F416901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 199 | 328 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300048090|Ga0495615_0023263|Ga0495615_0023263_137_898 |
| Length | 244 |
| Sequence | MQPMPGELSDNRGRGEAEWNWPAIHPEGRKFGLIAVIVALATLFLFDLEIVGWPLLMLSAGVFAFFRDPERVVPQGDDLVLSPADGMITMICLVPPPLELQGPDAAGSPGLGSEPLTRVSIFMSVFDVHINRAPVGGTVKRVFYIPGKFMNADLDKASDENERQHILIERPDGKPIGCTQIAGLVARRIVPFVKPGDIVAAGQRIGLIRFGSRVDVYLPQGTDTRVLLGQTELGRQELLEGVRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 10 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 11 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 12 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 13 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 14 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 15 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 105 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 111 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 122 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 124 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 125 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 153 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 178 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 181 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 182 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 186 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 187 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 188 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 190 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 192 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 194 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 195 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 196 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 197 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 198 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.8 |
| Metatranscriptomes | 0 |
| Isolates | 5.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.76 |
| Nodule | 0.87 |
| Rhizoplane | 7.8 |
| Rhizosphere | 63.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1691408 | 2162886007 | Bacteria | 4848 |
| 2 | SwRhRL2b_contig_1844621 | 2162886007 | Bacteria | 25117 |
| 3 | SwRhRL2b_contig_3413782 | 2162886007 | Bacteria | 1085 |
| 4 | JGI24751J29686_10000113 | 3300002459 | Bacteria | 42221 |
| 5 | Ga0055530_10044772 | 3300003791 | Bacteria | 1059 |
| 6 | Ga0065704_10070220 | 3300005289 | Bacteria | 67739 |
| 7 | Ga0065704_10070273 | 3300005289 | Bacteria | 42544 |
| 8 | Ga0070658_10019846 | 3300005327 | Bacteria | 5384 |
| 9 | Ga0070658_10089427 | 3300005327 | Bacteria | 2536 |
| 10 | Ga0070680_100083172 | 3300005336 | Bacteria | 2643 |
| 11 | Ga0070682_100043129 | 3300005337 | Bacteria | 2788 |
| 12 | Ga0070660_100015071 | 3300005339 | Bacteria | 5577 |
| 13 | Ga0070689_100153321 | 3300005340 | Bacteria | 1859 |
| 14 | Ga0070661_100001958 | 3300005344 | Bacteria | 14250 |
| 15 | Ga0070661_100224723 | 3300005344 | Bacteria | 1441 |
| 16 | Ga0070668_100039287 | 3300005347 | Bacteria | 3619 |
| 17 | Ga0070668_100080051 | 3300005347 | Bacteria | 2559 |
| 18 | Ga0070668_100288080 | 3300005347 | Bacteria | 1374 |
| 19 | Ga0070669_100000062 | 3300005353 | Bacteria | 107705 |
| 20 | Ga0070669_100002282 | 3300005353 | Bacteria | 13908 |
| 21 | Ga0070669_100004070 | 3300005353 | Bacteria | 10585 |
| 22 | Ga0070669_100201566 | 3300005353 | Bacteria | 1566 |
| 23 | Ga0070671_100000117 | 3300005355 | Bacteria | 51485 |
| 24 | Ga0070671_100018185 | 3300005355 | Bacteria | 5706 |
| 25 | Ga0070671_100028550 | 3300005355 | Bacteria | 4595 |
| 26 | Ga0070671_100029973 | 3300005355 | Bacteria | 4489 |
| 27 | Ga0070659_100021875 | 3300005366 | Bacteria | 4878 |
| 28 | Ga0070659_100363797 | 3300005366 | Bacteria | 1216 |
| 29 | Ga0070667_100000261 | 3300005367 | Bacteria | 60134 |
| 30 | Ga0070667_100017243 | 3300005367 | Bacteria | 5982 |
| 31 | Ga0070667_100017865 | 3300005367 | Bacteria | 5879 |
| 32 | Ga0070667_100113230 | 3300005367 | Bacteria | 2354 |
| 33 | Ga0070667_100232942 | 3300005367 | Bacteria | 1642 |
| 34 | Ga0070663_100077663 | 3300005455 | Bacteria | 2431 |
| 35 | Ga0070662_100012000 | 3300005457 | Bacteria | 5733 |
| 36 | Ga0070662_100047013 | 3300005457 | Bacteria | 3102 |
| 37 | Ga0070679_100013374 | 3300005530 | Bacteria | 7859 |
| 38 | Ga0070679_100014264 | 3300005530 | Bacteria | 7630 |
| 39 | Ga0068853_100006137 | 3300005539 | Bacteria | 9520 |
| 40 | Ga0070686_100040500 | 3300005544 | Bacteria | 2907 |
| 41 | Ga0070665_100000319 | 3300005548 | Bacteria | 74295 |
| 42 | Ga0070665_100009816 | 3300005548 | Bacteria | 9676 |
| 43 | Ga0070665_100041550 | 3300005548 | Bacteria | 4623 |
| 44 | Ga0068855_100001503 | 3300005563 | Bacteria | 29214 |
| 45 | Ga0068855_100012513 | 3300005563 | Bacteria | 10243 |
| 46 | Ga0070664_100015493 | 3300005564 | Bacteria | 6237 |
| 47 | Ga0068857_100126400 | 3300005577 | Bacteria | 2304 |
| 48 | Ga0068854_100020859 | 3300005578 | Bacteria | 4440 |
| 49 | Ga0068854_100127095 | 3300005578 | Bacteria | 1942 |
| 50 | Ga0068852_100053923 | 3300005616 | Bacteria | 3464 |
| 51 | Ga0068852_100264697 | 3300005616 | Bacteria | 1652 |
| 52 | Ga0068859_100079086 | 3300005617 | Bacteria | 3328 |
| 53 | Ga0068859_100212320 | 3300005617 | Bacteria | 2022 |
| 54 | Ga0068859_101045496 | 3300005617 | Bacteria | 897 |
| 55 | Ga0068864_100024888 | 3300005618 | Bacteria | 5036 |
| 56 | Ga0068864_100051711 | 3300005618 | Bacteria | 3540 |
| 57 | Ga0068864_100131807 | 3300005618 | Bacteria | 2246 |
| 58 | Ga0068863_100000058 | 3300005841 | Bacteria | 123096 |
| 59 | Ga0068863_100017997 | 3300005841 | Bacteria | 6764 |
| 60 | Ga0068858_100021669 | 3300005842 | Bacteria | 6006 |
| 61 | Ga0068860_100000057 | 3300005843 | Bacteria | 201847 |
| 62 | Ga0068860_100014159 | 3300005843 | Bacteria | 7823 |
| 63 | Ga0068860_100026686 | 3300005843 | Bacteria | 5567 |
| 64 | Ga0068860_100040430 | 3300005843 | Bacteria | 4456 |
| 65 | Ga0068860_100173658 | 3300005843 | Bacteria | 2082 |
| 66 | Ga0068860_100237295 | 3300005843 | Bacteria | 1773 |
