F417103

General Info

Members Datasets Scaffolds Average Seq Length
347 205 347 201

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10837919|Ga0075433_108379191
Length 227
Sequence VTTRRDDSGSGGPRPSRTVRIGLTGPIGCGKSTVARWLAARGAIVVDADAVARDVTAPGEPATQAVLARFGNAYRAADGGLDRSALAATVFGDERALRDLEAIVHPAVRPRILAALEEADEARAAAIVVEAIKLVEGGLAELCDEVWLVVCPERVQRERLVARGMAPADADRRIAAQAGLAERLRPAATRVFDAGGTTAETERIAAEAFAAALDAAAGSGRDAARRQ

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 9.51
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1020708 3300001977 Bacteria 922
2 JGI24744J21845_10035492 3300002077 Unclassified 943
3 Ga0070690_100017938 3300005330 Bacteria 4265
4 Ga0070670_100220585 3300005331 Bacteria 1649
5 Ga0068869_100048663 3300005334 Bacteria 3067
6 Ga0070680_100000006 3300005336 Bacteria 113367
7 Ga0070682_100050322 3300005337 Bacteria 2601
8 Ga0068868_100547603 3300005338 Bacteria 1019
9 Ga0070660_100108731 3300005339 Bacteria 2204
10 Ga0070689_100073046 3300005340 Bacteria 2681
11 Ga0070687_100004856 3300005343 Bacteria 5389
12 Ga0070687_100091049 3300005343 Bacteria 1687
13 Ga0070661_100035224 3300005344 Bacteria 3634
14 Ga0070692_10016719 3300005345 Bacteria 3495
15 Ga0070692_10192112 3300005345 Bacteria 1190
16 Ga0070668_100322280 3300005347 Bacteria 1301
17 Ga0070675_100167202 3300005354 Bacteria 1895
18 Ga0070671_100300520 3300005355 Bacteria 1367
19 Ga0070674_100042823 3300005356 Bacteria 3077
20 Ga0070673_100044937 3300005364 Bacteria 3422
21 Ga0070673_100365929 3300005364 Unclassified 1283
22 Ga0070688_100084949 3300005365 Bacteria 2057
23 Ga0070688_100188612 3300005365 Bacteria 1435
24 Ga0070659_100039661 3300005366 Bacteria 3677
25 Ga0070659_100688935 3300005366 Bacteria 883
26 Ga0070701_10008129 3300005438 Bacteria 4519
27 Ga0070700_100014283 3300005441 Bacteria 4480
28 Ga0070700_100084428 3300005441 Bacteria 2058
29 Ga0070694_100211025 3300005444 Unclassified 1452
30 Ga0070694_100544986 3300005444 Bacteria 928
31 Ga0070708_100052514 3300005445 Bacteria 3614
32 Ga0070708_100259383 3300005445 Bacteria 1634
33 Ga0070663_100942333 3300005455 Bacteria 748
34 Ga0070678_100144539 3300005456 Bacteria 1907
35 Ga0070678_101105316 3300005456 Bacteria 732
36 Ga0070662_100115702 3300005457 Bacteria 2049
37 Ga0070681_10266166 3300005458 Bacteria 1626
38 Ga0068867_100060396 3300005459 Bacteria 2812
39 Ga0070706_100606875 3300005467 Bacteria 1017
40 Ga0070707_100091215 3300005468 Bacteria 2950
41 Ga0070707_100196088 3300005468 Bacteria 1969
42 Ga0070698_100037090 3300005471 Bacteria 5027
43 Ga0070698_100265298 3300005471 Bacteria 1649
44 Ga0070699_100119646 3300005518 Bacteria 2315
45 Ga0070699_100270368 3300005518 Bacteria 1521
46 Ga0070679_101071044 3300005530 Unclassified 751
47 Ga0070684_100026964 3300005535 Bacteria 4844
48 Ga0070684_101174385 3300005535 Bacteria 722
49 Ga0070697_100002650 3300005536 Bacteria 13760
50 Ga0070697_100539606 3300005536 Bacteria 1022
51 Ga0070686_100005237 3300005544 Bacteria 7163
52 Ga0070686_100241020 3300005544 Bacteria 1317
53 Ga0070695_100009858 3300005545 Bacteria 5692
54 Ga0070695_100014924 3300005545 Bacteria 4686
55 Ga0070696_100001136 3300005546 Bacteria 17252
56 Ga0070696_100012179 3300005546 Bacteria 5764
57 Ga0070696_100257849 3300005546 Bacteria 1321
58 Ga0070696_100432955 3300005546 Bacteria 1035
59 Ga0070693_100039091 3300005547 Bacteria 2656
60 Ga0070704_100021963 3300005549 Bacteria 4146
61 Ga0070704_100061919 3300005549 Bacteria 2680
62 Ga0070704_100165144 3300005549 Bacteria 1755
63 Ga0070704_100260410 3300005549 Bacteria 1428
64 Ga0070664_100046265 3300005564 Bacteria 3675
65 Ga0070664_100619769 3300005564 Bacteria 1004
66 Ga0068857_100189809 3300005577 Bacteria 1871
67 Ga0068854_100882596 3300005578 Bacteria 785
68 Ga0070702_100045542 3300005615 Bacteria 2482
69 Ga0068852_100083530 3300005616 Bacteria 2840
70 Ga0068859_100005907 3300005617 Bacteria 12424
71 Ga0068859_100342544 3300005617 Bacteria 1589
72 Ga0068864_100148314 3300005618 Bacteria 2122
73 Ga0068861_100626144 3300005719 Bacteria 991
74 Ga0068861_100710791 3300005719 Bacteria 935
75 Ga0068870_10007376 3300005840 Bacteria 4898
76 Ga0068863_100203925 3300005841 Bacteria 1903
77 Ga0068858_100978330 3300005842 Bacteria 829
78 Ga0068860_100064688 3300005843 Bacteria 3473
79 Ga0081455_10149432 3300005937 Bacteria 1803
80 Ga0075365_10123585 3300006038 Bacteria 1787
81 Ga0070712_100159439 3300006175 Bacteria 1741
82 Ga0068871_100805848 3300006358 Bacteria 866
83 Ga0075433_10257453 3300006852 Unclassified 1548
84 Ga0075433_10837919 3300006852 Bacteria 803
85 Ga0075434_100451337 3300006871 Bacteria 1307
86 Ga0075434_100743819 3300006871 Unclassified 998
87 Ga0075434_100800159 3300006871 Bacteria 959
88 Ga0068865_100528449 3300006881 Unclassified 987
89 Ga0097620_100005907 3300006931 Bacteria 12424
90 Ga0097620_100342529 3300006931 Bacteria 1589
91 Ga0111539_10147820 3300009094 Bacteria 2751
92 Ga0111539_10560025 3300009094 Bacteria 1331
93 Ga0111539_11002984 3300009094 Bacteria 971
94 Ga0105245_10039111 3300009098 Bacteria 4222
95 Ga0105245_11281662 3300009098 Bacteria 781
