F417053

General Info

Members Datasets Scaffolds Average Seq Length
347 163 694 245

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100011842|Ga0070694_1000118422
Length 264
Sequence MVLIPLRNFPLQTEFVVANPMVRRMMFSDLMISGKVVMRTLRTLTPALMLAVALVLLASTYAYAITPGQKTKGRTPRAHTAALTGAEIKQADARLAELGYGKGRTALIAFQKYEGRDATGKLSRAELDAINNASAPVAKDAGYKHVEIDLDRQVLLLTDSDGVVSKVLPVSTGSNKNYNEKGMSGLAYTPRGRFRIYAKISGWRKSPLGLLYYPSYFSDGLAIHGNSSVPNSMSRQMPVGTIVLIYDSQAFVSAKAWAEADKQK

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
154 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
159 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.15
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 29.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100011842 3300005444 Bacteria 5409
2 SwRhRL2b_contig_1708624 2162886007 Bacteria 1034
3 JGI24034J14986_100038 3300001432 Unclassified 4789
4 JGI24748J21848_1000028 3300002074 Bacteria 91962
5 JGI24034J26672_10000051 3300002239 Bacteria 49831
6 rootL2_10312598 3300003322 Bacteria 2808
7 Ga0065704_10000988 3300005289 Bacteria 17860
8 Ga0065704_10105918 3300005289 Unclassified 2080
9 Ga0065704_10150639 3300005289 Bacteria 1432
10 Ga0065712_10033959 3300005290 Unclassified 1231
11 Ga0065715_10089655 3300005293 Bacteria 9060
12 Ga0065715_10096178 3300005293 Unclassified 3928
13 Ga0065715_10116383 3300005293 Bacteria 2383
14 Ga0065715_10178827 3300005293 Bacteria 1491
15 Ga0065715_10204654 3300005293 Bacteria 1343
16 Ga0065707_10002179 3300005295 Bacteria 6180
17 Ga0065707_10109899 3300005295 Unclassified 2446
18 Ga0065707_10116245 3300005295 Bacteria 2243
19 Ga0065707_10129156 3300005295 Bacteria 1926
20 Ga0065707_10248706 3300005295 Bacteria 1132
21 Ga0065707_10286738 3300005295 Unclassified 1034
22 Ga0070690_100006762 3300005330 Bacteria 6516
23 Ga0070690_100071400 3300005330 Unclassified 2256
24 Ga0070670_100046310 3300005331 Bacteria 3740
25 Ga0070670_100046677 3300005331 Bacteria 3725
26 Ga0068869_100007407 3300005334 Bacteria 7010
27 Ga0068869_100480622 3300005334 Unclassified 1034
28 Ga0068869_100575574 3300005334 Unclassified 949
29 Ga0070666_10038472 3300005335 Bacteria 3184
30 Ga0070680_100300532 3300005336 Unclassified 1361
31 Ga0070682_100002874 3300005337 Bacteria 9547
32 Ga0070689_100070608 3300005340 Bacteria 2727
33 Ga0070689_100338854 3300005340 Bacteria 1259
34 Ga0070691_10135550 3300005341 Bacteria 1251
35 Ga0070687_100010336 3300005343 Bacteria 4033
36 Ga0070687_100108784 3300005343 Bacteria 1565
37 Ga0070687_100346154 3300005343 Unclassified 958
38 Ga0070669_100001313 3300005353 Bacteria 17950
39 Ga0070669_100042803 3300005353 Bacteria 3297
40 Ga0070669_100377522 3300005353 Bacteria 1156
41 Ga0070675_100022504 3300005354 Bacteria 5037
42 Ga0070671_100448733 3300005355 Unclassified 1106
43 Ga0070674_100372652 3300005356 Unclassified 1159
44 Ga0070674_100384211 3300005356 Bacteria 1143
45 Ga0070673_100093002 3300005364 Unclassified 2468
46 Ga0070659_100322192 3300005366 Unclassified 1292
47 Ga0070659_100457966 3300005366 Unclassified 1083
48 Ga0070667_100034262 3300005367 Bacteria 4248
49 Ga0070703_10000098 3300005406 Bacteria 44872
50 Ga0070701_10112293 3300005438 Unclassified 1524
51 Ga0070705_100036362 3300005440 Unclassified 2768
52 Ga0070705_100095712 3300005440 Bacteria 1862
53 Ga0070705_100454605 3300005440 Unclassified 962
54 Ga0070700_100028924 3300005441 Unclassified 3301
55 Ga0070700_100046296 3300005441 Bacteria 2687
