264
192 3300005354 Ga0070675_100018222 Ga0070675_1000182223 264
193 3300005355 Ga0070671_100004202 Ga0070671_1000042023 264
194 3300005356 Ga0070674_100010770 Ga0070674_1000107703 264
195 3300005356 Ga0070674_100398965 Ga0070674_1003989651 264
196 3300005364 Ga0070673_100034437 Ga0070673_1000344372 264
197 3300005365 Ga0070688_100001014 Ga0070688_10000101415 264
198 3300005366 Ga0070659_100131269 Ga0070659_1001312692 264
199 3300005367 Ga0070667_100054866 Ga0070667_1000548663 264
200 3300005367 Ga0070667_100094904 Ga0070667_1000949042 264
201 3300005436 Ga0070713_100087586 Ga0070713_1000875862 264
202 3300005437 Ga0070710_10061639 Ga0070710_100616391 264
203 3300005444 Ga0070694_100362617 Ga0070694_1003626171 264
204 3300005445 Ga0070708_100368945 Ga0070708_1003689451 264
205 3300005456 Ga0070678_100036038 Ga0070678_1000360383 264
206 3300005457 Ga0070662_100018238 Ga0070662_1000182384 264
207 3300005459 Ga0068867_100009796 Ga0068867_1000097964 264
208 3300005471 Ga0070698_100207175 Ga0070698_1002071752 264
209 3300005471 Ga0070698_100436827 Ga0070698_1004368272 264
210 3300005543 Ga0070672_100005133 Ga0070672_1000051339 264
211 3300005547 Ga0070693_100147378 Ga0070693_1001473782 264
212 3300005548 Ga0070665_100012850 Ga0070665_1000128507 264
213 3300005577 Ga0068857_100121888 Ga0068857_1001218882 264
214 3300005577 Ga0068857_100135232 Ga0068857_1001352321 264
215 3300005614 Ga0068856_100003900 Ga0068856_1000039006 264
216 3300005615 Ga0070702_100122297 Ga0070702_1001222972 264
217 3300005618 Ga0068864_100551949 Ga0068864_1005519492 264
218 3300005718 Ga0068866_10015248 Ga0068866_100152483 264
219 3300005843 Ga0068860_100107102 Ga0068860_1001071022 264
220 3300005843 Ga0068860_100546006 Ga0068860_1005460062 264
221 3300005844 Ga0068862_100061677 Ga0068862_1000616771 264
222 3300005844 Ga0068862_100205789 Ga0068862_1002057892 264
223 3300005937 Ga0081455_10000805 Ga0081455_1000080513 264
224 3300005937 Ga0081455_10014179 Ga0081455_100141796 264
225 3300005937 Ga0081455_10056238 Ga0081455_100562383 264
226 3300005937 Ga0081455_10169063 Ga0081455_101690632 264
227 3300005985 Ga0081539_10017546 Ga0081539_100175465 264
228 3300005985 Ga0081539_10026445 Ga0081539_100264454 264
229 3300006028 Ga0070717_10005932 Ga0070717_100059323 264
230 3300006028 Ga0070717_10018229 Ga0070717_100182293 264
231 3300006028 Ga0070717_10035678 Ga0070717_100356783 264
232 3300006237 Ga0097621_100011254 Ga0097621_1000112543 264
233 3300006358 Ga0068871_100015382 Ga0068871_1000153825 264
234 3300006871 Ga0075434_100107983 Ga0075434_1001079833 264
235 3300006871 Ga0075434_100901947 Ga0075434_1009019471 264
236 3300006881 Ga0068865_100063104 Ga0068865_1000631043 264
237 3300009098 Ga0105245_10249244 Ga0105245_102492442 264
238 3300009551 Ga0105238_10338972 Ga0105238_103389722 264
239 3300009553 Ga0105249_10110547 Ga0105249_101105473 264
240 3300013296 Ga0157374_10008256 Ga0157374_100082567 264
241 3300013296 Ga0157374_10136827 Ga0157374_101368272 264
242 3300013297 Ga0157378_10008653 Ga0157378_100086532 264
243 3300013297 Ga0157378_10027220 Ga0157378_100272203 264
244 3300013297 Ga0157378_10088660 Ga0157378_100886602 264
245 3300013306 Ga0163162_10006459 Ga0163162_100064599 264
246 3300013307 Ga0157372_10085585 Ga0157372_100855852 264
247 3300013307 Ga0157372_10590928 Ga0157372_105909282 264
248 3300013308 Ga0157375_10026649 Ga0157375_100266493 264
249 3300013308 Ga0157375_10260762 Ga0157375_102607621 264
250 3300014325 Ga0163163_10034732 Ga0163163_100347322 264
251 3300014969 Ga0157376_10431088 Ga0157376_104310882 264
252 3300017792 Ga0163161_10014284 Ga0163161_100142844 264