96 Ga0114129_10031842 3300009147 Bacteria 7455
97 Ga0114129_10068000 3300009147 Bacteria 4968
98 Ga0114129_10329795 3300009147 Bacteria 2027
99 Ga0114129_11780210 3300009147 Bacteria 750
100 Ga0105243_10009660 3300009148 Bacteria 7343
101 Ga0105243_10464281 3300009148 Unclassified 1191
102 Ga0105243_11120122 3300009148 Bacteria 796
103 Ga0105242_10063666 3300009176 Bacteria 3037
104 Ga0105242_10774721 3300009176 Bacteria 947
105 Ga0105248_10038824 3300009177 Bacteria 5330
106 Ga0105238_10655829 3300009551 Unclassified 1060
107 Ga0105249_10024211 3300009553 Bacteria 5455
108 Ga0105249_10719618 3300009553 Bacteria 1059
109 Ga0157378_10036071 3300013297 Bacteria 4376
110 Ga0157378_10686915 3300013297 Bacteria 1042
111 Ga0163162_10029170 3300013306 Bacteria 5459
112 Ga0163162_10555393 3300013306 Bacteria 1276
113 Ga0157375_10012639 3300013308 Bacteria 7494
114 Ga0157375_10270758 3300013308 Unclassified 1860
115 Ga0157375_10590206 3300013308 Bacteria 1271
116 Ga0163163_10145347 3300014325 Bacteria 2415
117 Ga0157380_10170008 3300014326 Bacteria 1903
118 Ga0157380_10186331 3300014326 Bacteria 1828
119 Ga0157380_10290823 3300014326 Bacteria 1500
120 Ga0157377_10012144 3300014745 Bacteria 4324
121 Ga0157379_10339838 3300014968 Bacteria 1373
122 Ga0157379_10516910 3300014968 Bacteria 1108
123 Ga0157376_10186538 3300014969 Bacteria 1899
124 Ga0207688_10006317 3300025901 Bacteria 6451
125 Ga0207643_10004881 3300025908 Bacteria 7181
126 Ga0207684_10219842 3300025910 Bacteria 1639
127 Ga0207684_10639250 3300025910 Bacteria 907
128 Ga0207707_10053305 3300025912 Bacteria 3521
129 Ga0207660_10000002 3300025917 Bacteria 883566
130 Ga0207662_10007294 3300025918 Bacteria 6011
131 Ga0207657_10010493 3300025919 Bacteria 9240
132 Ga0207649_10175230 3300025920 Unclassified 1497
133 Ga0207646_10065682 3300025922 Bacteria 3240
134 Ga0207694_10462753 3300025924 Unclassified 1060
135 Ga0207650_10151176 3300025925 Bacteria 1832
136 Ga0207650_10507022 3300025925 Bacteria 1009
137 Ga0207659_10080989 3300025926 Bacteria 2399
138 Ga0207687_10016553 3300025927 Bacteria 4844
139 Ga0207690_10021900 3300025932 Bacteria 3970
140 Ga0207690_10320142 3300025932 Bacteria 1219
141 Ga0207706_10004153 3300025933 Bacteria 13651
142 Ga0207706_10069317 3300025933 Bacteria 3102
143 Ga0207706_10449822 3300025933 Bacteria 1114
144 Ga0207709_10065184 3300025935 Bacteria 2290
145 Ga0207709_10522747 3300025935 Bacteria 929
146 Ga0207670_10032213 3300025936 Bacteria 3368
147 Ga0207669_10441915 3300025937 Bacteria 1029
148 Ga0207704_10010713 3300025938 Bacteria 4484
149 Ga0207711_10188621 3300025941 Bacteria 1878
150 Ga0207689_10052518 3300025942 Bacteria 3358
151 Ga0207679_10637964 3300025945 Unclassified 962
152 Ga0207651_10101931 3300025960 Unclassified 2132
153 Ga0207712_10024010 3300025961 Bacteria 4032
154 Ga0207712_10071604 3300025961 Unclassified 2493
155 Ga0207712_10218474 3300025961 Bacteria 1522
156 Ga0207703_10070597 3300026035 Bacteria 2883
157 Ga0207678_10009714 3300026067 Bacteria 8461
158 Ga0207708_10016025 3300026075 Bacteria 5629
159 Ga0207708_10094348 3300026075 Bacteria 2310
160 Ga0207708_10373150 3300026075 Bacteria 1175
161 Ga0207702_11439574 3300026078 Bacteria 683
162 Ga0207641_10398121 3300026088 Bacteria 1322
163 Ga0207648_10018444 3300026089 Bacteria 6318
164 Ga0207674_10017391 3300026116 Bacteria 7846
165 Ga0207675_100072983 3300026118 Bacteria 3210
166 Ga0207675_100120438 3300026118 Bacteria 2483
167 Ga0207675_100420305 3300026118 Bacteria 1320
168 Ga0207683_10014355 3300026121 Bacteria 6748
169 Ga0207698_10163049 3300026142 Bacteria 1952
170 Ga0207428_10149911 3300027907 Bacteria 1775
171 Ga0268264_10098056 3300028381 Bacteria 2541
172 Ga0265326_10011577 3300028558 Bacteria 2597
173 Ga0265334_10069860 3300028573 Bacteria 1310
174 Ga0265323_10031195 3300028653 Bacteria 1982
175 Ga0265322_10030281 3300028654 Bacteria 1546
176 Ga0265330_10026274 3300031235 Bacteria 2634
177 Ga0265332_10075197 3300031238 Bacteria 1436
178 Ga0265329_10018225 3300031242 Bacteria 2403
179 Ga0265316_10012084 3300031344 Bacteria 7757
180 Ga0307408_100085818 3300031548 Bacteria 2365
181 Ga0316575_10061776 3300031665 Bacteria 1498
182 Ga0316578_10191505 3300031728 Bacteria 1232
183 Ga0307405_10074121 3300031731 Bacteria 2200
184 Ga0307409_100012770 3300031995 Bacteria 5368
185 Ga0307409_100040744 3300031995 Bacteria 3462
186 Ga0307416_100011628 3300032002 Bacteria 5884
187 Ga0307411_10090463 3300032005 Bacteria 2135
188 Ga0307415_100004791 3300032126 Bacteria 7092
189 Ga0373959_0042224 3300034820 Unclassified 961
190 Ga0373939_0216585 3300035114 Bacteria 731
191 Ga0373953_0254423 3300035117 Unclassified 764
192 Ga0373942_0034808 3300035207 Unclassified 1349
193 Ga0373962_0180386 3300035242 Bacteria 706
194 Ga0316574_0324970 3300035398 Bacteria 976
195 Ga0316574_0369267 3300035398 Bacteria 906
196 Ga0373933_0603542 3300035724 Bacteria 721
197 Ga0395901_0465474 3300038443 Bacteria 1291
198 Ga0439465_0071866 3300041413 Unclassified 1161
199 Ga0451853_0691589 3300041512 Bacteria 1540