| 67 | Ga0068860_100289137 | 3300005843 | Bacteria | 1603 |
| 68 | Ga0068862_100020989 | 3300005844 | Bacteria | 5457 |
| 69 | Ga0068862_100036225 | 3300005844 | Bacteria | 4182 |
| 70 | Ga0075368_10001005 | 3300006042 | Bacteria | 8821 |
| 71 | Ga0075363_100000282 | 3300006048 | Bacteria | 14734 |
| 72 | Ga0075363_100003405 | 3300006048 | Bacteria | 6760 |
| 73 | Ga0075364_10026282 | 3300006051 | Bacteria | 3712 |
| 74 | Ga0075364_10084544 | 3300006051 | Bacteria | 2101 |
| 75 | Ga0075364_10178543 | 3300006051 | Bacteria | 1436 |
| 76 | Ga0075432_10000402 | 3300006058 | Bacteria | 12646 |
| 77 | Ga0075362_10000096 | 3300006177 | Bacteria | 24783 |
| 78 | Ga0075362_10020905 | 3300006177 | Bacteria | 2739 |
| 79 | Ga0075367_10249423 | 3300006178 | Bacteria | 1113 |
| 80 | Ga0075369_10000872 | 3300006186 | Bacteria | 9998 |
| 81 | Ga0075369_10040824 | 3300006186 | Bacteria | 1984 |
| 82 | Ga0075366_10000243 | 3300006195 | Bacteria | 24123 |
| 83 | Ga0075366_10016794 | 3300006195 | Bacteria | 4207 |
| 84 | Ga0075366_10119322 | 3300006195 | Bacteria | 1589 |
| 85 | Ga0075366_10168311 | 3300006195 | Bacteria | 1329 |
| 86 | Ga0075370_10000003 | 3300006353 | Bacteria | 133163 |
| 87 | Ga0075370_10087120 | 3300006353 | Bacteria | 1799 |
| 88 | Ga0097620_100079085 | 3300006931 | Bacteria | 3328 |
| 89 | Ga0097620_100212302 | 3300006931 | Bacteria | 2022 |
| 90 | Ga0097620_101045499 | 3300006931 | Bacteria | 897 |
| 91 | Ga0079104_1034464 | 3300006946 | Bacteria | 1229 |
| 92 | Ga0105251_10001939 | 3300009011 | Bacteria | 16942 |
| 93 | Ga0105250_10026697 | 3300009092 | Bacteria | 2327 |
| 94 | Ga0111539_10877787 | 3300009094 | Bacteria | 1043 |
| 95 | Ga0105248_10074182 | 3300009177 | Bacteria | 3824 |
| 96 | Ga0105248_10364549 | 3300009177 | Bacteria | 1627 |
| 97 | Ga0105248_10507104 | 3300009177 | Bacteria | 1360 |
| 98 | Ga0105249_10364524 | 3300009553 | Bacteria | 1467 |
| 99 | Ga0105246_10000150 | 3300011119 | Bacteria | 32883 |
| 100 | Ga0157371_10002149 | 3300013102 | Bacteria | 19211 |
| 101 | Ga0157370_10008444 | 3300013104 | Bacteria | 11110 |
| 102 | Ga0157369_10032308 | 3300013105 | Bacteria | 5758 |
| 103 | Ga0157369_10119611 | 3300013105 | Bacteria | 2795 |
| 104 | Ga0163162_10031936 | 3300013306 | Bacteria | 5226 |
| 105 | Ga0157372_10011328 | 3300013307 | Bacteria | 9483 |
| 106 | Ga0157375_10687207 | 3300013308 | Bacteria | 1178 |
| 107 | Ga0163163_10405873 | 3300014325 | Bacteria | 1421 |
| 108 | Ga0157380_10241694 | 3300014326 | Bacteria | 1628 |
| 109 | Ga0209050_1000119 | 3300025298 | Bacteria | 200661 |
| 110 | Ga0207697_10074593 | 3300025315 | Bacteria | 1425 |
| 111 | Ga0207696_1016962 | 3300025711 | Bacteria | 2423 |
| 112 | Ga0207713_1005977 | 3300025735 | Bacteria | 7508 |
| 113 | Ga0207713_1041441 | 3300025735 | Bacteria | 1921 |
| 114 | Ga0207705_10138160 | 3300025909 | Bacteria | 1818 |
| 115 | Ga0207707_10010796 | 3300025912 | Bacteria | 7937 |
| 116 | Ga0207660_10007624 | 3300025917 | Bacteria | 7007 |
| 117 | Ga0207657_10000599 | 3300025919 | Bacteria | 38276 |
| 118 | Ga0207649_10016967 | 3300025920 | Bacteria | 4120 |
| 119 | Ga0207649_10064025 | 3300025920 | Bacteria | 2323 |
| 120 | Ga0207649_10439934 | 3300025920 | Bacteria | 982 |
| 121 | Ga0207652_10002434 | 3300025921 | Bacteria | 15717 |
| 122 | Ga0207652_10104543 | 3300025921 | Bacteria | 2505 |
| 123 | Ga0207652_10109382 | 3300025921 | Bacteria | 2450 |
| 124 | Ga0207681_10000125 | 3300025923 | Bacteria | 62866 |
| 125 | Ga0207681_10000441 | 3300025923 | Bacteria | 29051 |
| 126 | Ga0207681_10000667 | 3300025923 | Bacteria | 22714 |
| 127 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 128 | Ga0207644_10012811 | 3300025931 | Bacteria | 5576 |
| 129 | Ga0207644_10020391 | 3300025931 | Bacteria | 4507 |
| 130 | Ga0207690_10004159 | 3300025932 | Bacteria | 8550 |
| 131 | Ga0207690_10032821 | 3300025932 | Bacteria | 3334 |
| 132 | Ga0207706_10015829 | 3300025933 | Bacteria | 6820 |
| 133 | Ga0207706_10023799 | 3300025933 | Bacteria | 5495 |
| 134 | Ga0207706_10185922 | 3300025933 | Bacteria | 1824 |
| 135 | Ga0207670_10175558 | 3300025936 | Bacteria | 1610 |
| 136 | Ga0207711_10095710 | 3300025941 | Bacteria | 2619 |
| 137 | Ga0207711_10358541 | 3300025941 | Bacteria | 1350 |
| 138 | Ga0207711_10543578 | 3300025941 | Bacteria | 1083 |
| 139 | Ga0207661_10414256 | 3300025944 | Bacteria | 1223 |
| 140 | Ga0207679_10041356 | 3300025945 | Bacteria | 3305 |
| 141 | Ga0207667_10004266 | 3300025949 | Bacteria | 17545 |
| 142 | Ga0207667_10005265 | 3300025949 | Bacteria | 15779 |
| 143 | Ga0207667_10148556 | 3300025949 | Bacteria | 2412 |
| 144 | Ga0207667_10439501 | 3300025949 | Bacteria | 1326 |
| 145 | Ga0207668_10021148 | 3300025972 | Bacteria | 4146 |
| 146 | Ga0207640_10237770 | 3300025981 | Bacteria | 1405 |
| 147 | Ga0207658_10000247 | 3300025986 | Bacteria | 56367 |
| 148 | Ga0207658_10011126 | 3300025986 | Bacteria | 6127 |
| 149 | Ga0207658_10011699 | 3300025986 | Bacteria | 5975 |
| 150 | Ga0207658_10140162 | 3300025986 | Bacteria | 1955 |
| 151 | Ga0207703_10003571 | 3300026035 | Bacteria | 13000 |
| 152 | Ga0207703_10015753 | 3300026035 | Bacteria | 5897 |
| 153 | Ga0207703_10477201 | 3300026035 | Bacteria | 1168 |
| 154 | Ga0207639_10008940 | 3300026041 | Bacteria | 6894 |
| 155 | Ga0207678_10105062 | 3300026067 | Bacteria | 2410 |
| 156 | Ga0207702_10010124 | 3300026078 | Bacteria | 7900 |
| 157 | Ga0207641_10000338 | 3300026088 | Bacteria | 56937 |
| 158 | Ga0207641_10002385 | 3300026088 | Bacteria | 17328 |
| 159 | Ga0207641_10871132 | 3300026088 | Bacteria | 893 |
| 160 | Ga0207676_10003392 | 3300026095 | Bacteria | 11254 |
| 161 | Ga0207676_10332294 | 3300026095 | Bacteria | 1399 |
| 162 | Ga0207698_10011878 | 3300026142 | Bacteria | 5670 |
| 163 | Ga0209281_1005318 | 3300027111 | Bacteria | 3604 |
| 164 | Ga0209281_1021911 | 3300027111 | Bacteria | 1229 |
| 165 | Ga0209813_10000013 | 3300027866 | Bacteria | 89768 |
| 166 | Ga0268266_10000212 | 3300028379 | Bacteria | 101029 |
| 167 | Ga0268266_10006062 | 3300028379 | Bacteria | 11142 |