56 Ga0070700_100220052 3300005441 Bacteria 1345
57 Ga0070700_100326173 3300005441 Bacteria 1130
58 Ga0070694_100007149 3300005444 Bacteria 6797
59 Ga0070694_100032077 3300005444 Bacteria 3448
60 Ga0070694_100090428 3300005444 Bacteria 2147
61 Ga0070694_100205334 3300005444 Bacteria 1470
62 Ga0070694_100442927 3300005444 Bacteria 1024
63 Ga0070708_100164738 3300005445 Bacteria 2067
64 Ga0070678_100184126 3300005456 Bacteria 1712
65 Ga0070662_100015255 3300005457 Bacteria 5143
66 Ga0070662_100105100 3300005457 Bacteria 2143
67 Ga0070662_100323540 3300005457 Unclassified 1258
68 Ga0068867_100008443 3300005459 Bacteria 7265
69 Ga0068867_100367889 3300005459 Unclassified 1204
70 Ga0068867_100412326 3300005459 Unclassified 1142
71 Ga0070706_100002105 3300005467 Bacteria 20268
72 Ga0070706_100066564 3300005467 Bacteria 3332
73 Ga0070706_100372970 3300005467 Bacteria 1329
74 Ga0070707_100000128 3300005468 Bacteria 71110
75 Ga0070707_100078365 3300005468 Plasmid 3187
76 Ga0070707_100319088 3300005468 Bacteria 1510
77 Ga0070698_100000847 3300005471 Bacteria 33519
78 Ga0070698_100001943 3300005471 Bacteria 22951
79 Ga0070698_100053202 3300005471 Bacteria 4115
80 Ga0070698_100070345 3300005471 Bacteria 3511
81 Ga0070698_100074697 3300005471 Unclassified 3395
82 Ga0070698_100098030 3300005471 Bacteria 2906
83 Ga0070699_100011705 3300005518 Bacteria 7575
84 Ga0070699_100020928 3300005518 Bacteria 5640
85 Ga0070699_100119775 3300005518 Bacteria 2314
86 Ga0070684_100320177 3300005535 Unclassified 1425
87 Ga0070697_100000332 3300005536 Bacteria 37171
88 Ga0070697_100186636 3300005536 Bacteria 1759
89 Ga0070697_100223136 3300005536 Bacteria 1606
90 Ga0068853_100002377 3300005539 Bacteria 14066
91 Ga0068853_100428055 3300005539 Bacteria 1242
92 Ga0070672_100130470 3300005543 Bacteria 2065
93 Ga0070672_100347313 3300005543 Bacteria 1264
94 Ga0070686_100024264 3300005544 Bacteria 3633
95 Ga0070686_100033607 3300005544 Bacteria 3153
96 Ga0070686_100043118 3300005544 Bacteria 2829
97 Ga0070695_100006844 3300005545 Bacteria 6751
98 Ga0070695_100024440 3300005545 Bacteria 3722
99 Ga0070695_100032821 3300005545 Bacteria 3246
100 Ga0070695_100113611 3300005545 Bacteria 1842
101 Ga0070695_100298809 3300005545 Bacteria 1189
102 Ga0070696_100021797 3300005546 Bacteria 4345
103 Ga0070696_100289631 3300005546 Unclassified 1251
104 Ga0070696_100577744 3300005546 Unclassified 904
105 Ga0070693_100241949 3300005547 Unclassified 1192
106 Ga0070665_100069874 3300005548 Unclassified 3519
107 Ga0070704_100021202 3300005549 Unclassified 4208
108 Ga0070704_100030692 3300005549 Bacteria 3604
109 Ga0070704_100050255 3300005549 Bacteria 2929
110 Ga0068857_100863900 3300005577 Unclassified 866
111 Ga0068854_100127742 3300005578 Bacteria 1938
112 Ga0068854_100403302 3300005578 Unclassified 1132
113 Ga0070702_100031855 3300005615 Bacteria 2888
114 Ga0070702_100035508 3300005615 Unclassified 2755
115 Ga0070702_100095005 3300005615 Unclassified 1816
116 Ga0068852_100706981 3300005616 Bacteria 1018
117 Ga0068859_100014153 3300005617 Bacteria 8000
118 Ga0068859_100036827 3300005617 Bacteria 4912
119 Ga0068859_100075704 3300005617 Unclassified 3406
120 Ga0068859_100550267 3300005617 Unclassified 1248
121 Ga0068859_100598921 3300005617 Bacteria 1195
122 Ga0068859_100613399 3300005617 Bacteria 1181
123 Ga0068864_100006149 3300005618 Bacteria 9846
124 Ga0068864_100050142 3300005618 Unclassified 3592
125 Ga0068864_100110261 3300005618 Unclassified 2451