200 Ga0451853_0735891 3300041512 Bacteria 1111
201 Ga0450910_035529 3300042147 Unclassified 794
202 Ga0439446_0185813 3300042156 Bacteria 697
203 Ga0439435_0092700 3300042436 Unclassified 919
204 Ga0495629_0486727 3300046459 Unclassified 833
205 Ga0495641_0160749 3300046461 Bacteria 1005
206 Ga0495651_0022784 3300046462 Bacteria 4869
207 Ga0495657_0323046 3300046675 Bacteria 917
208 Ga0495646_0107246 3300046680 Bacteria 1594
209 Ga0495674_0065565 3300047319 Bacteria 3154
210 Ga0495676_0354684 3300047321 Bacteria 980
211 Ga0495680_0072742 3300047322 Bacteria 2615
212 Ga0495684_0553702 3300047471 Bacteria 783
213 Ga0495593_0253657 3300047673 Bacteria 881
214 Ga0496100_0024040 3300048903 Unclassified 3711
215 Ga0496101_0586941 3300048904 Bacteria 881
216 Ga0496102_0090858 3300048905 Bacteria 2826
217 Ga0496102_0219103 3300048905 Bacteria 1794
218 Ga0496102_0339278 3300048905 Bacteria 1415
219 Ga0496104_0074015 3300048907 Bacteria 3242
220 Ga0496104_0144631 3300048907 Bacteria 2283
221 Ga0496104_0500600 3300048907 Bacteria 1126
222 Ga0496105_0166611 3300048908 Bacteria 1808
223 Ga0496105_0383405 3300048908 Bacteria 1118
224 Ga0496107_0111301 3300048910 Bacteria 2013
225 Ga0496108_0016202 3300048911 Bacteria 6079
226 Ga0496108_0021408 3300048911 Bacteria 5315
227 Ga0496109_0020756 3300048912 Bacteria 5802
228 Ga0496109_0057891 3300048912 Bacteria 3539
229 Ga0496109_0093670 3300048912 Unclassified 2780
230 Ga0496109_0206900 3300048912 Bacteria 1845
231 Ga0496109_0246368 3300048912 Bacteria 1682
232 Ga0496109_0314617 3300048912 Bacteria 1477
233 Ga0496110_0018369 3300048913 Bacteria 5863
234 Ga0496110_0102535 3300048913 Bacteria 2566
235 Ga0496111_0412341 3300048914 Bacteria 998
236 Ga0496112_0056262 3300048915 Bacteria 3871
237 Ga0496112_0128979 3300048915 Bacteria 2500
238 Ga0496112_0596166 3300048915 Bacteria 1037
239 Ga0496112_0609998 3300048915 Bacteria 1023
240 Ga0496112_0715398 3300048915 Bacteria 929
241 Ga0496113_0015816 3300048916 Bacteria 5199
242 Ga0496113_0110043 3300048916 Unclassified 2143
243 Ga0496113_0234443 3300048916 Bacteria 1464
244 Ga0496113_0306094 3300048916 Bacteria 1273
245 Ga0496113_0650498 3300048916 Bacteria 843
246 Ga0496114_0584256 3300048917 Unclassified 986
247 Ga0501031_0091738 3300049568 Bacteria 1982
248 Ga0501036_0107756 3300049572 Bacteria 2355
249 Ga0501036_0159058 3300049572 Bacteria 1905
250 Ga0501036_0533100 3300049572 Unclassified 976
251 Ga0501037_0032984 3300049573 Bacteria 3826
252 Ga0501037_0082234 3300049573 Bacteria 2334
253 Ga0501038_0120416 3300049574 Bacteria 2165
254 Ga0501039_0171861 3300049575 Bacteria 1704
255 Ga0501039_0198422 3300049575 Bacteria 1578
256 Ga0501039_0495900 3300049575 Unclassified 959
257 Ga0501040_0034751 3300049576 Bacteria 3415
258 Ga0501040_0050590 3300049576 Bacteria 2843
259 Ga0501040_0136950 3300049576 Bacteria 1724
260 Ga0501040_0186906 3300049576 Bacteria 1469
261 Ga0501041_0021229 3300049577 Bacteria 3891
262 Ga0501042_0081042 3300049578 Bacteria 2326
263 Ga0501042_0095054 3300049578 Bacteria 2140
264 Ga0501042_0194165 3300049578 Unclassified 1464
265 Ga0501043_0226538 3300049579 Bacteria 1445
266 Ga0501043_0330013 3300049579 Unclassified 1162
267 Ga0501046_0025318 3300049580 Bacteria 4858
268 Ga0501046_0071877 3300049580 Bacteria 2687
269 Ga0501048_0031652 3300049582 Bacteria 3826
270 Ga0501067_0016106 3300049583 Bacteria 4134
271 Ga0501068_0138675 3300049584 Bacteria 1524
272 Ga0501068_0392942 3300049584 Bacteria 894
273 Ga0501068_0417804 3300049584 Unclassified 866
274 Ga0501069_0048787 3300049585 Bacteria 2352
275 Ga0501070_0536131 3300049586 Bacteria 938
276 Ga0501071_0120617 3300049587 Bacteria 1943
277 Ga0501071_0146850 3300049587 Unclassified 1758
278 Ga0501071_0243864 3300049587 Bacteria 1355
279 Ga0501071_0354264 3300049587 Unclassified 1117
280 Ga0501071_0373938 3300049587 Unclassified 1086
281 Ga0501071_0460230 3300049587 Bacteria 974
282 Ga0501072_0040085 3300049588 Bacteria 3677
283 Ga0501072_0164766 3300049588 Bacteria 1768
284 Ga0501072_0203075 3300049588 Bacteria 1580
285 Ga0501073_0316340 3300049589 Bacteria 1077
286 Ga0501073_0437664 3300049589 Unclassified 904
287 Ga0501074_0033780 3300049590 Bacteria 3708
288 Ga0501074_0043244 3300049590 Bacteria 3260
289 Ga0501074_0379435 3300049590 Unclassified 1003
290 Ga0501075_0017421 3300049591 Bacteria 5190
291 Ga0501075_0043357 3300049591 Bacteria 3374
292 Ga0501075_0078305 3300049591 Bacteria 2502
293 Ga0501075_0242360 3300049591 Bacteria 1374
294 Ga0501075_0363445 3300049591 Bacteria 1103
295 Ga0501076_0008346 3300049592 Bacteria 7590
296 Ga0501076_0137317 3300049592 Bacteria 1985
297 Ga0501076_0338308 3300049592 Bacteria 1235
298 Ga0501076_0405914 3300049592 Bacteria 1120
299 Ga0501076_0563765 3300049592 Unclassified 939
300 Ga0501077_0019972 3300049593 Bacteria 4239
301 Ga0501077_0046775 3300049593 Bacteria 2749
302 Ga0501079_0030759 3300049741 Bacteria 4125
303 Ga0501079_0048228 3300049741 Bacteria 3287
304 Ga0501079_0070614 3300049741 Bacteria 2697
305 Ga0501080_0070966 3300049742 Bacteria 3239
306 Ga0501080_0148544 3300049742 Unclassified 2167