| 168 | Ga0268266_10022516 | 3300028379 | Bacteria | 5369 |
| 169 | Ga0268266_10300167 | 3300028379 | Bacteria | 1498 |
| 170 | Ga0268265_10005043 | 3300028380 | Bacteria | 9063 |
| 171 | Ga0268265_10009009 | 3300028380 | Bacteria | 6752 |
| 172 | Ga0268265_10668084 | 3300028380 | Bacteria | 1000 |
| 173 | Ga0268264_10000078 | 3300028381 | Bacteria | 249595 |
| 174 | Ga0268264_10018259 | 3300028381 | Bacteria | 5737 |
| 175 | Ga0268264_10028843 | 3300028381 | Bacteria | 4542 |
| 176 | Ga0268264_10052997 | 3300028381 | Bacteria | 3384 |
| 177 | Ga0268264_10100812 | 3300028381 | Bacteria | 2509 |
| 178 | Ga0307408_100278734 | 3300031548 | Bacteria | 1391 |
| 179 | Ga0316579_10054247 | 3300031691 | Bacteria | 1879 |
| 180 | Ga0307516_10204732 | 3300031730 | Bacteria | 1691 |
| 181 | Ga0307405_10004030 | 3300031731 | Bacteria | 6893 |
| 182 | Ga0307405_10155969 | 3300031731 | Bacteria | 1611 |
| 183 | Ga0307413_10104404 | 3300031824 | Bacteria | 1881 |
| 184 | Ga0307413_10170822 | 3300031824 | Bacteria | 1539 |
| 185 | Ga0307413_10173464 | 3300031824 | Bacteria | 1529 |
| 186 | Ga0307413_10340346 | 3300031824 | Bacteria | 1153 |
| 187 | Ga0307410_10057890 | 3300031852 | Bacteria | 2641 |
| 188 | Ga0307410_10216144 | 3300031852 | Bacteria | 1472 |
| 189 | Ga0307406_10027127 | 3300031901 | Bacteria | 3448 |
| 190 | Ga0307412_10027755 | 3300031911 | Bacteria | 3534 |
| 191 | Ga0307412_10213379 | 3300031911 | Bacteria | 1474 |
| 192 | Ga0307409_100145140 | 3300031995 | Bacteria | 2051 |
| 193 | Ga0307409_100200922 | 3300031995 | Bacteria | 1783 |
| 194 | Ga0307416_100153954 | 3300032002 | Bacteria | 2113 |
| 195 | Ga0307414_10018159 | 3300032004 | Bacteria | 4321 |
| 196 | Ga0307414_10107767 | 3300032004 | Bacteria | 2112 |
| 197 | Ga0307414_10664506 | 3300032004 | Bacteria | 940 |
| 198 | Ga0307415_100103014 | 3300032126 | Bacteria | 2099 |
| 199 | Ga0316583_10064811 | 3300032133 | Bacteria | 1279 |
| 200 | Ga0373932_0039171 | 3300035112 | Bacteria | 1358 |
| 201 | Ga0316584_0216302 | 3300036712 | Bacteria | 1409 |
| 202 | Ga0439462_0001116 | 3300042015 | Bacteria | 5813 |
| 203 | Ga0450912_000663 | 3300042116 | Bacteria | 1811 |
| 204 | Ga0466957_0521258 | 3300044842 | Bacteria | 826 |
| 205 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 206 | Ga0495627_001263 | 3300046453 | Bacteria | 15596 |
| 207 | Ga0495638_0033581 | 3300046460 | Bacteria | 3281 |
| 208 | Ga0495638_0139240 | 3300046460 | Bacteria | 1418 |
| 209 | Ga0495650_0004264 | 3300046471 | Bacteria | 9884 |
| 210 | Ga0495596_0001235 | 3300046500 | Bacteria | 14901 |
| 211 | Ga0495607_0007510 | 3300046501 | Bacteria | 7530 |
| 212 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 213 | Ga0495610_0001450 | 3300046512 | Bacteria | 20950 |
| 214 | Ga0495610_0017398 | 3300046512 | Bacteria | 4100 |
| 215 | Ga0495620_0065378 | 3300046515 | Bacteria | 1501 |
| 216 | Ga0495632_0002246 | 3300046519 | Bacteria | 14875 |
| 217 | Ga0495643_0000351 | 3300046522 | Bacteria | 62687 |
| 218 | Ga0495643_0013407 | 3300046522 | Bacteria | 4908 |
| 219 | Ga0495643_0085592 | 3300046522 | Bacteria | 1634 |
| 220 | Ga0495654_0028276 | 3300046530 | Bacteria | 2868 |
| 221 | Ga0495654_0062050 | 3300046530 | Bacteria | 1793 |
| 222 | Ga0495621_0011995 | 3300046539 | Bacteria | 2695 |
| 223 | Ga0495625_0034843 | 3300046660 | Bacteria | 3713 |
| 224 | Ga0495670_0081676 | 3300046691 | Bacteria | 1647 |
| 225 | Ga0495671_0173198 | 3300046692 | Bacteria | 1049 |
| 226 | Ga0495681_0000052 | 3300047470 | Bacteria | 106939 |
| 227 | Ga0495615_0023263 | 3300048090 | Bacteria | 1418 |
| 228 | Ga0495626_0001891 | 3300048091 | Bacteria | 15640 |
| 229 | Ga0496100_0003126 | 3300048903 | Bacteria | 8573 |
| 230 | Ga0496101_0009333 | 3300048904 | Bacteria | 6445 |
| 231 | Ga0496101_0027853 | 3300048904 | Bacteria | 3940 |
| 232 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 233 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 234 | Ga0496103_0058706 | 3300048906 | Bacteria | 2390 |
| 235 | Ga0496103_0064384 | 3300048906 | Bacteria | 2285 |
| 236 | Ga0496104_0000060 | 3300048907 | Bacteria | 117966 |
| 237 | Ga0496104_0017089 | 3300048907 | Bacteria | 6602 |
| 238 | Ga0496104_0034062 | 3300048907 | Bacteria | 4747 |
| 239 | Ga0496104_0298643 | 3300048907 | Bacteria | 1523 |
| 240 | Ga0496105_0000122 | 3300048908 | Bacteria | 52475 |
| 241 | Ga0496105_0004473 | 3300048908 | Bacteria | 10523 |
| 242 | Ga0496106_0000950 | 3300048909 | Bacteria | 21126 |
| 243 | Ga0496106_0503423 | 3300048909 | Bacteria | 973 |
| 244 | Ga0496107_0004246 | 3300048910 | Bacteria | 9682 |
| 245 | Ga0496107_0046360 | 3300048910 | Bacteria | 3129 |
| 246 | Ga0496109_0015067 | 3300048912 | Bacteria | 6729 |
| 247 | Ga0496110_0436761 | 3300048913 | Bacteria | 1193 |
| 248 | Ga0496111_0125765 | 3300048914 | Bacteria | 1895 |
| 249 | Ga0496111_0241507 | 3300048914 | Bacteria | 1341 |
| 250 | Ga0496112_0040529 | 3300048915 | Bacteria | 4554 |
| 251 | Ga0496112_0248984 | 3300048915 | Bacteria | 1728 |
| 252 | Ga0496113_0000260 | 3300048916 | Bacteria | 25008 |
| 253 | Ga0496113_0015486 | 3300048916 | Bacteria | 5243 |
| 254 | Ga0496114_0059932 | 3300048917 | Bacteria | 3180 |
| 255 | Ga0496115_0295770 | 3300048918 | Bacteria | 1327 |
| 256 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 257 | Ga0496116_0045432 | 3300048919 | Bacteria | 2973 |
| 258 | Ga0496117_0014179 | 3300048920 | Bacteria | 6889 |
| 259 | Ga0496117_0147902 | 3300048920 | Bacteria | 1395 |
| 260 | Ga0496118_0002769 | 3300048921 | Bacteria | 22965 |
| 261 | Ga0496118_0038992 | 3300048921 | Bacteria | 3798 |
| 262 | Ga0496118_0045198 | 3300048921 | Bacteria | 3441 |
| 263 | Ga0496119_0000222 | 3300048922 | Bacteria | 79824 |
| 264 | Ga0496120_0000747 | 3300048923 | Bacteria | 47215 |
| 265 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 266 | Ga0496121_0000312 | 3300048924 | Bacteria | 101230 |
| 267 | Ga0496121_0004707 | 3300048924 | Bacteria | 18061 |
| 268 | Ga0496121_0013641 | 3300048924 | Bacteria | 8711 |
| 269 | Ga0496122_0010607 | 3300048925 | Bacteria | 9464 |
| 270 | Ga0496122_0015995 | 3300048925 | Bacteria | 7133 |