253 3300025315 Ga0207697_10000150 Ga0207697_1000015015 264
254 3300025315 Ga0207697_10000270 Ga0207697_100002702 264
255 3300025315 Ga0207697_10000696 Ga0207697_100006964 264
256 3300025898 Ga0207692_10099507 Ga0207692_100995072 264
257 3300025901 Ga0207688_10000453 Ga0207688_1000045317 264
258 3300025903 Ga0207680_10019937 Ga0207680_100199373 264
259 3300025905 Ga0207685_10027463 Ga0207685_100274632 264
260 3300025906 Ga0207699_10047898 Ga0207699_100478982 264
261 3300025907 Ga0207645_10002422 Ga0207645_100024223 264
262 3300025907 Ga0207645_10015563 Ga0207645_100155633 264
263 3300025910 Ga0207684_10067576 Ga0207684_100675762 264
264 3300025915 Ga0207693_10004109 Ga0207693_100041097 264
265 3300025918 Ga0207662_10000246 Ga0207662_100002463 264
266 3300025922 Ga0207646_10129938 Ga0207646_101299382 264
267 3300025922 Ga0207646_10241506 Ga0207646_102415062 264
268 3300025923 Ga0207681_10019984 Ga0207681_100199843 264
269 3300025924 Ga0207694_10256559 Ga0207694_102565592 264
270 3300025925 Ga0207650_10064547 Ga0207650_100645472 264
271 3300025925 Ga0207650_10143125 Ga0207650_101431252 264
272 3300025926 Ga0207659_10024207 Ga0207659_100242073 264
273 3300025926 Ga0207659_10034615 Ga0207659_100346151 264
274 3300025927 Ga0207687_10372573 Ga0207687_103725731 264
275 3300025928 Ga0207700_10028591 Ga0207700_100285913 264
276 3300025931 Ga0207644_10033695 Ga0207644_100336951 264
277 3300025931 Ga0207644_10102595 Ga0207644_101025952 264
278 3300025931 Ga0207644_10249176 Ga0207644_102491762 264
279 3300025933 Ga0207706_10004464 Ga0207706_1000446412 264
280 3300025937 Ga0207669_10070588 Ga0207669_100705883 264
281 3300025938 Ga0207704_10232250 Ga0207704_102322502 264
282 3300025939 Ga0207665_10009063 Ga0207665_100090635 264
283 3300025940 Ga0207691_10000689 Ga0207691_1000068929 264
284 3300025940 Ga0207691_10007657 Ga0207691_100076576 264
285 3300025960 Ga0207651_10034289 Ga0207651_100342891 264
286 3300025960 Ga0207651_10067602 Ga0207651_100676022 264
287 3300025972 Ga0207668_10026329 Ga0207668_100263293 264
288 3300025972 Ga0207668_10108528 Ga0207668_101085282 264
289 3300025986 Ga0207658_10040639 Ga0207658_100406393 264
290 3300026023 Ga0207677_10026375 Ga0207677_100263754 264
291 3300026078 Ga0207702_10000106 Ga0207702_1000010637 264
292 3300026089 Ga0207648_10119909 Ga0207648_101199092 264
293 3300026095 Ga0207676_10031567 Ga0207676_100315671 264
294 3300026116 Ga0207674_10053240 Ga0207674_100532403 264
295 3300026116 Ga0207674_10180472 Ga0207674_101804723 264
296 3300026118 Ga0207675_100450666 Ga0207675_1004506662 264
297 3300026121 Ga0207683_10390276 Ga0207683_103902762 264
298 3300028379 Ga0268266_10047755 Ga0268266_100477553 264
299 3300028379 Ga0268266_10121616 Ga0268266_101216163 264
300 3300028381 Ga0268264_10078244 Ga0268264_100782443 264
301 3300028381 Ga0268264_10156601 Ga0268264_101566012 264
302 3300028558 Ga0265326_10003623 Ga0265326_100036232 264
303 3300028800 Ga0265338_10000050 Ga0265338_100000508 264
304 3300028800 Ga0265338_10000237 Ga0265338_1000023780 264
305 3300028800 Ga0265338_10004029 Ga0265338_1000402914 264
306 3300031247 Ga0265340_10021561 Ga0265340_100215613 264
307 3300031456 Ga0307513_10007924 Ga0307513_1000792412 264
308 3300035116 Ga0373945_0099911 Ga0373945_0099911_85_879 264
309 3300035170 Ga0373943_0072481 Ga0373943_0072481_673_1470 264
310 3300035170 Ga0373943_0119273 Ga0373943_0119273_309_1112 264
311 3300035170 Ga0373943_0221041 Ga0373943_0221041_52_849 264
312 3300035692 Ga0373935_0046808 Ga0373935_0046808_969_1763 264
313 3300035725 Ga0373947_0056230 Ga0373947_0056230_538_1335 264