307 Ga0501081_0031349 3300049743 Bacteria 3603
308 Ga0501081_0404389 3300049743 Bacteria 1011
309 Ga0501083_0123056 3300049744 Bacteria 1701
310 Ga0501035_0091402 3300049822 Bacteria 2679
311 Ga0501045_0032624 3300049824 Bacteria 3775
312 Ga0501045_0177902 3300049824 Unclassified 1585
313 Ga0501045_0202950 3300049824 Bacteria 1477
314 Ga0501045_0378893 3300049824 Bacteria 1053
315 Ga0501045_0598994 3300049824 Bacteria 816
316 nmdc:mga0yw44_260937_c1 3300050492 Unclassified 1154
317 nmdc:mga05p37_30391_c1 3300050507 Bacteria 2592
318 nmdc:mga05p37_681301_c1 3300050507 Bacteria 1146
319 nmdc:mga05p37_757624_c1 3300050507 Bacteria 1069
320 nmdc:mga05p37_79697_c1 3300050507 Bacteria 4032
321 nmdc:mga08y16_157283_c1 3300050511 Bacteria 2362
322 nmdc:mga08y16_591393_c1 3300050511 Unclassified 1119
323 nmdc:mga08y16_645880_c1 3300050511 Bacteria 1063
324 nmdc:mga08y16_729801_c1 3300050511 Bacteria 988
325 nmdc:mga0n895_281516_c1 3300050512 Bacteria 1686
326 nmdc:mga0n895_638884_c1 3300050512 Bacteria 1064
327 nmdc:mga0n895_96522_c1 3300050512 Bacteria 2961
328 nmdc:mga0rr50_62408_c1 3300050513 Bacteria 2811
329 nmdc:mga08x19_122923_c1 3300050514 Bacteria 1741
330 nmdc:mga0a205_105357_c1 3300050515 Bacteria 2719
331 nmdc:mga0a205_84574_c1 3300050515 Bacteria 3064
332 Ga0495595_0023283 3300053084 Bacteria 2725
333 Ga0495619_0214791 3300053085 Unclassified 1332
334 Ga0495619_0237895 3300053085 Bacteria 1262
335 Ga0501084_0055308 3300054114 Bacteria 3320
336 Ga0501084_0101231 3300054114 Bacteria 2419
337 Ga0501084_0160548 3300054114 Bacteria 1896
338 Ga0501084_0320393 3300054114 Unclassified 1309
339 Ga0501082_0012857 3300060353 Bacteria 7195
340 Ga0501082_0074520 3300060353 Bacteria 2923
341 Ga0501082_0296780 3300060353 Unclassified 1407
342 Ga0530510_0005827 3300061734 Bacteria 8535
343 Ga0530510_0014075 3300061734 Bacteria 5640
344 Ga0530510_0205598 3300061734 Bacteria 1463
345 Ga0530510_0241912 3300061734 Bacteria 1344
346 Ga0530510_0265444 3300061734 Unclassified 1281
347 Ga0530510_0322441 3300061734 Bacteria 1158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0107756 Ga0501036_0107756_799_1308 168
2 3300049573 Ga0501037_0032984 Ga0501037_0032984_2337_2846 168
3 3300049574 Ga0501038_0120416 Ga0501038_0120416_846_1355 168
4 3300049576 Ga0501040_0186906 Ga0501040_0186906_471_980 168
5 3300049578 Ga0501042_0095054 Ga0501042_0095054_1265_1774 168
6 3300049579 Ga0501043_0226538 Ga0501043_0226538_385_894 168
7 3300049582 Ga0501048_0031652 Ga0501048_0031652_2380_2889 168
8 3300049584 Ga0501068_0138675 Ga0501068_0138675_130_639 168
9 3300049585 Ga0501069_0048787 Ga0501069_0048787_575_1084 168
10 3300049586 Ga0501070_0536131 Ga0501070_0536131_385_894 168
11 3300049587 Ga0501071_0120617 Ga0501071_0120617_1161_1670 168
12 3300049588 Ga0501072_0040085 Ga0501072_0040085_493_1002 168
13 3300049589 Ga0501073_0316340 Ga0501073_0316340_74_583 168
14 3300049590 Ga0501074_0043244 Ga0501074_0043244_16_525 168
15 3300049591 Ga0501075_0043357 Ga0501075_0043357_2608_3117 168
16 3300049592 Ga0501076_0405914 Ga0501076_0405914_481_990 168
17 3300049741 Ga0501079_0030759 Ga0501079_0030759_2665_3174 168
18 3300049742 Ga0501080_0070966 Ga0501080_0070966_1329_1838 168
19 3300049744 Ga0501083_0123056 Ga0501083_0123056_882_1391 168
20 3300049822 Ga0501035_0091402 Ga0501035_0091402_1879_2388 168
21 3300054114 Ga0501084_0101231 Ga0501084_0101231_1383_1892 168
22 3300060353 Ga0501082_0074520 Ga0501082_0074520_16_525 168
23 3300061734 Ga0530510_0014075 Ga0530510_0014075_294_803 168
24 3300046459 Ga0495629_0486727 Ga0495629_0486727_289_810 170
25 3300047471 Ga0495684_0553702 Ga0495684_0553702_39_560 170
26 3300005546 Ga0070696_100432955 Ga0070696_1004329552 178
27 3300048915 Ga0496112_0056262 Ga0496112_0056262_720_1430 179
28 3300042156 Ga0439446_0185813 Ga0439446_0185813_115_669 181
29 3300006038 Ga0075365_10123585 Ga0075365_101235852 182
30 3300009094 Ga0111539_11002984 Ga0111539_110029842 182
31 3300009147 Ga0114129_10068000 Ga0114129_100680004 182
32 3300050492 nmdc:mga0yw44_260937_c1 nmdc:mga0yw44_260937_c1_441_1049 182
33 3300050507 nmdc:mga05p37_757624_c1 nmdc:mga05p37_757624_c1_321_929 182
34 3300050511 nmdc:mga08y16_591393_c1 nmdc:mga08y16_591393_c1_492_1100 182
35 3300046462 Ga0495651_0022784 Ga0495651_0022784_3043_3681 184
36 3300047322 Ga0495680_0072742 Ga0495680_0072742_672_1310 184
37 3300048915 Ga0496112_0715398 Ga0496112_0715398_101_751 184
38 3300005445 Ga0070708_100052514 Ga0070708_1000525143 187
39 3300005468 Ga0070707_100196088 Ga0070707_1001960882 187
40 3300041512 Ga0451853_0735891 Ga0451853_0735891_331_954 187
41 3300049743 Ga0501081_0031349 Ga0501081_0031349_1546_2148 187
42 3300054114 Ga0501084_0320393 Ga0501084_0320393_164_727 187
43 3300031995 Ga0307409_100040744 Ga0307409_1000407442 188
44 3300050507 nmdc:mga05p37_681301_c1 nmdc:mga05p37_681301_c1_182_787 188
45 3300032005 Ga0307411_10090463 Ga0307411_100904632 189
46 3300047321 Ga0495676_0354684 Ga0495676_0354684_61_699 189
47 3300046675 Ga0495657_0323046 Ga0495657_0323046_53_691 190
48 3300047319 Ga0495674_0065565 Ga0495674_0065565_2016_2654 190