| 271 | Ga0496123_0003060 | 3300048926 | Bacteria | 19222 |
| 272 | Ga0496123_0013961 | 3300048926 | Bacteria | 6690 |
| 273 | Ga0496123_0018495 | 3300048926 | Bacteria | 5540 |
| 274 | Ga0496124_0001019 | 3300048927 | Bacteria | 44416 |
| 275 | Ga0496124_0004374 | 3300048927 | Bacteria | 16529 |
| 276 | Ga0496124_0050061 | 3300048927 | Bacteria | 3561 |
| 277 | Ga0496125_0011528 | 3300048928 | Bacteria | 8832 |
| 278 | Ga0496125_0011588 | 3300048928 | Bacteria | 8808 |
| 279 | Ga0496125_0057307 | 3300048928 | Bacteria | 3156 |
| 280 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 281 | Ga0496126_0000294 | 3300048929 | Bacteria | 106327 |
| 282 | Ga0496126_0006152 | 3300048929 | Bacteria | 13445 |
| 283 | Ga0496126_0093424 | 3300048929 | Bacteria | 2641 |
| 284 | Ga0501036_0356066 | 3300049572 | Bacteria | 1222 |
| 285 | Ga0501037_0066000 | 3300049573 | Bacteria | 2637 |
| 286 | Ga0501039_0181939 | 3300049575 | Bacteria | 1653 |
| 287 | Ga0501047_0329703 | 3300049581 | Bacteria | 1365 |
| 288 | Ga0501224_009522 | 3300049664 | Bacteria | 1422 |
| 289 | Ga0501044_0001521 | 3300049823 | Bacteria | 27210 |
| 290 | nmdc:mga03683_15716_c1 | 3300050489 | Bacteria | 2830 |
| 291 | nmdc:mga03683_16633_c1 | 3300050489 | Bacteria | 2767 |
| 292 | nmdc:mga03683_5315_c1 | 3300050489 | Bacteria | 4344 |
| 293 | nmdc:mga03683_95_c1 | 3300050489 | Bacteria | 32187 |
| 294 | nmdc:mga03n38_15075_c1 | 3300050490 | Bacteria | 2978 |
| 295 | nmdc:mga03n38_741_c1 | 3300050490 | Bacteria | 8621 |
| 296 | nmdc:mga00v17_304846_c1 | 3300050491 | Bacteria | 1035 |
| 297 | nmdc:mga00v17_382_c1 | 3300050491 | Bacteria | 25073 |
| 298 | nmdc:mga00v17_66972_c1 | 3300050491 | Bacteria | 2218 |
| 299 | nmdc:mga0k408_27450_c1 | 3300050493 | Bacteria | 3233 |
| 300 | nmdc:mga0k408_3_c1 | 3300050493 | Bacteria | 243777 |
| 301 | nmdc:mga0k408_4850_c1 | 3300050493 | Bacteria | 7137 |
| 302 | nmdc:mga0k408_89116_c1 | 3300050493 | Bacteria | 1812 |
| 303 | nmdc:mga0k408_91830_c1 | 3300050493 | Bacteria | 1784 |
| 304 | nmdc:mga06z11_899_c1 | 3300050494 | Bacteria | 10815 |
| 305 | nmdc:mga04h51_478_c1 | 3300050495 | Bacteria | 9586 |
| 306 | nmdc:mga07m45_16_c1 | 3300050496 | Bacteria | 151695 |
| 307 | nmdc:mga07m45_29946_c1 | 3300050496 | Bacteria | 3013 |
| 308 | nmdc:mga07m45_6_c1 | 3300050496 | Bacteria | 260521 |
| 309 | nmdc:mga0sz30_409_c1 | 3300050516 | Bacteria | 16403 |
| 310 | nmdc:mga0sz30_860_c1 | 3300050516 | Bacteria | 10933 |
| 311 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 312 | Ga0500607_001368 | 3300053121 | Bacteria | 22161 |
| 313 | Ga0500607_003293 | 3300053121 | Bacteria | 11891 |
| 314 | Ga0500608_000758 | 3300053122 | Bacteria | 11763 |
| 315 | Ga0500608_133560 | 3300053122 | Bacteria | 1110 |
| 316 | Ga0500618_005497 | 3300053125 | Bacteria | 3840 |
| 317 | Ga0500618_028572 | 3300053125 | Bacteria | 1320 |
| 318 | Ga0500559_0001235 | 3300053136 | Bacteria | 15068 |
| 319 | Ga0500559_0015413 | 3300053136 | Bacteria | 3227 |
| 320 | Ga0500564_009897 | 3300053138 | Bacteria | 4165 |
| 321 | Ga0500590_028316 | 3300053148 | Bacteria | 2907 |
| 322 | Ga0500604_0032141 | 3300053151 | Bacteria | 1545 |
| 323 | Ga0500616_0006668 | 3300053153 | Bacteria | 7506 |
| 324 | Ga0500622_0009092 | 3300053156 | Bacteria | 5516 |
| 325 | Ga0500637_0015765 | 3300053178 | Bacteria | 4015 |
| 326 | Ga0500567_002323 | 3300053723 | Bacteria | 8103 |
| 327 | Ga0500625_000022 | 3300053729 | Bacteria | 78028 |
| 328 | Ga0501082_0627950 | 3300060353 | Bacteria | 940 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10405873 | Ga0163163_104058733 | 240 |
| 2 | 3300046539 | Ga0495621_0011995 | Ga0495621_0011995_1073_1834 | 240 |
| 3 | 3300048090 | Ga0495615_0023263 | Ga0495615_0023263_137_898 | 240 |
| 4 | 3300005843 | Ga0068860_100237295 | Ga0068860_1002372952 | 244 |
| 5 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_503649_504401 | 244 |
| 6 | iso_pu_bacteria | 2510917021 | 2511126166 | 245 |
| 7 | iso_pu_bacteria | 2738541275 | 2738712521 | 245 |
| 8 | iso_pu_bacteria | 2738541301 | 2738850945 | 245 |
| 9 | iso_pu_bacteria | 2738541304 | 2738866675 | 245 |
| 10 | iso_pu_bacteria | 2738543022 | 2739299192 | 245 |
| 11 | iso_pu_bacteria | 2738543033 | 2739360871 | 245 |
| 12 | iso_pu_bacteria | 2818991438 | 2819552684 | 245 |
| 13 | iso_pu_bacteria | 2882806704 | 2882808163 | 245 |
| 14 | iso_pu_bacteria | 2895880812 | 2895883289 | 245 |
| 15 | iso_pu_bacteria | 2896184354 | 2896184501 | 245 |
| 16 | iso_pu_bacteria | 2896253425 | 2896256620 | 245 |
| 17 | iso_pu_bacteria | 2919138771 | 2919139925 | 245 |
| 18 | iso_pu_bacteria | 2928100450 | 2928103829 | 245 |
| 19 | iso_pu_bacteria | 2928959182 | 2928961758 | 245 |
| 20 | iso_pu_bacteria | 8054302542 | 8054302955 | 245 |
| 21 | iso_pu_bacteria | 3000865235 | 3000865451 | 247 |
| 22 | 3300005336 | Ga0070680_100083172 | Ga0070680_1000831722 | 248 |
| 23 | 3300005530 | Ga0070679_100014264 | Ga0070679_1000142644 | 248 |
| 24 | 3300014326 | Ga0157380_10241694 | Ga0157380_102416942 | 248 |
| 25 | 3300025921 | Ga0207652_10002434 | Ga0207652_1000243412 | 248 |
| 26 | 3300025921 | Ga0207652_10104543 | Ga0207652_101045432 | 248 |
| 27 | iso_pu_bacteria | 2643221588 | 2643949674 | 248 |
| 28 | iso_pu_bacteria | 2739367865 | 2740028895 | 248 |
| 29 | 2162886007 | SwRhRL2b_contig_1691408 | SwRhRL2b_0068.00007590 | 249 |
| 30 | 2162886007 | SwRhRL2b_contig_1844621 | SwRhRL2b_0644.00000630 | 249 |
| 31 | 2162886007 | SwRhRL2b_contig_3413782 | SwRhRL2b_0709.00002080 | 249 |
| 32 | 3300002459 | JGI24751J29686_10000113 | JGI24751J29686_1000011321 | 249 |
| 33 | 3300003791 | Ga0055530_10044772 | Ga0055530_100447721 | 249 |
| 34 | 3300005289 | Ga0065704_10070220 | Ga0065704_1007022026 | 249 |
| 35 | 3300005289 | Ga0065704_10070273 | Ga0065704_1007027337 | 249 |
| 36 | 3300005327 | Ga0070658_10019846 | Ga0070658_100198463 | 249 |
| 37 | 3300005327 | Ga0070658_10089427 | Ga0070658_100894272 | 249 |
| 38 | 3300005337 | Ga0070682_100043129 | Ga0070682_1000431294 | 249 |
| 39 | 3300005339 | Ga0070660_100015071 | Ga0070660_1000150713 | 249 |