126 Ga0068866_10028652 3300005718 Bacteria 2656
127 Ga0068861_100042403 3300005719 Unclassified 3410
128 Ga0068861_100090325 3300005719 Bacteria 2416
129 Ga0068861_100205265 3300005719 Unclassified 1657
130 Ga0068861_100756164 3300005719 Unclassified 908
131 Ga0068870_10086799 3300005840 Bacteria 1741
132 Ga0068870_10118411 3300005840 Unclassified 1522
133 Ga0068870_10203935 3300005840 Bacteria 1200
134 Ga0068863_100276022 3300005841 Bacteria 1627
135 Ga0068863_100452252 3300005841 Unclassified 1260
136 Ga0068858_100000567 3300005842 Bacteria 38567
137 Ga0068858_100027142 3300005842 Bacteria 5319
138 Ga0068858_100181618 3300005842 Unclassified 1987
139 Ga0068858_100212179 3300005842 Bacteria 1832
140 Ga0068860_100015670 3300005843 Bacteria 7401
141 Ga0068860_100027368 3300005843 Bacteria 5493
142 Ga0068860_100108733 3300005843 Unclassified 2650
143 Ga0068862_100027800 3300005844 Bacteria 4763
144 Ga0081539_10079430 3300005985 Bacteria 1729
145 Ga0070715_10000102 3300006163 Bacteria 21108
146 Ga0070716_100000021 3300006173 Bacteria 79460
147 Ga0070716_100160359 3300006173 Bacteria 1457
148 Ga0097621_100041866 3300006237 Bacteria 3689
149 Ga0097621_100099084 3300006237 Bacteria 2449
150 Ga0097621_100187854 3300006237 Unclassified 1788
151 Ga0068871_100006662 3300006358 Bacteria 8191
152 Ga0068871_100019741 3300006358 Bacteria 5150
153 Ga0068871_100058583 3300006358 Unclassified 3136
154 Ga0068871_100219207 3300006358 Bacteria 1648
155 Ga0075428_100095630 3300006844 Bacteria 3238
156 Ga0075428_100351972 3300006844 Unclassified 1581
157 Ga0075428_100677669 3300006844 Bacteria 1099
158 Ga0075430_100036485 3300006846 Unclassified 4168
159 Ga0075431_100026198 3300006847 Bacteria 5980
160 Ga0075433_10156864 3300006852 Bacteria 2025
161 Ga0075434_100328407 3300006871 Bacteria 1550
162 Ga0075429_100392079 3300006880 Unclassified 1216
163 Ga0097620_100014153 3300006931 Bacteria 8000
164 Ga0097620_100036827 3300006931 Bacteria 4912
165 Ga0097620_100075713 3300006931 Unclassified 3406
166 Ga0097620_100550273 3300006931 Unclassified 1248
167 Ga0097620_100598905 3300006931 Bacteria 1195
168 Ga0097620_100613438 3300006931 Bacteria 1181
169 Ga0111539_10030532 3300009094 Bacteria 6549
170 Ga0111539_10077418 3300009094 Bacteria 3914
171 Ga0111539_10079397 3300009094 Bacteria 3860
172 Ga0111539_10579916 3300009094 Unclassified 1306
173 Ga0105247_10000252 3300009101 Bacteria 49875
174 Ga0105247_10297798 3300009101 Unclassified 1118
175 Ga0114129_10010985 3300009147 Bacteria 12901
176 Ga0114129_10595054 3300009147 Bacteria 1434
177 Ga0114129_11007666 3300009147 Unclassified 1048
178 Ga0105243_10000169 3300009148 Bacteria 74793
179 Ga0105243_10024786 3300009148 Bacteria 4579
180 Ga0105243_10082592 3300009148 Bacteria 2626
181 Ga0105243_10304946 3300009148 Bacteria 1445
182 Ga0105243_10867584 3300009148 Unclassified 895
183 Ga0105242_10000175 3300009176 Bacteria 48582
184 Ga0105242_10000517 3300009176 Bacteria 30283
185 Ga0105242_10194795 3300009176 Unclassified 1796
186 Ga0105242_10234198 3300009176 Unclassified 1647
187 Ga0105242_10868418 3300009176 Bacteria 899
188 Ga0105248_10012939 3300009177 Bacteria 9198
189 Ga0105248_10025914 3300009177 Bacteria 6522
190 Ga0105248_10215590 3300009177 Bacteria 2162
191 Ga0105237_10574244 3300009545 Unclassified 1134
192 Ga0105238_10038359 3300009551 Bacteria 4865
193 Ga0105249_10041504 3300009553 Bacteria 4183
194 Ga0105249_10158824 3300009553 Bacteria 2183
195 Ga0105249_10222199 3300009553 Bacteria 1859
196 Ga0105239_10102339 3300010375 Unclassified 3170
197 Ga0105246_10152000 3300011119 Bacteria 1753
198 Ga0157374_10030780 3300013296 Bacteria 4875
199 Ga0157378_10004237 3300013297 Bacteria 12651
200 Ga0157378_10011421 3300013297 Bacteria 7775
201 Ga0157378_10328918 3300013297 Bacteria 1487
202 Ga0157378_10571443 3300013297 Bacteria 1139
203 Ga0157378_11258901 3300013297 Unclassified 780
204 Ga0163162_10001013 3300013306 Bacteria 26117
205 Ga0163162_10023513 3300013306 Bacteria 6082
206 Ga0163162_10064189 3300013306 Bacteria 3717
207 Ga0163162_10125850 3300013306 Bacteria 2669
208 Ga0163162_10181161 3300013306 Unclassified 2233
209 Ga0157375_10004041 3300013308 Bacteria 12730
210 Ga0157375_10005744 3300013308 Bacteria 10792
211 Ga0157375_10022626 3300013308 Bacteria 5787
212 Ga0157375_10054026 3300013308 Unclassified 3955
213 Ga0163163_10060106 3300014325 Bacteria 3762
214 Ga0163163_10108679 3300014325 Bacteria 2801
215 Ga0163163_10126988 3300014325 Bacteria 2588
216 Ga0157379_10088540 3300014968 Bacteria 2777
217 Ga0157376_10013954 3300014969 Bacteria 6010
218 Ga0163161_10015852 3300017792 Bacteria 5257
219 Ga0163161_10033728 3300017792 Bacteria 3658
220 Ga0163161_10050770 3300017792 Unclassified 3003
221 Ga0163161_10633126 3300017792 Bacteria 885
222 Ga0163161_10635050 3300017792 Unclassified 883
223 Ga0207672_1000070 3300025223 Bacteria 13639
224 Ga0207697_10040906 3300025315 Bacteria 1903
225 Ga0207653_10000177 3300025885 Bacteria 44860
226 Ga0207710_10000001 3300025900 Bacteria 1797433
227 Ga0207680_10341719 3300025903 Unclassified 1050
228 Ga0207647_10009673 3300025904 Bacteria 6844
229 Ga0207685_10000016 3300025905 Bacteria 151990
230 Ga0207643_10005063 3300025908 Bacteria 7057
231 Ga0207643_10071571 3300025908 Bacteria 1996
232 Ga0207684_10003671 3300025910 Bacteria 14896
233 Ga0207684_10014348 3300025910 Bacteria 6834
234 Ga0207654_10290420 3300025911 Unclassified 1109
235 Ga0207707_10219674 3300025912 Bacteria 1654
236 Ga0207660_10406548 3300025917 Unclassified 1097
237 Ga0207662_10001395 3300025918 Bacteria 11673
238 Ga0207662_10142339 3300025918 Unclassified 1520
239 Ga0207662_10210488 3300025918 Bacteria 1262
240 Ga0207662_10237504 3300025918 Bacteria 1192
241 Ga0207646_10001202 3300025922 Bacteria 32571
242 Ga0207646_10005487 3300025922 Bacteria 13333
243 Ga0207646_10190501 3300025922 Bacteria 1852
244 Ga0207646_10234613 3300025922 Bacteria 1658
245 Ga0207681_10013702 3300025923 Bacteria 5020
246 Ga0207681_10056042 3300025923 Bacteria 2687
247 Ga0207681_10079777 3300025923 Bacteria 2307
248 Ga0207681_10169596 3300025923 Unclassified 1653
249 Ga0207694_10022182 3300025924 Bacteria 4814
250 Ga0207650_10000780 3300025925 Bacteria 24540
251 Ga0207650_10317041 3300025925 Bacteria 1276
252 Ga0207650_10449520 3300025925 Unclassified 1072
253 Ga0207659_10201184 3300025926 Bacteria 1591
254 Ga0207687_10130159 3300025927 Bacteria 1895
255 Ga0207644_10003313 3300025931 Bacteria 10405
256 Ga0207644_10007348 3300025931 Bacteria 7175
257 Ga0207690_10017846 3300025932 Bacteria 4343
258 Ga0207706_10053111 3300025933 Bacteria 3577
259 Ga0207706_10085695 3300025933 Bacteria 2770
260 Ga0207706_10354535 3300025933 Unclassified 1275
261 Ga0207686_10000082 3300025934 Bacteria 79873
262 Ga0207686_10000144 3300025934 Bacteria 55991
263 Ga0207709_10000219 3300025935 Bacteria 72376
264 Ga0207709_10725178 3300025935 Bacteria 797
265 Ga0207670_10176639 3300025936 Bacteria 1605
266 Ga0207704_10041736 3300025938 Bacteria 2693
267 Ga0207704_10267845 3300025938 Bacteria 1292
268 Ga0207665_10000035 3300025939 Bacteria 87960
269 Ga0207665_10036386 3300025939 Bacteria 3274
270 Ga0207665_10344214 3300025939 Bacteria 1124
271 Ga0207691_10007611 3300025940 Bacteria 10425
272 Ga0207691_10274723 3300025940 Bacteria 1451
273 Ga0207711_10426862 3300025941 Unclassified 1233
274 Ga0207689_10006966 3300025942 Bacteria 9941
275 Ga0207689_10309086 3300025942 Unclassified 1311
276 Ga0207689_10537399 3300025942 Unclassified 981
277 Ga0207651_10035749 3300025960 Bacteria 3235
278 Ga0207651_10095540 3300025960 Bacteria 2189
279 Ga0207712_10120908 3300025961 Bacteria 1981
280 Ga0207712_10234963 3300025961 Bacteria 1474
281 Ga0207712_10275308 3300025961 Bacteria 1371
282 Ga0207640_10056887 3300025981 Bacteria 2570
283 Ga0207640_10096847 3300025981 Unclassified 2058
284 Ga0207658_10129949 3300025986 Bacteria 2022
285 Ga0207658_10177579 3300025986 Unclassified 1760
286 Ga0207703_10001462 3300026035 Bacteria 21560
287 Ga0207703_10017606 3300026035 Bacteria 5578
288 Ga0207703_10102826 3300026035 Unclassified 2425
289 Ga0207703_10172813 3300026035 Bacteria 1902
290 Ga0207703_10325906 3300026035 Bacteria 1408
291 Ga0207639_10682278 3300026041 Unclassified 952
292 Ga0207708_10032748 3300026075 Bacteria 3946
293 Ga0207708_10045124 3300026075 Unclassified 3359
294 Ga0207708_10070532 3300026075 Bacteria 2675
295 Ga0207708_10225360 3300026075 Unclassified 1503
296 Ga0207708_10370092 3300026075 Bacteria 1180
297 Ga0207641_10497160 3300026088 Bacteria 1184
298 Ga0207641_10792605 3300026088 Unclassified 937
299 Ga0207648_10012573 3300026089 Bacteria 7920
300 Ga0207648_10041187 3300026089 Unclassified 4057
301 Ga0207648_10958687 3300026089 Unclassified 800
302 Ga0207676_10100075 3300026095 Unclassified 2401
303 Ga0207674_10048470 3300026116 Bacteria 4348
304 Ga0207674_10669836 3300026116 Bacteria 1002
305 Ga0207675_100056758 3300026118 Unclassified 3652
306 Ga0207675_100059770 3300026118 Bacteria 3557
307 Ga0207675_100086079 3300026118 Unclassified 2950
308 Ga0207675_100676886 3300026118 Unclassified 1039
309 Ga0207683_10108218 3300026121 Bacteria 2487
310 Ga0207698_10291938 3300026142 Unclassified 1514
311 Ga0207428_10007032 3300027907 Bacteria 10303
312 Ga0207428_10062114 3300027907 Bacteria 2955
313 Ga0207428_10186536 3300027907 Unclassified 1565
314 Ga0268265_10151182 3300028380 Bacteria 1958
315 Ga0268265_10513363 3300028380 Bacteria 1131
316 Ga0268264_10073295 3300028381 Bacteria 2905
317 Ga0268264_10115843 3300028381 Unclassified 2355
318 Ga0307405_10250379 3300031731 Bacteria 1318
319 Ga0307414_10444552 3300032004 Bacteria 1136
320 Ga0373951_0063554 3300035091 Bacteria 928
321 Ga0439458_0014099 3300042157 Bacteria 1803
322 Ga0439460_0039202 3300042461 Bacteria 1384
323 Ga0495621_0089245 3300046539 Bacteria 1160
324 Ga0495636_0233002 3300047318 Unclassified 848
325 Ga0495672_0010700 3300047320 Bacteria 6513
326 Ga0496104_0335834 3300048907 Bacteria 1424
327 Ga0496107_0384283 3300048910 Bacteria 1044
328 Ga0496110_0361972 3300048913 Bacteria 1322
329 Ga0496112_0875827 3300048915 Unclassified 821
330 Ga0501299_002656 3300049522 Unclassified 2496
331 Ga0501209_038800 3300049656 Unclassified 1250
332 Ga0501230_028449 3300049667 Unclassified 1027
333 Ga0501233_110120 3300049668 Unclassified 736
334 Ga0501249_006940 3300049679 Unclassified 2334