49 3300053084 Ga0495595_0023283 Ga0495595_0023283_1513_2151 190
50 3300053085 Ga0495619_0214791 Ga0495619_0214791_123_761 190
51 3300005444 Ga0070694_100544986 Ga0070694_1005449862 191
52 3300046680 Ga0495646_0107246 Ga0495646_0107246_750_1388 191
53 3300005336 Ga0070680_100000006 Ga0070680_10000000612 192
54 3300005356 Ga0070674_100042823 Ga0070674_1000428233 192
55 3300006358 Ga0068871_100805848 Ga0068871_1008058482 192
56 3300009098 Ga0105245_10039111 Ga0105245_100391113 192
57 3300025917 Ga0207660_10000002 Ga0207660_1000000211 192
58 3300009147 Ga0114129_10031842 Ga0114129_100318422 193
59 3300050507 nmdc:mga05p37_30391_c1 nmdc:mga05p37_30391_c1_951_1556 193
60 3300005518 Ga0070699_100270368 Ga0070699_1002703681 195
61 3300042436 Ga0439435_0092700 Ga0439435_0092700_265_858 195
62 3300049572 Ga0501036_0159058 Ga0501036_0159058_241_876 195
63 3300049575 Ga0501039_0495900 Ga0501039_0495900_27_668 195
64 3300049576 Ga0501040_0034751 Ga0501040_0034751_156_797 195
65 3300049577 Ga0501041_0021229 Ga0501041_0021229_2207_2848 195
66 3300049580 Ga0501046_0071877 Ga0501046_0071877_213_854 195
67 3300049583 Ga0501067_0016106 Ga0501067_0016106_2184_2786 195
68 3300049584 Ga0501068_0392942 Ga0501068_0392942_270_872 195
69 3300049588 Ga0501072_0164766 Ga0501072_0164766_69_710 195
70 3300049591 Ga0501075_0017421 Ga0501075_0017421_2862_3503 195
71 3300049592 Ga0501076_0008346 Ga0501076_0008346_1186_1827 195
72 3300049593 Ga0501077_0046775 Ga0501077_0046775_1603_2244 195
73 3300049742 Ga0501080_0148544 Ga0501080_0148544_424_1065 195
74 3300054114 Ga0501084_0055308 Ga0501084_0055308_459_1100 195
75 3300060353 Ga0501082_0296780 Ga0501082_0296780_690_1331 195
76 3300005365 Ga0070688_100188612 Ga0070688_1001886122 196
77 3300005456 Ga0070678_101105316 Ga0070678_1011053162 196
78 3300005530 Ga0070679_101071044 Ga0070679_1010710441 196
79 3300005536 Ga0070697_100539606 Ga0070697_1005396061 196
80 3300005546 Ga0070696_100257849 Ga0070696_1002578492 196
81 3300005842 Ga0068858_100978330 Ga0068858_1009783302 196
82 3300009147 Ga0114129_10329795 Ga0114129_103297952 196
83 3300009148 Ga0105243_11120122 Ga0105243_111201222 196
84 3300013308 Ga0157375_10590206 Ga0157375_105902062 196
85 3300026075 Ga0207708_10373150 Ga0207708_103731502 196
86 3300035398 Ga0316574_0324970 Ga0316574_0324970_90_698 196
87 3300041512 Ga0451853_0691589 Ga0451853_0691589_198_803 196
88 3300048904 Ga0496101_0586941 Ga0496101_0586941_86_691 196
89 3300048907 Ga0496104_0144631 Ga0496104_0144631_1362_1967 196
90 3300048907 Ga0496104_0500600 Ga0496104_0500600_56_652 196
91 3300048908 Ga0496105_0166611 Ga0496105_0166611_306_911 196
92 3300048911 Ga0496108_0021408 Ga0496108_0021408_4322_4927 196
93 3300048912 Ga0496109_0057891 Ga0496109_0057891_2280_2885 196
94 3300048912 Ga0496109_0093670 Ga0496109_0093670_2021_2623 196
95 3300048915 Ga0496112_0596166 Ga0496112_0596166_117_722 196
96 3300048916 Ga0496113_0306094 Ga0496113_0306094_478_1074 196
97 3300048916 Ga0496113_0650498 Ga0496113_0650498_177_779 196
98 3300049824 Ga0501045_0598994 Ga0501045_0598994_179_784 196
99 3300050507 nmdc:mga05p37_79697_c1 nmdc:mga05p37_79697_c1_2555_3154 196
100 3300005343 Ga0070687_100091049 Ga0070687_1000910492 197
101 3300005471 Ga0070698_100265298 Ga0070698_1002652982 197
102 3300009147 Ga0114129_11780210 Ga0114129_117802102 197
103 3300014968 Ga0157379_10339838 Ga0157379_103398382 197
104 3300031731 Ga0307405_10074121 Ga0307405_100741212 197
105 3300046461 Ga0495641_0160749 Ga0495641_0160749_178_792 197
106 3300047673 Ga0495593_0253657 Ga0495593_0253657_155_769 197
107 3300048917 Ga0496114_0584256 Ga0496114_0584256_240_875 197
108 3300049587 Ga0501071_0146850 Ga0501071_0146850_321_953 197
109 3300049592 Ga0501076_0563765 Ga0501076_0563765_274_873 197
110 3300049824 Ga0501045_0177902 Ga0501045_0177902_322_954 197
111 3300061734 Ga0530510_0265444 Ga0530510_0265444_184_783 197
112 3300005444 Ga0070694_100211025 Ga0070694_1002110252 198
113 3300005445 Ga0070708_100259383 Ga0070708_1002593832 198
114 3300005458 Ga0070681_10266166 Ga0070681_102661662 198
115 3300005467 Ga0070706_100606875 Ga0070706_1006068751 198
116 3300005468 Ga0070707_100091215 Ga0070707_1000912152 198
117 3300005471 Ga0070698_100037090 Ga0070698_1000370904 198
118 3300005518 Ga0070699_100119646 Ga0070699_1001196462 198
119 3300005536 Ga0070697_100002650 Ga0070697_1000026506 198
120 3300005545 Ga0070695_100009858 Ga0070695_1000098582 198
121 3300005545 Ga0070695_100014924 Ga0070695_1000149242 198
122 3300005546 Ga0070696_100001136 Ga0070696_1000011362 198
123 3300005546 Ga0070696_100012179 Ga0070696_1000121796 198
124 3300005549 Ga0070704_100021963 Ga0070704_1000219633 198
125 3300005549 Ga0070704_100165144 Ga0070704_1001651442 198
126 3300005549 Ga0070704_100260410 Ga0070704_1002604102 198
127 3300005719 Ga0068861_100710791 Ga0068861_1007107912 198
128 3300006871 Ga0075434_100451337 Ga0075434_1004513372 198
129 3300025910 Ga0207684_10219842 Ga0207684_102198421 198
130 3300025910 Ga0207684_10639250 Ga0207684_106392501 198