| 40 | 3300005340 | Ga0070689_100153321 | Ga0070689_1001533212 | 249 |
| 41 | 3300005344 | Ga0070661_100001958 | Ga0070661_10000195810 | 249 |
| 42 | 3300005344 | Ga0070661_100224723 | Ga0070661_1002247232 | 249 |
| 43 | 3300005347 | Ga0070668_100039287 | Ga0070668_1000392873 | 249 |
| 44 | 3300005347 | Ga0070668_100080051 | Ga0070668_1000800512 | 249 |
| 45 | 3300005347 | Ga0070668_100288080 | Ga0070668_1002880802 | 249 |
| 46 | 3300005353 | Ga0070669_100000062 | Ga0070669_10000006234 | 249 |
| 47 | 3300005353 | Ga0070669_100002282 | Ga0070669_1000022827 | 249 |
| 48 | 3300005353 | Ga0070669_100004070 | Ga0070669_1000040701 | 249 |
| 49 | 3300005353 | Ga0070669_100201566 | Ga0070669_1002015661 | 249 |
| 50 | 3300005355 | Ga0070671_100000117 | Ga0070671_10000011751 | 249 |
| 51 | 3300005355 | Ga0070671_100018185 | Ga0070671_1000181853 | 249 |
| 52 | 3300005355 | Ga0070671_100028550 | Ga0070671_1000285503 | 249 |
| 53 | 3300005355 | Ga0070671_100029973 | Ga0070671_1000299735 | 249 |
| 54 | 3300005366 | Ga0070659_100021875 | Ga0070659_1000218752 | 249 |
| 55 | 3300005366 | Ga0070659_100363797 | Ga0070659_1003637972 | 249 |
| 56 | 3300005367 | Ga0070667_100000261 | Ga0070667_10000026160 | 249 |
| 57 | 3300005367 | Ga0070667_100017243 | Ga0070667_1000172434 | 249 |
| 58 | 3300005367 | Ga0070667_100017865 | Ga0070667_1000178655 | 249 |
| 59 | 3300005367 | Ga0070667_100113230 | Ga0070667_1001132303 | 249 |
| 60 | 3300005367 | Ga0070667_100232942 | Ga0070667_1002329423 | 249 |
| 61 | 3300005455 | Ga0070663_100077663 | Ga0070663_1000776632 | 249 |
| 62 | 3300005457 | Ga0070662_100012000 | Ga0070662_1000120007 | 249 |
| 63 | 3300005457 | Ga0070662_100047013 | Ga0070662_1000470132 | 249 |
| 64 | 3300005530 | Ga0070679_100013374 | Ga0070679_10001337410 | 249 |
| 65 | 3300005539 | Ga0068853_100006137 | Ga0068853_10000613710 | 249 |
| 66 | 3300005544 | Ga0070686_100040500 | Ga0070686_1000405002 | 249 |
| 67 | 3300005548 | Ga0070665_100000319 | Ga0070665_10000031984 | 249 |
| 68 | 3300005548 | Ga0070665_100009816 | Ga0070665_1000098165 | 249 |
| 69 | 3300005548 | Ga0070665_100041550 | Ga0070665_1000415504 | 249 |
| 70 | 3300005563 | Ga0068855_100001503 | Ga0068855_10000150314 | 249 |
| 71 | 3300005563 | Ga0068855_100012513 | Ga0068855_10001251310 | 249 |
| 72 | 3300005564 | Ga0070664_100015493 | Ga0070664_1000154934 | 249 |
| 73 | 3300005577 | Ga0068857_100126400 | Ga0068857_1001264003 | 249 |
| 74 | 3300005578 | Ga0068854_100020859 | Ga0068854_1000208593 | 249 |
| 75 | 3300005578 | Ga0068854_100127095 | Ga0068854_1001270952 | 249 |
| 76 | 3300005616 | Ga0068852_100053923 | Ga0068852_1000539235 | 249 |
| 77 | 3300005616 | Ga0068852_100264697 | Ga0068852_1002646972 | 249 |
| 78 | 3300005617 | Ga0068859_100079086 | Ga0068859_1000790862 | 249 |
| 79 | 3300005617 | Ga0068859_100212320 | Ga0068859_1002123203 | 249 |
| 80 | 3300005617 | Ga0068859_101045496 | Ga0068859_1010454961 | 249 |
| 81 | 3300005618 | Ga0068864_100024888 | Ga0068864_1000248881 | 249 |
| 82 | 3300005618 | Ga0068864_100051711 | Ga0068864_1000517113 | 249 |
| 83 | 3300005618 | Ga0068864_100131807 | Ga0068864_1001318072 | 249 |
| 84 | 3300005841 | Ga0068863_100000058 | Ga0068863_10000005863 | 249 |
| 85 | 3300005841 | Ga0068863_100017997 | Ga0068863_1000179977 | 249 |
| 86 | 3300005842 | Ga0068858_100021669 | Ga0068858_1000216694 | 249 |
| 87 | 3300005843 | Ga0068860_100000057 | Ga0068860_100000057155 | 249 |
| 88 | 3300005843 | Ga0068860_100014159 | Ga0068860_10001415912 | 249 |
| 89 | 3300005843 | Ga0068860_100026686 | Ga0068860_1000266865 | 249 |
| 90 | 3300005843 | Ga0068860_100040430 | Ga0068860_1000404303 | 249 |
| 91 | 3300005843 | Ga0068860_100173658 | Ga0068860_1001736583 | 249 |
| 92 | 3300005843 | Ga0068860_100289137 | Ga0068860_1002891372 | 249 |
| 93 | 3300005844 | Ga0068862_100020989 | Ga0068862_1000209893 | 249 |
| 94 | 3300005844 | Ga0068862_100036225 | Ga0068862_1000362253 | 249 |
| 95 | 3300006042 | Ga0075368_10001005 | Ga0075368_100010054 | 249 |
| 96 | 3300006048 | Ga0075363_100000282 | Ga0075363_10000028210 | 249 |
| 97 | 3300006048 | Ga0075363_100003405 | Ga0075363_1000034053 | 249 |
| 98 | 3300006051 | Ga0075364_10026282 | Ga0075364_100262825 | 249 |
| 99 | 3300006051 | Ga0075364_10084544 | Ga0075364_100845442 | 249 |
| 100 | 3300006051 | Ga0075364_10178543 | Ga0075364_101785432 | 249 |
| 101 | 3300006058 | Ga0075432_10000402 | Ga0075432_100004029 | 249 |
| 102 | 3300006177 | Ga0075362_10000096 | Ga0075362_100000962 | 249 |
| 103 | 3300006177 | Ga0075362_10020905 | Ga0075362_100209054 | 249 |
| 104 | 3300006178 | Ga0075367_10249423 | Ga0075367_102494232 | 249 |
| 105 | 3300006186 | Ga0075369_10000872 | Ga0075369_100008723 | 249 |
| 106 | 3300006186 | Ga0075369_10040824 | Ga0075369_100408241 | 249 |
| 107 | 3300006195 | Ga0075366_10000243 | Ga0075366_1000024313 | 249 |
| 108 | 3300006195 | Ga0075366_10016794 | Ga0075366_100167942 | 249 |
| 109 | 3300006195 | Ga0075366_10119322 | Ga0075366_101193222 | 249 |
| 110 | 3300006195 | Ga0075366_10168311 | Ga0075366_101683112 | 249 |
| 111 | 3300006353 | Ga0075370_10000003 | Ga0075370_1000000344 | 249 |
| 112 | 3300006353 | Ga0075370_10087120 | Ga0075370_100871203 | 249 |
| 113 | 3300006931 | Ga0097620_100079085 | Ga0097620_1000790852 | 249 |
| 114 | 3300006931 | Ga0097620_100212302 | Ga0097620_1002123022 | 249 |
| 115 | 3300006931 | Ga0097620_101045499 | Ga0097620_1010454991 | 249 |
| 116 | 3300006946 | Ga0079104_1034464 | Ga0079104_10344642 | 249 |
| 117 | 3300009011 | Ga0105251_10001939 | Ga0105251_100019396 | 249 |
| 118 | 3300009092 | Ga0105250_10026697 | Ga0105250_100266971 | 249 |
| 119 | 3300009094 | Ga0111539_10877787 | Ga0111539_108777871 | 249 |
| 120 | 3300009177 | Ga0105248_10074182 | Ga0105248_100741825 | 249 |
| 121 | 3300009177 | Ga0105248_10364549 | Ga0105248_103645492 | 249 |
| 122 | 3300009177 | Ga0105248_10507104 | Ga0105248_105071041 | 249 |
| 123 | 3300009553 | Ga0105249_10364524 | Ga0105249_103645242 | 249 |
| 124 | 3300011119 | Ga0105246_10000150 | Ga0105246_1000015014 | 249 |
| 125 | 3300013102 | Ga0157371_10002149 | Ga0157371_1000214921 | 249 |