335 Ga0501249_009128 3300049679 Unclassified 2062
336 Ga0501234_014201 3300049707 Bacteria 1250
337 Ga0501273_002547 3300049770 Unclassified 1863
338 Ga0501212_003530 3300049851 Bacteria 1968
339 nmdc:mga05p37_552311_c1 3300050507 Unclassified 1311
340 nmdc:mga08y16_121739_c1 3300050511 Unclassified 2715
341 nmdc:mga08y16_245650_c1 3300050511 Bacteria 1850
342 nmdc:mga08y16_2859_c1 3300050511 Bacteria 17755
343 nmdc:mga08y16_606_c1 3300050511 Bacteria 33436
344 nmdc:mga08y16_63152_c1 3300050511 Bacteria 3867
345 nmdc:mga0n895_104088_c1 3300050512 Bacteria 2850
346 nmdc:mga0n895_94189_c1 3300050512 Unclassified 2998
347 Ga0530510_0173442 3300061734 Bacteria 1598
348 Ga0070694_100011842
349 SwRhRL2b_contig_1708624
350 JGI24034J14986_100038
351 JGI24748J21848_1000028
352 JGI24034J26672_10000051
353 rootL2_10312598
354 Ga0065704_10000988
355 Ga0065704_10105918
356 Ga0065704_10150639
357 Ga0065712_10033959
358 Ga0065715_10089655
359 Ga0065715_10096178
360 Ga0065715_10116383
361 Ga0065715_10178827
362 Ga0065715_10204654
363 Ga0065707_10002179
364 Ga0065707_10109899
365 Ga0065707_10116245
366 Ga0065707_10129156
367 Ga0065707_10248706
368 Ga0065707_10286738
369 Ga0070690_100006762
370 Ga0070690_100071400
371 Ga0070670_100046310
372 Ga0070670_100046677
373 Ga0068869_100007407
374 Ga0068869_100480622
375 Ga0068869_100575574
376 Ga0070666_10038472
377 Ga0070680_100300532
378 Ga0070682_100002874
379 Ga0070689_100070608
380 Ga0070689_100338854
381 Ga0070691_10135550
382 Ga0070687_100010336
383 Ga0070687_100108784
384 Ga0070687_100346154
385 Ga0070669_100001313
386 Ga0070669_100042803
387 Ga0070669_100377522
388 Ga0070675_100022504
389 Ga0070671_100448733
390 Ga0070674_100372652
391 Ga0070674_100384211
392 Ga0070673_100093002
393 Ga0070659_100322192
394 Ga0070659_100457966
395 Ga0070667_100034262
396 Ga0070703_10000098
397 Ga0070701_10112293
398 Ga0070705_100036362
399 Ga0070705_100095712
400 Ga0070705_100454605
401 Ga0070700_100028924
402 Ga0070700_100046296
403 Ga0070700_100220052
404 Ga0070700_100326173
405 Ga0070694_100007149
406 Ga0070694_100032077
407 Ga0070694_100090428
408 Ga0070694_100205334
409 Ga0070694_100442927
410 Ga0070708_100164738
411 Ga0070678_100184126
412 Ga0070662_100015255
413 Ga0070662_100105100
414 Ga0070662_100323540
415 Ga0068867_100008443
416 Ga0068867_100367889
417 Ga0068867_100412326
418 Ga0070706_100002105
419 Ga0070706_100066564
420 Ga0070706_100372970
421 Ga0070707_100000128
422 Ga0070707_100078365
423 Ga0070707_100319088
424 Ga0070698_100000847
425 Ga0070698_100001943
426 Ga0070698_100053202
427 Ga0070698_100070345
428 Ga0070698_100074697
429 Ga0070698_100098030
430 Ga0070699_100011705
431 Ga0070699_100020928
432 Ga0070699_100119775
433 Ga0070684_100320177
434 Ga0070697_100000332
435 Ga0070697_100186636
436 Ga0070697_100223136
437 Ga0068853_100002377
438 Ga0068853_100428055
439 Ga0070672_100130470
440 Ga0070672_100347313
441 Ga0070686_100024264
442 Ga0070686_100033607
443 Ga0070686_100043118
444 Ga0070695_100006844
445 Ga0070695_100024440
446 Ga0070695_100032821
447 Ga0070695_100113611
448 Ga0070695_100298809
449 Ga0070696_100021797
450 Ga0070696_100289631
451 Ga0070696_100577744
452 Ga0070693_100241949
453 Ga0070665_100069874
454 Ga0070704_100021202
455 Ga0070704_100030692
456 Ga0070704_100050255
457 Ga0068857_100863900
458 Ga0068854_100127742
459 Ga0068854_100403302
460 Ga0070702_100031855
461 Ga0070702_100035508
462 Ga0070702_100095005