131 3300025912 Ga0207707_10053305 Ga0207707_100533052 198
132 3300025922 Ga0207646_10065682 Ga0207646_100656822 198
133 3300026078 Ga0207702_11439574 Ga0207702_114395741 198
134 3300031665 Ga0316575_10061776 Ga0316575_100617762 198
135 3300035398 Ga0316574_0369267 Ga0316574_0369267_90_731 198
136 3300038443 Ga0395901_0465474 Ga0395901_0465474_171_785 198
137 3300041413 Ga0439465_0071866 Ga0439465_0071866_381_992 198
138 3300042147 Ga0450910_035529 Ga0450910_035529_89_700 198
139 3300048903 Ga0496100_0024040 Ga0496100_0024040_2826_3437 198
140 3300048905 Ga0496102_0090858 Ga0496102_0090858_502_1113 198
141 3300048905 Ga0496102_0339278 Ga0496102_0339278_571_1182 198
142 3300048907 Ga0496104_0074015 Ga0496104_0074015_1154_1765 198
143 3300048908 Ga0496105_0383405 Ga0496105_0383405_490_1101 198
144 3300048911 Ga0496108_0016202 Ga0496108_0016202_559_1170 198
145 3300048912 Ga0496109_0020756 Ga0496109_0020756_976_1587 198
146 3300048912 Ga0496109_0206900 Ga0496109_0206900_965_1585 198
147 3300048913 Ga0496110_0018369 Ga0496110_0018369_1836_2447 198
148 3300048914 Ga0496111_0412341 Ga0496111_0412341_58_669 198
149 3300050512 nmdc:mga0n895_281516_c1 nmdc:mga0n895_281516_c1_454_1065 198
150 3300050515 nmdc:mga0a205_105357_c1 nmdc:mga0a205_105357_c1_1405_2016 198
151 3300005345 Ga0070692_10192112 Ga0070692_101921122 199
152 3300005364 Ga0070673_100365929 Ga0070673_1003659292 199
153 3300005441 Ga0070700_100084428 Ga0070700_1000844281 199
154 3300005457 Ga0070662_100115702 Ga0070662_1001157022 199
155 3300005535 Ga0070684_101174385 Ga0070684_1011743851 199
156 3300005544 Ga0070686_100241020 Ga0070686_1002410202 199
157 3300005564 Ga0070664_100619769 Ga0070664_1006197692 199
158 3300005617 Ga0068859_100342544 Ga0068859_1003425442 199
159 3300005719 Ga0068861_100626144 Ga0068861_1006261442 199
160 3300006931 Ga0097620_100342529 Ga0097620_1003425292 199
161 3300009094 Ga0111539_10560025 Ga0111539_105600252 199
162 3300009553 Ga0105249_10719618 Ga0105249_107196182 199
163 3300013306 Ga0163162_10555393 Ga0163162_105553932 199
164 3300013308 Ga0157375_10270758 Ga0157375_102707582 199
165 3300014326 Ga0157380_10186331 Ga0157380_101863312 199
166 3300014326 Ga0157380_10290823 Ga0157380_102908232 199
167 3300025933 Ga0207706_10069317 Ga0207706_100693172 199
168 3300025933 Ga0207706_10449822 Ga0207706_104498222 199
169 3300025961 Ga0207712_10071604 Ga0207712_100716042 199
170 3300026075 Ga0207708_10094348 Ga0207708_100943482 199
171 3300026118 Ga0207675_100120438 Ga0207675_1001204382 199
172 3300028558 Ga0265326_10011577 Ga0265326_100115772 199
173 3300028573 Ga0265334_10069860 Ga0265334_100698602 199
174 3300028653 Ga0265323_10031195 Ga0265323_100311952 199
175 3300028654 Ga0265322_10030281 Ga0265322_100302812 199
176 3300031235 Ga0265330_10026274 Ga0265330_100262742 199
177 3300031238 Ga0265332_10075197 Ga0265332_100751972 199
178 3300031242 Ga0265329_10018225 Ga0265329_100182252 199
179 3300031344 Ga0265316_10012084 Ga0265316_100120843 199
180 3300035117 Ga0373953_0254423 Ga0373953_0254423_96_719 199
181 3300035724 Ga0373933_0603542 Ga0373933_0603542_29_643 199
182 3300048915 Ga0496112_0128979 Ga0496112_0128979_1018_1641 199
183 3300048915 Ga0496112_0609998 Ga0496112_0609998_184_807 199
184 3300048916 Ga0496113_0110043 Ga0496113_0110043_1500_2123 199
185 3300049575 Ga0501039_0171861 Ga0501039_0171861_28_654 199
186 3300049578 Ga0501042_0081042 Ga0501042_0081042_760_1386 199
187 3300049588 Ga0501072_0203075 Ga0501072_0203075_240_866 199
188 3300049824 Ga0501045_0378893 Ga0501045_0378893_212_838 199
189 3300050511 nmdc:mga08y16_645880_c1 nmdc:mga08y16_645880_c1_155_772 199
190 3300005338 Ga0068868_100547603 Ga0068868_1005476031 200
191 3300005366 Ga0070659_100688935 Ga0070659_1006889351 200
192 3300005549 Ga0070704_100061919 Ga0070704_1000619192 200
193 3300006175 Ga0070712_100159439 Ga0070712_1001594393 200
194 3300006852 Ga0075433_10837919 Ga0075433_108379191 200
195 3300006871 Ga0075434_100743819 Ga0075434_1007438191 200
196 3300006871 Ga0075434_100800159 Ga0075434_1008001592 200
197 3300009098 Ga0105245_11281662 Ga0105245_112816621 200
198 3300009148 Ga0105243_10464281 Ga0105243_104642812 200
199 3300013297 Ga0157378_10686915 Ga0157378_106869152 200
200 3300025932 Ga0207690_10320142 Ga0207690_103201422 200
201 3300025935 Ga0207709_10522747 Ga0207709_105227472 200
202 3300025961 Ga0207712_10218474 Ga0207712_102184742 200
203 3300031548 Ga0307408_100085818 Ga0307408_1000858182 200
204 3300031728 Ga0316578_10191505 Ga0316578_101915052 200
205 3300031995 Ga0307409_100012770 Ga0307409_1000127704 200
206 3300032002 Ga0307416_100011628 Ga0307416_1000116283 200
207 3300032126 Ga0307415_100004791 Ga0307415_1000047913 200
208 3300048905 Ga0496102_0219103 Ga0496102_0219103_421_1071 200
209 3300048910 Ga0496107_0111301 Ga0496107_0111301_236_895 200
210 3300048912 Ga0496109_0314617 Ga0496109_0314617_89_709 200
211 3300048916 Ga0496113_0234443 Ga0496113_0234443_308_958 200
212 3300049568 Ga0501031_0091738 Ga0501031_0091738_1336_1938 200
213 3300049573 Ga0501037_0082234 Ga0501037_0082234_1220_1822 200
214 3300049576 Ga0501040_0136950 Ga0501040_0136950_719_1321 200
215 3300049578 Ga0501042_0194165 Ga0501042_0194165_583_1185 200
216 3300049579 Ga0501043_0330013 Ga0501043_0330013_336_938 200
217 3300049580 Ga0501046_0025318 Ga0501046_0025318_1371_1973 200
218 3300049587 Ga0501071_0354264 Ga0501071_0354264_332_934 200
219 3300049590 Ga0501074_0033780 Ga0501074_0033780_804_1406 200
220 3300049591 Ga0501075_0078305 Ga0501075_0078305_1035_1637 200
221 3300049591 Ga0501075_0242360 Ga0501075_0242360_378_980 200
222 3300049592 Ga0501076_0137317 Ga0501076_0137317_1175_1777 200
223 3300049592 Ga0501076_0338308 Ga0501076_0338308_403_1005 200
224 3300049593 Ga0501077_0019972 Ga0501077_0019972_2445_3047 200
225 3300049824 Ga0501045_0032624 Ga0501045_0032624_3157_3759 200
226 3300049824 Ga0501045_0202950 Ga0501045_0202950_661_1263 200
227 3300050511 nmdc:mga08y16_729801_c1 nmdc:mga08y16_729801_c1_330_950 200
228 3300050512 nmdc:mga0n895_638884_c1 nmdc:mga0n895_638884_c1_184_795 200
229 3300050512 nmdc:mga0n895_96522_c1 nmdc:mga0n895_96522_c1_618_1292 200
230 3300050513 nmdc:mga0rr50_62408_c1 nmdc:mga0rr50_62408_c1_637_1248 200
231 3300050514 nmdc:mga08x19_122923_c1 nmdc:mga08x19_122923_c1_175_786 200
232 3300053085 Ga0495619_0237895 Ga0495619_0237895_543_1166 200
233 3300060353 Ga0501082_0012857 Ga0501082_0012857_2745_3347 200
234 3300061734 Ga0530510_0205598 Ga0530510_0205598_629_1231 200
235 3300061734 Ga0530510_0241912 Ga0530510_0241912_139_741 200
236 3300061734 Ga0530510_0322441 Ga0530510_0322441_530_1135 200
237 3300001977 JGI24746J21847_1020708 JGI24746J21847_10207081 201
238 3300002077 JGI24744J21845_10035492 JGI24744J21845_100354921 201
239 3300005330 Ga0070690_100017938 Ga0070690_1000179383 201
240 3300005331 Ga0070670_100220585 Ga0070670_1002205852 201
241 3300005334 Ga0068869_100048663 Ga0068869_1000486633 201
242 3300005337 Ga0070682_100050322 Ga0070682_1000503221 201
243 3300005339 Ga0070660_100108731 Ga0070660_1001087312 201
244 3300005340 Ga0070689_100073046 Ga0070689_1000730462 201
245 3300005343 Ga0070687_100004856 Ga0070687_1000048565 201
246 3300005344 Ga0070661_100035224 Ga0070661_1000352242 201
247 3300005345 Ga0070692_10016719 Ga0070692_100167192 201
248 3300005347 Ga0070668_100322280 Ga0070668_1003222801 201
249 3300005354 Ga0070675_100167202 Ga0070675_1001672021 201
250 3300005355 Ga0070671_100300520 Ga0070671_1003005202 201
251 3300005364 Ga0070673_100044937 Ga0070673_1000449372 201
252 3300005365 Ga0070688_100084949 Ga0070688_1000849492 201
253 3300005366 Ga0070659_100039661 Ga0070659_1000396613 201
254 3300005438 Ga0070701_10008129 Ga0070701_100081294 201
255 3300005441 Ga0070700_100014283 Ga0070700_1000142833 201
256 3300005455 Ga0070663_100942333 Ga0070663_1009423332 201
257 3300005456 Ga0070678_100144539 Ga0070678_1001445391 201
258 3300005459 Ga0068867_100060396 Ga0068867_1000603961 201
259 3300005535 Ga0070684_100026964 Ga0070684_1000269642 201
260 3300005544 Ga0070686_100005237 Ga0070686_1000052375 201
261 3300005547 Ga0070693_100039091 Ga0070693_1000390911 201
262 3300005564 Ga0070664_100046265 Ga0070664_1000462653 201
263 3300005577 Ga0068857_100189809 Ga0068857_1001898091 201
264 3300005578 Ga0068854_100882596 Ga0068854_1008825961 201
265 3300005615 Ga0070702_100045542 Ga0070702_1000455421 201
266 3300005616 Ga0068852_100083530 Ga0068852_1000835302 201
267 3300005617 Ga0068859_100005907 Ga0068859_1000059079 201
268 3300005618 Ga0068864_100148314 Ga0068864_1001483142 201
269 3300005840 Ga0068870_10007376 Ga0068870_100073764 201
270 3300005841 Ga0068863_100203925 Ga0068863_1002039252 201
271 3300005843 Ga0068860_100064688 Ga0068860_1000646882 201
272 3300005937 Ga0081455_10149432 Ga0081455_101494322 201
273 3300006852 Ga0075433_10257453 Ga0075433_102574532 201
274 3300006881 Ga0068865_100528449 Ga0068865_1005284492 201
275 3300006931 Ga0097620_100005907 Ga0097620_1000059074 201
276 3300009094 Ga0111539_10147820 Ga0111539_101478203 201
277 3300009148 Ga0105243_10009660 Ga0105243_100096604 201
278 3300009176 Ga0105242_10063666 Ga0105242_100636662 201
279 3300009176 Ga0105242_10774721 Ga0105242_107747212 201
280 3300009177 Ga0105248_10038824 Ga0105248_100388242 201
281 3300009551 Ga0105238_10655829 Ga0105238_106558292 201
282 3300009553 Ga0105249_10024211 Ga0105249_100242114 201
283 3300013297 Ga0157378_10036071 Ga0157378_100360712 201
284 3300013306 Ga0163162_10029170 Ga0163162_100291704 201
285 3300013308 Ga0157375_10012639 Ga0157375_100126392 201
286 3300014325 Ga0163163_10145347 Ga0163163_101453472 201
287 3300014326 Ga0157380_10170008 Ga0157380_101700082 201
288 3300014745 Ga0157377_10012144 Ga0157377_100121443 201
289 3300014968 Ga0157379_10516910 Ga0157379_105169101 201
290 3300014969 Ga0157376_10186538 Ga0157376_101865382 201
291 3300025901 Ga0207688_10006317 Ga0207688_100063175 201
292 3300025908 Ga0207643_10004881 Ga0207643_100048814 201
293 3300025918 Ga0207662_10007294 Ga0207662_100072945 201
294 3300025919 Ga0207657_10010493 Ga0207657_100104935 201
295 3300025920 Ga0207649_10175230 Ga0207649_101752302 201
296 3300025924 Ga0207694_10462753 Ga0207694_104627532 201
297 3300025925 Ga0207650_10151176 Ga0207650_101511762 201
298 3300025925 Ga0207650_10507022 Ga0207650_105070222 201
299 3300025926 Ga0207659_10080989 Ga0207659_100809892 201
300 3300025927 Ga0207687_10016553 Ga0207687_100165531 201
301 3300025932 Ga0207690_10021900 Ga0207690_100219003 201
302 3300025933 Ga0207706_10004153 Ga0207706_100041534 201
303 3300025935 Ga0207709_10065184 Ga0207709_100651842 201
304 3300025936 Ga0207670_10032213 Ga0207670_100322133 201
305 3300025937 Ga0207669_10441915 Ga0207669_104419152 201
306 3300025938 Ga0207704_10010713 Ga0207704_100107132 201
307 3300025941 Ga0207711_10188621 Ga0207711_101886212 201
308 3300025942 Ga0207689_10052518 Ga0207689_100525183 201
309 3300025945 Ga0207679_10637964 Ga0207679_106379642 201
310 3300025960 Ga0207651_10101931 Ga0207651_101019312 201
311 3300025961 Ga0207712_10024010 Ga0207712_100240103 201
312 3300026035 Ga0207703_10070597 Ga0207703_100705972 201
313 3300026067 Ga0207678_10009714 Ga0207678_100097142 201
314 3300026075 Ga0207708_10016025 Ga0207708_100160252 201
315 3300026088 Ga0207641_10398121 Ga0207641_103981213 201
316 3300026089 Ga0207648_10018444 Ga0207648_100184444 201
317 3300026116 Ga0207674_10017391 Ga0207674_100173914 201
318 3300026118 Ga0207675_100072983 Ga0207675_1000729832 201
319 3300026118 Ga0207675_100420305 Ga0207675_1004203052 201
320 3300026121 Ga0207683_10014355 Ga0207683_100143554 201
321 3300026142 Ga0207698_10163049 Ga0207698_101630492 201
322 3300027907 Ga0207428_10149911 Ga0207428_101499111 201
323 3300028381 Ga0268264_10098056 Ga0268264_100980562 201
324 3300034820 Ga0373959_0042224 Ga0373959_0042224_226_831 201
325 3300035114 Ga0373939_0216585 Ga0373939_0216585_46_651 201
326 3300035207 Ga0373942_0034808 Ga0373942_0034808_220_825 201
327 3300035242 Ga0373962_0180386 Ga0373962_0180386_41_646 201
328 3300048912 Ga0496109_0246368 Ga0496109_0246368_25_630 201
329 3300048913 Ga0496110_0102535 Ga0496110_0102535_1241_1846 201
330 3300048916 Ga0496113_0015816 Ga0496113_0015816_1035_1640 201
331 3300049572 Ga0501036_0533100 Ga0501036_0533100_262_867 201
332 3300049575 Ga0501039_0198422 Ga0501039_0198422_813_1436 201
333 3300049576 Ga0501040_0050590 Ga0501040_0050590_10_645 201
334 3300049584 Ga0501068_0417804 Ga0501068_0417804_240_845 201
335 3300049587 Ga0501071_0243864 Ga0501071_0243864_56_691 201
336 3300049587 Ga0501071_0373938 Ga0501071_0373938_87_731 201
337 3300049587 Ga0501071_0460230 Ga0501071_0460230_139_780 201
338 3300049589 Ga0501073_0437664 Ga0501073_0437664_121_765 201
339 3300049590 Ga0501074_0379435 Ga0501074_0379435_314_919 201
340 3300049591 Ga0501075_0363445 Ga0501075_0363445_30_671 201
341 3300049741 Ga0501079_0048228 Ga0501079_0048228_174_809 201
342 3300049741 Ga0501079_0070614 Ga0501079_0070614_924_1529 201
343 3300049743 Ga0501081_0404389 Ga0501081_0404389_119_745 201
344 3300050511 nmdc:mga08y16_157283_c1 nmdc:mga08y16_157283_c1_882_1487 201
345 3300050515 nmdc:mga0a205_84574_c1 nmdc:mga0a205_84574_c1_816_1421 201
346 3300054114 Ga0501084_0160548 Ga0501084_0160548_843_1448 201
347 3300061734 Ga0530510_0005827 Ga0530510_0005827_4060_4665 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

19

200

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f6r-assembly1.cif.gz_A crystal structure of bifunctional coenzyme a synthase (coa synthase): (18044849) from mus musculus at 1.70 a resolution 0.8892 2 195
4ttr-assembly1.cif.gz_A crystal structure of legionella pneumophila dephospho-coa kinase in complex with bu2 0.8764 1 198
2grj-assembly2.cif.gz_B crystal structure of dephospho-coa kinase (ec 2.7.1.24) (dephosphocoenzyme a kinase) (tm1387) from thermotoga maritima at 2.60 a resolution 0.8721 2 195
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8718 2 198
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8636 2 198
ID Description Score Start End Superfamily
af_Q13057_357_562_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.905 1 194 3.40.50.300
af_Q9VRP4_309_517_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9022 3 196 3.40.50.300
af_Q54N39_1_207_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8953 2 197 3.40.50.300
af_Q2FXP1_1_198_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8939 1 196 3.40.50.300
af_Q8WVC6_1_203_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8914 2 197 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A521S5P4-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9889 2 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A535PAD3-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9867 2 144 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A536NJ73-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9798 2 197 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A521S5P4-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9694 2 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1F8SEG8-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9693 3 200 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
94.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map