| 126 | 3300013104 | Ga0157370_10008444 | Ga0157370_100084442 | 249 |
| 127 | 3300013105 | Ga0157369_10032308 | Ga0157369_100323082 | 249 |
| 128 | 3300013105 | Ga0157369_10119611 | Ga0157369_101196111 | 249 |
| 129 | 3300013306 | Ga0163162_10031936 | Ga0163162_100319365 | 249 |
| 130 | 3300013307 | Ga0157372_10011328 | Ga0157372_100113282 | 249 |
| 131 | 3300013308 | Ga0157375_10687207 | Ga0157375_106872071 | 249 |
| 132 | 3300025298 | Ga0209050_1000119 | Ga0209050_1000119101 | 249 |
| 133 | 3300025315 | Ga0207697_10074593 | Ga0207697_100745932 | 249 |
| 134 | 3300025711 | Ga0207696_1016962 | Ga0207696_10169622 | 249 |
| 135 | 3300025735 | Ga0207713_1005977 | Ga0207713_10059776 | 249 |
| 136 | 3300025735 | Ga0207713_1041441 | Ga0207713_10414413 | 249 |
| 137 | 3300025909 | Ga0207705_10138160 | Ga0207705_101381602 | 249 |
| 138 | 3300025912 | Ga0207707_10010796 | Ga0207707_100107963 | 249 |
| 139 | 3300025917 | Ga0207660_10007624 | Ga0207660_100076248 | 249 |
| 140 | 3300025919 | Ga0207657_10000599 | Ga0207657_1000059932 | 249 |
| 141 | 3300025920 | Ga0207649_10016967 | Ga0207649_100169673 | 249 |
| 142 | 3300025920 | Ga0207649_10064025 | Ga0207649_100640253 | 249 |
| 143 | 3300025920 | Ga0207649_10439934 | Ga0207649_104399342 | 249 |
| 144 | 3300025921 | Ga0207652_10109382 | Ga0207652_101093822 | 249 |
| 145 | 3300025923 | Ga0207681_10000125 | Ga0207681_1000012520 | 249 |
| 146 | 3300025923 | Ga0207681_10000441 | Ga0207681_100004419 | 249 |
| 147 | 3300025923 | Ga0207681_10000667 | Ga0207681_100006677 | 249 |
| 148 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003337 | 249 |
| 149 | 3300025931 | Ga0207644_10012811 | Ga0207644_100128115 | 249 |
| 150 | 3300025931 | Ga0207644_10020391 | Ga0207644_100203913 | 249 |
| 151 | 3300025932 | Ga0207690_10004159 | Ga0207690_100041598 | 249 |
| 152 | 3300025932 | Ga0207690_10032821 | Ga0207690_100328212 | 249 |
| 153 | 3300025933 | Ga0207706_10015829 | Ga0207706_100158295 | 249 |
| 154 | 3300025933 | Ga0207706_10023799 | Ga0207706_100237992 | 249 |
| 155 | 3300025933 | Ga0207706_10185922 | Ga0207706_101859221 | 249 |
| 156 | 3300025936 | Ga0207670_10175558 | Ga0207670_101755582 | 249 |
| 157 | 3300025941 | Ga0207711_10095710 | Ga0207711_100957102 | 249 |
| 158 | 3300025941 | Ga0207711_10358541 | Ga0207711_103585412 | 249 |
| 159 | 3300025941 | Ga0207711_10543578 | Ga0207711_105435781 | 249 |
| 160 | 3300025944 | Ga0207661_10414256 | Ga0207661_104142562 | 249 |
| 161 | 3300025945 | Ga0207679_10041356 | Ga0207679_100413562 | 249 |
| 162 | 3300025949 | Ga0207667_10004266 | Ga0207667_1000426616 | 249 |
| 163 | 3300025949 | Ga0207667_10005265 | Ga0207667_100052658 | 249 |
| 164 | 3300025949 | Ga0207667_10148556 | Ga0207667_101485562 | 249 |
| 165 | 3300025949 | Ga0207667_10439501 | Ga0207667_104395012 | 249 |
| 166 | 3300025972 | Ga0207668_10021148 | Ga0207668_100211484 | 249 |
| 167 | 3300025981 | Ga0207640_10237770 | Ga0207640_102377701 | 249 |
| 168 | 3300025986 | Ga0207658_10000247 | Ga0207658_1000024717 | 249 |
| 169 | 3300025986 | Ga0207658_10011126 | Ga0207658_100111263 | 249 |
| 170 | 3300025986 | Ga0207658_10011699 | Ga0207658_100116995 | 249 |
| 171 | 3300025986 | Ga0207658_10140162 | Ga0207658_101401622 | 249 |
| 172 | 3300026035 | Ga0207703_10003571 | Ga0207703_100035717 | 249 |
| 173 | 3300026035 | Ga0207703_10015753 | Ga0207703_100157534 | 249 |
| 174 | 3300026035 | Ga0207703_10477201 | Ga0207703_104772011 | 249 |
| 175 | 3300026041 | Ga0207639_10008940 | Ga0207639_100089402 | 249 |
| 176 | 3300026067 | Ga0207678_10105062 | Ga0207678_101050622 | 249 |
| 177 | 3300026078 | Ga0207702_10010124 | Ga0207702_1001012410 | 249 |
| 178 | 3300026088 | Ga0207641_10000338 | Ga0207641_1000033827 | 249 |
| 179 | 3300026088 | Ga0207641_10002385 | Ga0207641_100023855 | 249 |
| 180 | 3300026088 | Ga0207641_10871132 | Ga0207641_108711321 | 249 |
| 181 | 3300026095 | Ga0207676_10003392 | Ga0207676_1000339211 | 249 |
| 182 | 3300026095 | Ga0207676_10332294 | Ga0207676_103322941 | 249 |
| 183 | 3300026142 | Ga0207698_10011878 | Ga0207698_100118786 | 249 |
| 184 | 3300027111 | Ga0209281_1005318 | Ga0209281_10053184 | 249 |
| 185 | 3300027111 | Ga0209281_1021911 | Ga0209281_10219112 | 249 |
| 186 | 3300027866 | Ga0209813_10000013 | Ga0209813_1000001320 | 249 |
| 187 | 3300028379 | Ga0268266_10000212 | Ga0268266_1000021233 | 249 |
| 188 | 3300028379 | Ga0268266_10006062 | Ga0268266_1000606210 | 249 |
| 189 | 3300028379 | Ga0268266_10022516 | Ga0268266_100225167 | 249 |
| 190 | 3300028379 | Ga0268266_10300167 | Ga0268266_103001672 | 249 |
| 191 | 3300028380 | Ga0268265_10005043 | Ga0268265_100050434 | 249 |
| 192 | 3300028380 | Ga0268265_10009009 | Ga0268265_100090094 | 249 |
| 193 | 3300028380 | Ga0268265_10668084 | Ga0268265_106680842 | 249 |
| 194 | 3300028381 | Ga0268264_10000078 | Ga0268264_1000007836 | 249 |
| 195 | 3300028381 | Ga0268264_10018259 | Ga0268264_100182595 | 249 |
| 196 | 3300028381 | Ga0268264_10028843 | Ga0268264_100288434 | 249 |
| 197 | 3300028381 | Ga0268264_10052997 | Ga0268264_100529973 | 249 |
| 198 | 3300028381 | Ga0268264_10100812 | Ga0268264_101008123 | 249 |
| 199 | 3300031548 | Ga0307408_100278734 | Ga0307408_1002787341 | 249 |
| 200 | 3300031691 | Ga0316579_10054247 | Ga0316579_100542472 | 249 |
| 201 | 3300031730 | Ga0307516_10204732 | Ga0307516_102047321 | 249 |
| 202 | 3300031731 | Ga0307405_10004030 | Ga0307405_100040303 | 249 |
| 203 | 3300031731 | Ga0307405_10155969 | Ga0307405_101559693 | 249 |
| 204 | 3300031824 | Ga0307413_10104404 | Ga0307413_101044041 | 249 |
| 205 | 3300031824 | Ga0307413_10170822 | Ga0307413_101708222 | 249 |
| 206 | 3300031824 | Ga0307413_10173464 | Ga0307413_101734642 | 249 |
| 207 | 3300031824 | Ga0307413_10340346 | Ga0307413_103403461 | 249 |
| 208 | 3300031852 | Ga0307410_10057890 | Ga0307410_100578902 | 249 |
| 209 | 3300031852 | Ga0307410_10216144 | Ga0307410_102161442 | 249 |
| 210 | 3300031901 | Ga0307406_10027127 | Ga0307406_100271274 | 249 |
| 211 | 3300031911 | Ga0307412_10027755 | Ga0307412_100277552 | 249 |
| 212 | 3300031911 | Ga0307412_10213379 | Ga0307412_102133792 | 249 |