314 3300035725 Ga0373947_0074908 Ga0373947_0074908_479_1276 264
315 3300036401 Ga0373937_0207348 Ga0373937_0207348_100_918 264
316 3300037068 Ga0373925_0219594 Ga0373925_0219594_48_851 264
317 3300044673 Ga0453683_0306885 Ga0453683_0306885_64_885 264
318 3300044719 Ga0466971_0066170 Ga0466971_0066170_806_1615 264
319 3300045976 Ga0466967_0051348 Ga0466967_0051348_722_1531 264
320 3300046454 Ga0495592_0169872 Ga0495592_0169872_406_1224 264
321 3300046462 Ga0495651_0023166 Ga0495651_0023166_1015_1833 264
322 3300046516 Ga0495628_0000013 Ga0495628_0000013_57079_57885 264
323 3300046517 Ga0495630_0037430 Ga0495630_0037430_2705_3523 264
324 3300046536 Ga0495587_0080799 Ga0495587_0080799_793_1611 264
325 3300046559 Ga0495667_0046613 Ga0495667_0046613_816_1634 264
326 3300046689 Ga0495613_0169308 Ga0495613_0169308_557_1366 264
327 3300047322 Ga0495680_0058010 Ga0495680_0058010_1448_2263 264
328 3300047444 Ga0495675_0141248 Ga0495675_0141248_369_1187 264
329 3300047471 Ga0495684_0003158 Ga0495684_0003158_11926_12732 264
330 3300047471 Ga0495684_0042204 Ga0495684_0042204_1615_2433 264
331 3300048903 Ga0496100_0019858 Ga0496100_0019858_1949_2752 264
332 3300048904 Ga0496101_0028385 Ga0496101_0028385_2853_3656 264
333 3300048905 Ga0496102_0012258 Ga0496102_0012258_1792_2595 264
334 3300048906 Ga0496103_0013290 Ga0496103_0013290_1027_1830 264
335 3300048907 Ga0496104_0184949 Ga0496104_0184949_921_1724 264
336 3300048909 Ga0496106_0040936 Ga0496106_0040936_1144_1947 264
337 3300048909 Ga0496106_0464239 Ga0496106_0464239_52_873 264
338 3300048910 Ga0496107_0001627 Ga0496107_0001627_2458_3261 264
339 3300048911 Ga0496108_0207874 Ga0496108_0207874_523_1326 264
340 3300048913 Ga0496110_0065471 Ga0496110_0065471_1308_2111 264
341 3300048915 Ga0496112_0032590 Ga0496112_0032590_1989_2792 264
342 3300048915 Ga0496112_0308264 Ga0496112_0308264_111_911 264
343 3300048917 Ga0496114_0207564 Ga0496114_0207564_695_1498 264
344 3300048918 Ga0496115_0067560 Ga0496115_0067560_1864_2667 264
345 3300050512 nmdc:mga0n895_625223_c1 nmdc:mga0n895_625223_c1_190_1011 264
346 3300050515 nmdc:mga0a205_514278_c1 nmdc:mga0a205_514278_c1_127_948 264
347 3300053153 Ga0500616_0001701 Ga0500616_0001701_18940_19761 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

173

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.9347 11 230
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.9309 11 228
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9306 11 228
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.9299 11 228
8hpr-assembly1.cif.gz_D lpqy-sugabc in state 4 0.9166 11 230
ID Description Score Start End Superfamily
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 8 230 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.941 12 258 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9403 12 252 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9253 12 252 3.40.50.300
af_Q2G1I6_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9219 12 258 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Z9J2N6-F1-model_v4 Nitrate ABC transporter ATP-binding protein 0.9599 11 258 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C6CYV5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9523 15 229 GO:0005524
GO:0016887
AF-A0A7V4SRL2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9523 12 177 GO:0005524
GO:0016887
AF-A0A259DVR4-F1-model_v4 deleted 0.9516 7 261
AF-A0A7W4J802-F1-model_v4 ABC transporter ATP-binding protein 0.9464 10 259 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.96 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map