463 Ga0068852_100706981
464 Ga0068859_100014153
465 Ga0068859_100036827
466 Ga0068859_100075704
467 Ga0068859_100550267
468 Ga0068859_100598921
469 Ga0068859_100613399
470 Ga0068864_100006149
471 Ga0068864_100050142
472 Ga0068864_100110261
473 Ga0068866_10028652
474 Ga0068861_100042403
475 Ga0068861_100090325
476 Ga0068861_100205265
477 Ga0068861_100756164
478 Ga0068870_10086799
479 Ga0068870_10118411
480 Ga0068870_10203935
481 Ga0068863_100276022
482 Ga0068863_100452252
483 Ga0068858_100000567
484 Ga0068858_100027142
485 Ga0068858_100181618
486 Ga0068858_100212179
487 Ga0068860_100015670
488 Ga0068860_100027368
489 Ga0068860_100108733
490 Ga0068862_100027800
491 Ga0081539_10079430
492 Ga0070715_10000102
493 Ga0070716_100000021
494 Ga0070716_100160359
495 Ga0097621_100041866
496 Ga0097621_100099084
497 Ga0097621_100187854
498 Ga0068871_100006662
499 Ga0068871_100019741
500 Ga0068871_100058583
501 Ga0068871_100219207
502 Ga0075428_100095630
503 Ga0075428_100351972
504 Ga0075428_100677669
505 Ga0075430_100036485
506 Ga0075431_100026198
507 Ga0075433_10156864
508 Ga0075434_100328407
509 Ga0075429_100392079
510 Ga0097620_100014153
511 Ga0097620_100036827
512 Ga0097620_100075713
513 Ga0097620_100550273
514 Ga0097620_100598905
515 Ga0097620_100613438
516 Ga0111539_10030532
517 Ga0111539_10077418
518 Ga0111539_10079397
519 Ga0111539_10579916
520 Ga0105247_10000252
521 Ga0105247_10297798
522 Ga0114129_10010985
523 Ga0114129_10595054
524 Ga0114129_11007666
525 Ga0105243_10000169
526 Ga0105243_10024786
527 Ga0105243_10082592
528 Ga0105243_10304946
529 Ga0105243_10867584
530 Ga0105242_10000175
531 Ga0105242_10000517
532 Ga0105242_10194795
533 Ga0105242_10234198
534 Ga0105242_10868418
535 Ga0105248_10012939
536 Ga0105248_10025914
537 Ga0105248_10215590
538 Ga0105237_10574244
539 Ga0105238_10038359
540 Ga0105249_10041504
541 Ga0105249_10158824
542 Ga0105249_10222199
543 Ga0105239_10102339
544 Ga0105246_10152000
545 Ga0157374_10030780
546 Ga0157378_10004237
547 Ga0157378_10011421
548 Ga0157378_10328918
549 Ga0157378_10571443
550 Ga0157378_11258901
551 Ga0163162_10001013
552 Ga0163162_10023513
553 Ga0163162_10064189
554 Ga0163162_10125850
555 Ga0163162_10181161
556 Ga0157375_10004041
557 Ga0157375_10005744
558 Ga0157375_10022626
559 Ga0157375_10054026
560 Ga0163163_10060106
561 Ga0163163_10108679
562 Ga0163163_10126988
563 Ga0157379_10088540
564 Ga0157376_10013954
565 Ga0163161_10015852
566 Ga0163161_10033728
567 Ga0163161_10050770
568 Ga0163161_10633126
569 Ga0163161_10635050
570 Ga0207672_1000070
571 Ga0207697_10040906
572 Ga0207653_10000177
573 Ga0207710_10000001
574 Ga0207680_10341719
575 Ga0207647_10009673
576 Ga0207685_10000016
577 Ga0207643_10005063
578 Ga0207643_10071571
579 Ga0207684_10003671
580 Ga0207684_10014348
581 Ga0207654_10290420
582 Ga0207707_10219674
583 Ga0207660_10406548
584 Ga0207662_10001395
585 Ga0207662_10142339
586 Ga0207662_10210488
587 Ga0207662_10237504
588 Ga0207646_10001202
589 Ga0207646_10005487
590 Ga0207646_10190501
591 Ga0207646_10234613
592 Ga0207681_10013702
593 Ga0207681_10056042
594 Ga0207681_10079777
595 Ga0207681_10169596
596 Ga0207694_10022182
597 Ga0207650_10000780
598 Ga0207650_10317041
599 Ga0207650_10449520
600 Ga0207659_10201184
601 Ga0207687_10130159
602 Ga0207644_10003313
603 Ga0207644_10007348
604 Ga0207690_10017846
605 Ga0207706_10053111
606 Ga0207706_10085695
607 Ga0207706_10354535
608 Ga0207686_10000082
609 Ga0207686_10000144
610 Ga0207709_10000219
611 Ga0207709_10725178
612 Ga0207670_10176639
613 Ga0207704_10041736
614 Ga0207704_10267845
615 Ga0207665_10000035
616 Ga0207665_10036386
617 Ga0207665_10344214
618 Ga0207691_10007611
619 Ga0207691_10274723
620 Ga0207711_10426862
621 Ga0207689_10006966
622 Ga0207689_10309086
623 Ga0207689_10537399
624 Ga0207651_10035749
625 Ga0207651_10095540
626 Ga0207712_10120908
627 Ga0207712_10234963
628 Ga0207712_10275308
629 Ga0207640_10056887
630 Ga0207640_10096847
631 Ga0207658_10129949
632 Ga0207658_10177579
633 Ga0207703_10001462
634 Ga0207703_10017606
635 Ga0207703_10102826
636 Ga0207703_10172813
637 Ga0207703_10325906
638 Ga0207639_10682278
639 Ga0207708_10032748
640 Ga0207708_10045124
641 Ga0207708_10070532
642 Ga0207708_10225360
643 Ga0207708_10370092
644 Ga0207641_10497160
645 Ga0207641_10792605
646 Ga0207648_10012573
647 Ga0207648_10041187
648 Ga0207648_10958687
649 Ga0207676_10100075
650 Ga0207674_10048470
651 Ga0207674_10669836
652 Ga0207675_100056758
653 Ga0207675_100059770
654 Ga0207675_100086079
655 Ga0207675_100676886
656 Ga0207683_10108218
657 Ga0207698_10291938
658 Ga0207428_10007032
659 Ga0207428_10062114
660 Ga0207428_10186536
661 Ga0268265_10151182
662 Ga0268265_10513363
663 Ga0268264_10073295
664 Ga0268264_10115843
665 Ga0307405_10250379
666 Ga0307414_10444552
667 Ga0373951_0063554
668 Ga0439458_0014099
669 Ga0439460_0039202
670 Ga0495621_0089245
671 Ga0495636_0233002
672 Ga0495672_0010700
673 Ga0496104_0335834
674 Ga0496107_0384283
675 Ga0496110_0361972
676 Ga0496112_0875827
677 Ga0501299_002656
678 Ga0501209_038800
679 Ga0501230_028449
680 Ga0501233_110120
681 Ga0501249_006940
682 Ga0501249_009128
683 Ga0501234_014201
684 Ga0501273_002547
685 Ga0501212_003530
686 nmdc:mga05p37_552311_c1
687 nmdc:mga08y16_121739_c1
688 nmdc:mga08y16_245650_c1
689 nmdc:mga08y16_2859_c1
690 nmdc:mga08y16_606_c1
691 nmdc:mga08y16_63152_c1
692 nmdc:mga0n895_104088_c1
693 nmdc:mga0n895_94189_c1
694 Ga0530510_0173442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

143

242

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.9126 29 92
5ao8-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-nam-pentapeptide 0.8632 25 91
7qvd-assembly1.cif.gz_AAA x-ray structure of the lytic transglycosylase sltb2 from pseudomonas aeruginosa 0.855 27 90
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8084 104 222
4lpq-assembly1.cif.gz_A crystal structure of the l,d-transpeptidase (residues 123-326) from xylanimonas cellulosilytica dsm 15894 0.8072 19 222
ID Description Score Start End Superfamily
4lpqA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8289 97 222 2.40.440.10
4lpqA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8229 97 222 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8084 104 222 2.40.440.10
1l6jA01 Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD 0.8062 34 94 1.10.101.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7748 104 222 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A085TVV0-F1-model_v4 Peptidoglycan binding domain-containing protein 0.9486 33 91
AF-A0A1X7A0C2-F1-model_v4 Putative peptidoglycan binding domain protein 0.9336 33 91
AF-A0A3M0WNM3-F1-model_v4 Peptidoglycan-binding protein 0.9324 33 96
AF-A0A259INP5-F1-model_v4 Lytic transglycosylase 0.93 28 92 GO:0008933
GO:0009253
AF-A0A7C3YEV2-F1-model_v4 Murein L,D-transpeptidase 0.9184 38 222 GO:0005576
GO:0005975
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972

Map