| 213 | 3300031995 | Ga0307409_100145140 | Ga0307409_1001451402 | 249 |
| 214 | 3300031995 | Ga0307409_100200922 | Ga0307409_1002009223 | 249 |
| 215 | 3300032002 | Ga0307416_100153954 | Ga0307416_1001539541 | 249 |
| 216 | 3300032004 | Ga0307414_10018159 | Ga0307414_100181594 | 249 |
| 217 | 3300032004 | Ga0307414_10107767 | Ga0307414_101077673 | 249 |
| 218 | 3300032004 | Ga0307414_10664506 | Ga0307414_106645062 | 249 |
| 219 | 3300032126 | Ga0307415_100103014 | Ga0307415_1001030144 | 249 |
| 220 | 3300032133 | Ga0316583_10064811 | Ga0316583_100648112 | 249 |
| 221 | 3300035112 | Ga0373932_0039171 | Ga0373932_0039171_296_1045 | 249 |
| 222 | 3300036712 | Ga0316584_0216302 | Ga0316584_0216302_110_862 | 249 |
| 223 | 3300042015 | Ga0439462_0001116 | Ga0439462_0001116_441_1202 | 249 |
| 224 | 3300042116 | Ga0450912_000663 | Ga0450912_000663_115_867 | 249 |
| 225 | 3300044842 | Ga0466957_0521258 | Ga0466957_0521258_29_778 | 249 |
| 226 | 3300046453 | Ga0495627_001263 | Ga0495627_001263_2240_2989 | 249 |
| 227 | 3300046460 | Ga0495638_0033581 | Ga0495638_0033581_2321_3070 | 249 |
| 228 | 3300046460 | Ga0495638_0139240 | Ga0495638_0139240_325_1077 | 249 |
| 229 | 3300046471 | Ga0495650_0004264 | Ga0495650_0004264_2095_2844 | 249 |
| 230 | 3300046500 | Ga0495596_0001235 | Ga0495596_0001235_2058_2813 | 249 |
| 231 | 3300046501 | Ga0495607_0007510 | Ga0495607_0007510_2218_2967 | 249 |
| 232 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_70666_71415 | 249 |
| 233 | 3300046512 | Ga0495610_0001450 | Ga0495610_0001450_311_1066 | 249 |
| 234 | 3300046512 | Ga0495610_0017398 | Ga0495610_0017398_2032_2781 | 249 |
| 235 | 3300046515 | Ga0495620_0065378 | Ga0495620_0065378_741_1490 | 249 |
| 236 | 3300046519 | Ga0495632_0002246 | Ga0495632_0002246_11897_12646 | 249 |
| 237 | 3300046522 | Ga0495643_0000351 | Ga0495643_0000351_11655_12404 | 249 |
| 238 | 3300046522 | Ga0495643_0013407 | Ga0495643_0013407_2384_3133 | 249 |
| 239 | 3300046522 | Ga0495643_0085592 | Ga0495643_0085592_586_1341 | 249 |
| 240 | 3300046530 | Ga0495654_0028276 | Ga0495654_0028276_582_1331 | 249 |
| 241 | 3300046530 | Ga0495654_0062050 | Ga0495654_0062050_524_1273 | 249 |
| 242 | 3300046660 | Ga0495625_0034843 | Ga0495625_0034843_2063_2812 | 249 |
| 243 | 3300046691 | Ga0495670_0081676 | Ga0495670_0081676_646_1395 | 249 |
| 244 | 3300046692 | Ga0495671_0173198 | Ga0495671_0173198_286_1035 | 249 |
| 245 | 3300047470 | Ga0495681_0000052 | Ga0495681_0000052_12631_13380 | 249 |
| 246 | 3300048091 | Ga0495626_0001891 | Ga0495626_0001891_2475_3230 | 249 |
| 247 | 3300048903 | Ga0496100_0003126 | Ga0496100_0003126_6422_7180 | 249 |
| 248 | 3300048904 | Ga0496101_0009333 | Ga0496101_0009333_1217_1975 | 249 |
| 249 | 3300048904 | Ga0496101_0027853 | Ga0496101_0027853_3094_3843 | 249 |
| 250 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_20837_21586 | 249 |
| 251 | 3300048906 | Ga0496103_0000095 | Ga0496103_0000095_82443_83192 | 249 |
| 252 | 3300048906 | Ga0496103_0058706 | Ga0496103_0058706_1444_2202 | 249 |
| 253 | 3300048906 | Ga0496103_0064384 | Ga0496103_0064384_25_783 | 249 |
| 254 | 3300048907 | Ga0496104_0000060 | Ga0496104_0000060_67350_68099 | 249 |
| 255 | 3300048907 | Ga0496104_0017089 | Ga0496104_0017089_3888_4646 | 249 |
| 256 | 3300048907 | Ga0496104_0034062 | Ga0496104_0034062_2062_2811 | 249 |
| 257 | 3300048907 | Ga0496104_0298643 | Ga0496104_0298643_202_951 | 249 |
| 258 | 3300048908 | Ga0496105_0000122 | Ga0496105_0000122_19532_20281 | 249 |
| 259 | 3300048908 | Ga0496105_0004473 | Ga0496105_0004473_8157_8906 | 249 |
| 260 | 3300048909 | Ga0496106_0000950 | Ga0496106_0000950_16132_16890 | 249 |
| 261 | 3300048909 | Ga0496106_0503423 | Ga0496106_0503423_33_782 | 249 |
| 262 | 3300048910 | Ga0496107_0004246 | Ga0496107_0004246_2277_3035 | 249 |
| 263 | 3300048910 | Ga0496107_0046360 | Ga0496107_0046360_1792_2541 | 249 |
| 264 | 3300048912 | Ga0496109_0015067 | Ga0496109_0015067_1128_1886 | 249 |
| 265 | 3300048913 | Ga0496110_0436761 | Ga0496110_0436761_136_1080 | 249 |
| 266 | 3300048914 | Ga0496111_0125765 | Ga0496111_0125765_888_1637 | 249 |
| 267 | 3300048914 | Ga0496111_0241507 | Ga0496111_0241507_529_1287 | 249 |
| 268 | 3300048915 | Ga0496112_0040529 | Ga0496112_0040529_1983_2732 | 249 |
| 269 | 3300048915 | Ga0496112_0248984 | Ga0496112_0248984_325_1083 | 249 |
| 270 | 3300048916 | Ga0496113_0000260 | Ga0496113_0000260_6750_7508 | 249 |
| 271 | 3300048916 | Ga0496113_0015486 | Ga0496113_0015486_2632_3381 | 249 |
| 272 | 3300048917 | Ga0496114_0059932 | Ga0496114_0059932_755_1516 | 249 |
| 273 | 3300048918 | Ga0496115_0295770 | Ga0496115_0295770_362_1111 | 249 |
| 274 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_51453_52202 | 249 |
| 275 | 3300048919 | Ga0496116_0045432 | Ga0496116_0045432_1406_2164 | 249 |
| 276 | 3300048920 | Ga0496117_0014179 | Ga0496117_0014179_197_946 | 249 |
| 277 | 3300048920 | Ga0496117_0147902 | Ga0496117_0147902_231_980 | 249 |
| 278 | 3300048921 | Ga0496118_0002769 | Ga0496118_0002769_6377_7126 | 249 |
| 279 | 3300048921 | Ga0496118_0038992 | Ga0496118_0038992_1631_2380 | 249 |
| 280 | 3300048921 | Ga0496118_0045198 | Ga0496118_0045198_1298_2047 | 249 |
| 281 | 3300048922 | Ga0496119_0000222 | Ga0496119_0000222_47976_48725 | 249 |
| 282 | 3300048923 | Ga0496120_0000747 | Ga0496120_0000747_43548_44297 | 249 |
| 283 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_172911_173660 | 249 |
| 284 | 3300048924 | Ga0496121_0000312 | Ga0496121_0000312_99612_100361 | 249 |
| 285 | 3300048924 | Ga0496121_0004707 | Ga0496121_0004707_14633_15382 | 249 |
| 286 | 3300048924 | Ga0496121_0013641 | Ga0496121_0013641_4092_4841 | 249 |
| 287 | 3300048925 | Ga0496122_0010607 | Ga0496122_0010607_5527_6276 | 249 |
| 288 | 3300048925 | Ga0496122_0015995 | Ga0496122_0015995_3720_4469 | 249 |
| 289 | 3300048926 | Ga0496123_0003060 | Ga0496123_0003060_12642_13391 | 249 |
| 290 | 3300048926 | Ga0496123_0013961 | Ga0496123_0013961_2665_3414 | 249 |
| 291 | 3300048926 | Ga0496123_0018495 | Ga0496123_0018495_2077_2826 | 249 |
| 292 | 3300048927 | Ga0496124_0001019 | Ga0496124_0001019_6152_6901 | 249 |
| 293 | 3300048927 | Ga0496124_0004374 | Ga0496124_0004374_551_1300 | 249 |
| 294 | 3300048927 | Ga0496124_0050061 | Ga0496124_0050061_2594_3343 | 249 |
| 295 | 3300048928 | Ga0496125_0011528 | Ga0496125_0011528_2660_3409 | 249 |
| 296 | 3300048928 | Ga0496125_0011588 | Ga0496125_0011588_7612_8370 | 249 |
| 297 | 3300048928 | Ga0496125_0057307 | Ga0496125_0057307_1842_2591 | 249 |
| 298 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_181802_182551 | 249 |
| 299 | 3300048929 | Ga0496126_0000294 | Ga0496126_0000294_9278_10027 | 249 |
| 300 | 3300048929 | Ga0496126_0006152 | Ga0496126_0006152_3279_4028 | 249 |
| 301 | 3300048929 | Ga0496126_0093424 | Ga0496126_0093424_394_1152 | 249 |
| 302 | 3300049572 | Ga0501036_0356066 | Ga0501036_0356066_313_1065 | 249 |
| 303 | 3300049573 | Ga0501037_0066000 | Ga0501037_0066000_1816_2574 | 249 |
| 304 | 3300049575 | Ga0501039_0181939 | Ga0501039_0181939_721_1479 | 249 |
| 305 | 3300049581 | Ga0501047_0329703 | Ga0501047_0329703_113_862 | 249 |
| 306 | 3300049664 | Ga0501224_009522 | Ga0501224_009522_20_769 | 249 |
| 307 | 3300049823 | Ga0501044_0001521 | Ga0501044_0001521_5067_5825 | 249 |
| 308 | 3300050489 | nmdc:mga03683_15716_c1 | nmdc:mga03683_15716_c1_78_836 | 249 |
| 309 | 3300050489 | nmdc:mga03683_16633_c1 | nmdc:mga03683_16633_c1_954_1712 | 249 |
| 310 | 3300050489 | nmdc:mga03683_5315_c1 | nmdc:mga03683_5315_c1_3295_4044 | 249 |
| 311 | 3300050489 | nmdc:mga03683_95_c1 | nmdc:mga03683_95_c1_26638_27387 | 249 |
| 312 | 3300050490 | nmdc:mga03n38_15075_c1 | nmdc:mga03n38_15075_c1_1157_1906 | 249 |
| 313 | 3300050490 | nmdc:mga03n38_741_c1 | nmdc:mga03n38_741_c1_7618_8376 | 249 |
| 314 | 3300050491 | nmdc:mga00v17_304846_c1 | nmdc:mga00v17_304846_c1_32_790 | 249 |
| 315 | 3300050491 | nmdc:mga00v17_382_c1 | nmdc:mga00v17_382_c1_1716_2465 | 249 |
| 316 | 3300050491 | nmdc:mga00v17_66972_c1 | nmdc:mga00v17_66972_c1_971_1729 | 249 |
| 317 | 3300050493 | nmdc:mga0k408_27450_c1 | nmdc:mga0k408_27450_c1_1626_2375 | 249 |
| 318 | 3300050493 | nmdc:mga0k408_3_c1 | nmdc:mga0k408_3_c1_154930_155679 | 249 |
| 319 | 3300050493 | nmdc:mga0k408_4850_c1 | nmdc:mga0k408_4850_c1_1208_1957 | 249 |
| 320 | 3300050493 | nmdc:mga0k408_89116_c1 | nmdc:mga0k408_89116_c1_779_1537 | 249 |
| 321 | 3300050493 | nmdc:mga0k408_91830_c1 | nmdc:mga0k408_91830_c1_327_1076 | 249 |
| 322 | 3300050494 | nmdc:mga06z11_899_c1 | nmdc:mga06z11_899_c1_7696_8583 | 249 |
| 323 | 3300050495 | nmdc:mga04h51_478_c1 | nmdc:mga04h51_478_c1_846_1733 | 249 |
| 324 | 3300050496 | nmdc:mga07m45_16_c1 | nmdc:mga07m45_16_c1_137235_138122 | 249 |
| 325 | 3300050496 | nmdc:mga07m45_29946_c1 | nmdc:mga07m45_29946_c1_2044_2793 | 249 |
| 326 | 3300050496 | nmdc:mga07m45_6_c1 | nmdc:mga07m45_6_c1_90875_91624 | 249 |
| 327 | 3300050516 | nmdc:mga0sz30_409_c1 | nmdc:mga0sz30_409_c1_15363_16121 | 249 |
| 328 | 3300050516 | nmdc:mga0sz30_860_c1 | nmdc:mga0sz30_860_c1_8470_9219 | 249 |
| 329 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_917661_918413 | 249 |
| 330 | 3300053121 | Ga0500607_001368 | Ga0500607_001368_2026_2775 | 249 |
| 331 | 3300053121 | Ga0500607_003293 | Ga0500607_003293_7600_8358 | 249 |
| 332 | 3300053122 | Ga0500608_000758 | Ga0500608_000758_9774_10532 | 249 |
| 333 | 3300053122 | Ga0500608_133560 | Ga0500608_133560_165_914 | 249 |
| 334 | 3300053125 | Ga0500618_005497 | Ga0500618_005497_1779_2528 | 249 |
| 335 | 3300053125 | Ga0500618_028572 | Ga0500618_028572_421_1170 | 249 |
| 336 | 3300053136 | Ga0500559_0001235 | Ga0500559_0001235_2026_2775 | 249 |
| 337 | 3300053136 | Ga0500559_0015413 | Ga0500559_0015413_626_1375 | 249 |
| 338 | 3300053138 | Ga0500564_009897 | Ga0500564_009897_1592_2350 | 249 |
| 339 | 3300053148 | Ga0500590_028316 | Ga0500590_028316_696_1445 | 249 |
| 340 | 3300053151 | Ga0500604_0032141 | Ga0500604_0032141_26_775 | 249 |
| 341 | 3300053153 | Ga0500616_0006668 | Ga0500616_0006668_581_1333 | 249 |
| 342 | 3300053156 | Ga0500622_0009092 | Ga0500622_0009092_4391_5140 | 249 |
| 343 | 3300053178 | Ga0500637_0015765 | Ga0500637_0015765_51_800 | 249 |
| 344 | 3300053723 | Ga0500567_002323 | Ga0500567_002323_1668_2426 | 249 |
| 345 | 3300053729 | Ga0500625_000022 | Ga0500625_000022_1821_2579 | 249 |
| 346 | 3300060353 | Ga0501082_0627950 | Ga0501082_0627950_148_897 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xmk-assembly1.cif.gz_M | cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) | 0.8033 | 24 | 60 |
| 7rdh-assembly1.cif.gz_H | crystal structure of the de novo designed binding protein h3mb in complex with the 1968 influenza a virus hemagglutinin | 0.8004 | 24 | 58 |
| 6oo2-assembly1.cif.gz_P | vps4 with cyclic peptide bound in the central pore | 0.7888 | 22 | 60 |
| 6oo2-assembly1.cif.gz_P | vps4 with cyclic peptide bound in the central pore | 0.7453 | 22 | 60 |
| 8bpo-assembly1.cif.gz_g2 | structure of rabbit 80s ribosome translating beta-tubulin in complex with tetratricopeptide protein 5 (ttc5) and s-phase cyclin a associated protein residing in the er (scaper) | 0.6322 | 27 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.936 | 61 | 236 | 2.70.70.10 |
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8947 | 61 | 236 | 2.70.70.10 |
| af_Q58156_13_77_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8189 | 24 | 58 | 1.20.1260.10 |
| af_Q58227_16_200_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8095 | 56 | 236 | 2.70.70.10 |
| 3mhvA00 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C | 0.8085 | 24 | 60 | 1.20.5.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3JDM5-F1-model_v4 | deleted | 0.9401 | 75 | 241 |
|
| AF-A0A1A3DMM6-F1-model_v4 | Phosphatidylserine decarboxylase | 0.9373 | 72 | 238 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A3D5QZE4-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9365 | 122 | 238 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A656KSX9-F1-model_v4 | deleted | 0.9363 | 76 | 238 |
|
| AF-A0A7Z9S1G0-F1-model_v4 | Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) | 0.9358 | 127 | 238 |
GO:0004609
GO:0005886 GO:0008654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar