F416901

General Info

Members Datasets Scaffolds Average Seq Length
346 199 328 251

Family's Representative Sequence

Representative Sequence 3300048090|Ga0495615_0023263|Ga0495615_0023263_137_898
Length 244
Sequence MQPMPGELSDNRGRGEAEWNWPAIHPEGRKFGLIAVIVALATLFLFDLEIVGWPLLMLSAGVFAFFRDPERVVPQGDDLVLSPADGMITMICLVPPPLELQGPDAAGSPGLGSEPLTRVSIFMSVFDVHINRAPVGGTVKRVFYIPGKFMNADLDKASDENERQHILIERPDGKPIGCTQIAGLVARRIVPFVKPGDIVAAGQRIGLIRFGSRVDVYLPQGTDTRVLLGQTELGRQELLEGVRQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
12 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
13 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
14 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
15 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
187 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
190 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
197 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.8
Metatranscriptomes 0
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.76
Nodule 0.87
Rhizoplane 7.8
Rhizosphere 63.29
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1691408 2162886007 Bacteria 4848
2 SwRhRL2b_contig_1844621 2162886007 Bacteria 25117
3 SwRhRL2b_contig_3413782 2162886007 Bacteria 1085
4 JGI24751J29686_10000113 3300002459 Bacteria 42221
5 Ga0055530_10044772 3300003791 Bacteria 1059
6 Ga0065704_10070220 3300005289 Bacteria 67739
7 Ga0065704_10070273 3300005289 Bacteria 42544
8 Ga0070658_10019846 3300005327 Bacteria 5384
9 Ga0070658_10089427 3300005327 Bacteria 2536
10 Ga0070680_100083172 3300005336 Bacteria 2643
11 Ga0070682_100043129 3300005337 Bacteria 2788
12 Ga0070660_100015071 3300005339 Bacteria 5577
13 Ga0070689_100153321 3300005340 Bacteria 1859
14 Ga0070661_100001958 3300005344 Bacteria 14250
15 Ga0070661_100224723 3300005344 Bacteria 1441
16 Ga0070668_100039287 3300005347 Bacteria 3619
17 Ga0070668_100080051 3300005347 Bacteria 2559
18 Ga0070668_100288080 3300005347 Bacteria 1374
19 Ga0070669_100000062 3300005353 Bacteria 107705
20 Ga0070669_100002282 3300005353 Bacteria 13908
21 Ga0070669_100004070 3300005353 Bacteria 10585
22 Ga0070669_100201566 3300005353 Bacteria 1566
23 Ga0070671_100000117 3300005355 Bacteria 51485
24 Ga0070671_100018185 3300005355 Bacteria 5706
25 Ga0070671_100028550 3300005355 Bacteria 4595
26 Ga0070671_100029973 3300005355 Bacteria 4489
27 Ga0070659_100021875 3300005366 Bacteria 4878
28 Ga0070659_100363797 3300005366 Bacteria 1216
29 Ga0070667_100000261 3300005367 Bacteria 60134
30 Ga0070667_100017243 3300005367 Bacteria 5982
31 Ga0070667_100017865 3300005367 Bacteria 5879
32 Ga0070667_100113230 3300005367 Bacteria 2354
33 Ga0070667_100232942 3300005367 Bacteria 1642
34 Ga0070663_100077663 3300005455 Bacteria 2431
35 Ga0070662_100012000 3300005457 Bacteria 5733
36 Ga0070662_100047013 3300005457 Bacteria 3102
37 Ga0070679_100013374 3300005530 Bacteria 7859
38 Ga0070679_100014264 3300005530 Bacteria 7630
39 Ga0068853_100006137 3300005539 Bacteria 9520
40 Ga0070686_100040500 3300005544 Bacteria 2907
41 Ga0070665_100000319 3300005548 Bacteria 74295
42 Ga0070665_100009816 3300005548 Bacteria 9676
43 Ga0070665_100041550 3300005548 Bacteria 4623
44 Ga0068855_100001503 3300005563 Bacteria 29214
45 Ga0068855_100012513 3300005563 Bacteria 10243
46 Ga0070664_100015493 3300005564 Bacteria 6237
47 Ga0068857_100126400 3300005577 Bacteria 2304
48 Ga0068854_100020859 3300005578 Bacteria 4440
49 Ga0068854_100127095 3300005578 Bacteria 1942
50 Ga0068852_100053923 3300005616 Bacteria 3464
51 Ga0068852_100264697 3300005616 Bacteria 1652
52 Ga0068859_100079086 3300005617 Bacteria 3328
53 Ga0068859_100212320 3300005617 Bacteria 2022
54 Ga0068859_101045496 3300005617 Bacteria 897
55 Ga0068864_100024888 3300005618 Bacteria 5036
56 Ga0068864_100051711 3300005618 Bacteria 3540
57 Ga0068864_100131807 3300005618 Bacteria 2246
58 Ga0068863_100000058 3300005841 Bacteria 123096
59 Ga0068863_100017997 3300005841 Bacteria 6764
60 Ga0068858_100021669 3300005842 Bacteria 6006
61 Ga0068860_100000057 3300005843 Bacteria 201847
62 Ga0068860_100014159 3300005843 Bacteria 7823
63 Ga0068860_100026686 3300005843 Bacteria 5567
64 Ga0068860_100040430 3300005843 Bacteria 4456
65 Ga0068860_100173658 3300005843 Bacteria 2082
66 Ga0068860_100237295 3300005843 Bacteria 1773
67 Ga0068860_100289137 3300005843 Bacteria 1603
68 Ga0068862_100020989 3300005844 Bacteria 5457
69 Ga0068862_100036225 3300005844 Bacteria 4182
70 Ga0075368_10001005 3300006042 Bacteria 8821
71 Ga0075363_100000282 3300006048 Bacteria 14734
72 Ga0075363_100003405 3300006048 Bacteria 6760
73 Ga0075364_10026282 3300006051 Bacteria 3712
74 Ga0075364_10084544 3300006051 Bacteria 2101
75 Ga0075364_10178543 3300006051 Bacteria 1436
76 Ga0075432_10000402 3300006058 Bacteria 12646
77 Ga0075362_10000096 3300006177 Bacteria 24783
78 Ga0075362_10020905 3300006177 Bacteria 2739
79 Ga0075367_10249423 3300006178 Bacteria 1113
80 Ga0075369_10000872 3300006186 Bacteria 9998
81 Ga0075369_10040824 3300006186 Bacteria 1984
82 Ga0075366_10000243 3300006195 Bacteria 24123
83 Ga0075366_10016794 3300006195 Bacteria 4207
84 Ga0075366_10119322 3300006195 Bacteria 1589
85 Ga0075366_10168311 3300006195 Bacteria 1329
86 Ga0075370_10000003 3300006353 Bacteria 133163
87 Ga0075370_10087120 3300006353 Bacteria 1799
88 Ga0097620_100079085 3300006931 Bacteria 3328
89 Ga0097620_100212302 3300006931 Bacteria 2022
90 Ga0097620_101045499 3300006931 Bacteria 897
91 Ga0079104_1034464 3300006946 Bacteria 1229
92 Ga0105251_10001939 3300009011 Bacteria 16942
93 Ga0105250_10026697 3300009092 Bacteria 2327
94 Ga0111539_10877787 3300009094 Bacteria 1043
95 Ga0105248_10074182 3300009177 Bacteria 3824
96 Ga0105248_10364549 3300009177 Bacteria 1627
97 Ga0105248_10507104 3300009177 Bacteria 1360
98 Ga0105249_10364524 3300009553 Bacteria 1467
99 Ga0105246_10000150 3300011119 Bacteria 32883
100 Ga0157371_10002149 3300013102 Bacteria 19211
101 Ga0157370_10008444 3300013104 Bacteria 11110
102 Ga0157369_10032308 3300013105 Bacteria 5758
103 Ga0157369_10119611 3300013105 Bacteria 2795
104 Ga0163162_10031936 3300013306 Bacteria 5226
105 Ga0157372_10011328 3300013307 Bacteria 9483
106 Ga0157375_10687207 3300013308 Bacteria 1178
107 Ga0163163_10405873 3300014325 Bacteria 1421
108 Ga0157380_10241694 3300014326 Bacteria 1628
109 Ga0209050_1000119 3300025298 Bacteria 200661
110 Ga0207697_10074593 3300025315 Bacteria 1425
111 Ga0207696_1016962 3300025711 Bacteria 2423
112 Ga0207713_1005977 3300025735 Bacteria 7508
113 Ga0207713_1041441 3300025735 Bacteria 1921
114 Ga0207705_10138160 3300025909 Bacteria 1818
115 Ga0207707_10010796 3300025912 Bacteria 7937
116 Ga0207660_10007624 3300025917 Bacteria 7007
117 Ga0207657_10000599 3300025919 Bacteria 38276
118 Ga0207649_10016967 3300025920 Bacteria 4120
119 Ga0207649_10064025 3300025920 Bacteria 2323
120 Ga0207649_10439934 3300025920 Bacteria 982
121 Ga0207652_10002434 3300025921 Bacteria 15717
122 Ga0207652_10104543 3300025921 Bacteria 2505
123 Ga0207652_10109382 3300025921 Bacteria 2450
124 Ga0207681_10000125 3300025923 Bacteria 62866
125 Ga0207681_10000441 3300025923 Bacteria 29051
126 Ga0207681_10000667 3300025923 Bacteria 22714
127 Ga0207644_10000003 3300025931 Bacteria 585905
128 Ga0207644_10012811 3300025931 Bacteria 5576
129 Ga0207644_10020391 3300025931 Bacteria 4507
130 Ga0207690_10004159 3300025932 Bacteria 8550
131 Ga0207690_10032821 3300025932 Bacteria 3334
132 Ga0207706_10015829 3300025933 Bacteria 6820
133 Ga0207706_10023799 3300025933 Bacteria 5495
134 Ga0207706_10185922 3300025933 Bacteria 1824
135 Ga0207670_10175558 3300025936 Bacteria 1610
136 Ga0207711_10095710 3300025941 Bacteria 2619
137 Ga0207711_10358541 3300025941 Bacteria 1350
138 Ga0207711_10543578 3300025941 Bacteria 1083
139 Ga0207661_10414256 3300025944 Bacteria 1223
140 Ga0207679_10041356 3300025945 Bacteria 3305
141 Ga0207667_10004266 3300025949 Bacteria 17545
142 Ga0207667_10005265 3300025949 Bacteria 15779
143 Ga0207667_10148556 3300025949 Bacteria 2412
144 Ga0207667_10439501 3300025949 Bacteria 1326
145 Ga0207668_10021148 3300025972 Bacteria 4146
146 Ga0207640_10237770 3300025981 Bacteria 1405
147 Ga0207658_10000247 3300025986 Bacteria 56367
148 Ga0207658_10011126 3300025986 Bacteria 6127
149 Ga0207658_10011699 3300025986 Bacteria 5975
150 Ga0207658_10140162 3300025986 Bacteria 1955
151 Ga0207703_10003571 3300026035 Bacteria 13000
152 Ga0207703_10015753 3300026035 Bacteria 5897
153 Ga0207703_10477201 3300026035 Bacteria 1168
154 Ga0207639_10008940 3300026041 Bacteria 6894
155 Ga0207678_10105062 3300026067 Bacteria 2410
156 Ga0207702_10010124 3300026078 Bacteria 7900
157 Ga0207641_10000338 3300026088 Bacteria 56937
158 Ga0207641_10002385 3300026088 Bacteria 17328
159 Ga0207641_10871132 3300026088 Bacteria 893
160 Ga0207676_10003392 3300026095 Bacteria 11254
161 Ga0207676_10332294 3300026095 Bacteria 1399
162 Ga0207698_10011878 3300026142 Bacteria 5670
163 Ga0209281_1005318 3300027111 Bacteria 3604
164 Ga0209281_1021911 3300027111 Bacteria 1229
165 Ga0209813_10000013 3300027866 Bacteria 89768
166 Ga0268266_10000212 3300028379 Bacteria 101029
167 Ga0268266_10006062 3300028379 Bacteria 11142
168 Ga0268266_10022516 3300028379 Bacteria 5369
169 Ga0268266_10300167 3300028379 Bacteria 1498
170 Ga0268265_10005043 3300028380 Bacteria 9063
171 Ga0268265_10009009 3300028380 Bacteria 6752
172 Ga0268265_10668084 3300028380 Bacteria 1000
173 Ga0268264_10000078 3300028381 Bacteria 249595
174 Ga0268264_10018259 3300028381 Bacteria 5737
175 Ga0268264_10028843 3300028381 Bacteria 4542
176 Ga0268264_10052997 3300028381 Bacteria 3384
177 Ga0268264_10100812 3300028381 Bacteria 2509
178 Ga0307408_100278734 3300031548 Bacteria 1391
179 Ga0316579_10054247 3300031691 Bacteria 1879
180 Ga0307516_10204732 3300031730 Bacteria 1691
181 Ga0307405_10004030 3300031731 Bacteria 6893
182 Ga0307405_10155969 3300031731 Bacteria 1611
183 Ga0307413_10104404 3300031824 Bacteria 1881
184 Ga0307413_10170822 3300031824 Bacteria 1539
185 Ga0307413_10173464 3300031824 Bacteria 1529
186 Ga0307413_10340346 3300031824 Bacteria 1153
187 Ga0307410_10057890 3300031852 Bacteria 2641
188 Ga0307410_10216144 3300031852 Bacteria 1472
189 Ga0307406_10027127 3300031901 Bacteria 3448
190 Ga0307412_10027755 3300031911 Bacteria 3534
191 Ga0307412_10213379 3300031911 Bacteria 1474
192 Ga0307409_100145140 3300031995 Bacteria 2051
193 Ga0307409_100200922 3300031995 Bacteria 1783
194 Ga0307416_100153954 3300032002 Bacteria 2113
195 Ga0307414_10018159 3300032004 Bacteria 4321
196 Ga0307414_10107767 3300032004 Bacteria 2112
197 Ga0307414_10664506 3300032004 Bacteria 940
198 Ga0307415_100103014 3300032126 Bacteria 2099
199 Ga0316583_10064811 3300032133 Bacteria 1279
200 Ga0373932_0039171 3300035112 Bacteria 1358
201 Ga0316584_0216302 3300036712 Bacteria 1409
202 Ga0439462_0001116 3300042015 Bacteria 5813
203 Ga0450912_000663 3300042116 Bacteria 1811
204 Ga0466957_0521258 3300044842 Bacteria 826
205 Ga0451576_0000007 3300045051 Bacteria 782228
206 Ga0495627_001263 3300046453 Bacteria 15596
207 Ga0495638_0033581 3300046460 Bacteria 3281
208 Ga0495638_0139240 3300046460 Bacteria 1418
209 Ga0495650_0004264 3300046471 Bacteria 9884
210 Ga0495596_0001235 3300046500 Bacteria 14901
211 Ga0495607_0007510 3300046501 Bacteria 7530
212 Ga0495610_0000020 3300046512 Bacteria 344007
213 Ga0495610_0001450 3300046512 Bacteria 20950
214 Ga0495610_0017398 3300046512 Bacteria 4100
215 Ga0495620_0065378 3300046515 Bacteria 1501
216 Ga0495632_0002246 3300046519 Bacteria 14875
217 Ga0495643_0000351 3300046522 Bacteria 62687
218 Ga0495643_0013407 3300046522 Bacteria 4908
219 Ga0495643_0085592 3300046522 Bacteria 1634
220 Ga0495654_0028276 3300046530 Bacteria 2868
221 Ga0495654_0062050 3300046530 Bacteria 1793
222 Ga0495621_0011995 3300046539 Bacteria 2695
223 Ga0495625_0034843 3300046660 Bacteria 3713
224 Ga0495670_0081676 3300046691 Bacteria 1647
225 Ga0495671_0173198 3300046692 Bacteria 1049
226 Ga0495681_0000052 3300047470 Bacteria 106939
227 Ga0495615_0023263 3300048090 Bacteria 1418
228 Ga0495626_0001891 3300048091 Bacteria 15640
229 Ga0496100_0003126 3300048903 Bacteria 8573
230 Ga0496101_0009333 3300048904 Bacteria 6445
231 Ga0496101_0027853 3300048904 Bacteria 3940
232 Ga0496102_0000106 3300048905 Bacteria 118841
233 Ga0496103_0000095 3300048906 Bacteria 98260
234 Ga0496103_0058706 3300048906 Bacteria 2390
235 Ga0496103_0064384 3300048906 Bacteria 2285
236 Ga0496104_0000060 3300048907 Bacteria 117966
237 Ga0496104_0017089 3300048907 Bacteria 6602
238 Ga0496104_0034062 3300048907 Bacteria 4747
239 Ga0496104_0298643 3300048907 Bacteria 1523
240 Ga0496105_0000122 3300048908 Bacteria 52475
241 Ga0496105_0004473 3300048908 Bacteria 10523
242 Ga0496106_0000950 3300048909 Bacteria 21126
243 Ga0496106_0503423 3300048909 Bacteria 973
244 Ga0496107_0004246 3300048910 Bacteria 9682
245 Ga0496107_0046360 3300048910 Bacteria 3129
246 Ga0496109_0015067 3300048912 Bacteria 6729
247 Ga0496110_0436761 3300048913 Bacteria 1193
248 Ga0496111_0125765 3300048914 Bacteria 1895
249 Ga0496111_0241507 3300048914 Bacteria 1341
250 Ga0496112_0040529 3300048915 Bacteria 4554
251 Ga0496112_0248984 3300048915 Bacteria 1728
252 Ga0496113_0000260 3300048916 Bacteria 25008
253 Ga0496113_0015486 3300048916 Bacteria 5243
254 Ga0496114_0059932 3300048917 Bacteria 3180
255 Ga0496115_0295770 3300048918 Bacteria 1327
256 Ga0496116_0000035 3300048919 Bacteria 402424
257 Ga0496116_0045432 3300048919 Bacteria 2973
258 Ga0496117_0014179 3300048920 Bacteria 6889
259 Ga0496117_0147902 3300048920 Bacteria 1395
260 Ga0496118_0002769 3300048921 Bacteria 22965
261 Ga0496118_0038992 3300048921 Bacteria 3798
262 Ga0496118_0045198 3300048921 Bacteria 3441
263 Ga0496119_0000222 3300048922 Bacteria 79824
264 Ga0496120_0000747 3300048923 Bacteria 47215
265 Ga0496121_0000022 3300048924 Bacteria 472849
266 Ga0496121_0000312 3300048924 Bacteria 101230
267 Ga0496121_0004707 3300048924 Bacteria 18061
268 Ga0496121_0013641 3300048924 Bacteria 8711
269 Ga0496122_0010607 3300048925 Bacteria 9464
270 Ga0496122_0015995 3300048925 Bacteria 7133
271 Ga0496123_0003060 3300048926 Bacteria 19222
272 Ga0496123_0013961 3300048926 Bacteria 6690
273 Ga0496123_0018495 3300048926 Bacteria 5540
274 Ga0496124_0001019 3300048927 Bacteria 44416
275 Ga0496124_0004374 3300048927 Bacteria 16529
276 Ga0496124_0050061 3300048927 Bacteria 3561
277 Ga0496125_0011528 3300048928 Bacteria 8832
278 Ga0496125_0011588 3300048928 Bacteria 8808
279 Ga0496125_0057307 3300048928 Bacteria 3156
280 Ga0496126_0000084 3300048929 Bacteria 217111
281 Ga0496126_0000294 3300048929 Bacteria 106327
282 Ga0496126_0006152 3300048929 Bacteria 13445
283 Ga0496126_0093424 3300048929 Bacteria 2641
284 Ga0501036_0356066 3300049572 Bacteria 1222
285 Ga0501037_0066000 3300049573 Bacteria 2637
286 Ga0501039_0181939 3300049575 Bacteria 1653
287 Ga0501047_0329703 3300049581 Bacteria 1365
288 Ga0501224_009522 3300049664 Bacteria 1422
289 Ga0501044_0001521 3300049823 Bacteria 27210
290 nmdc:mga03683_15716_c1 3300050489 Bacteria 2830
291 nmdc:mga03683_16633_c1 3300050489 Bacteria 2767
292 nmdc:mga03683_5315_c1 3300050489 Bacteria 4344
293 nmdc:mga03683_95_c1 3300050489 Bacteria 32187
294 nmdc:mga03n38_15075_c1 3300050490 Bacteria 2978
295 nmdc:mga03n38_741_c1 3300050490 Bacteria 8621
296 nmdc:mga00v17_304846_c1 3300050491 Bacteria 1035
297 nmdc:mga00v17_382_c1 3300050491 Bacteria 25073
298 nmdc:mga00v17_66972_c1 3300050491 Bacteria 2218
299 nmdc:mga0k408_27450_c1 3300050493 Bacteria 3233
300 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
301 nmdc:mga0k408_4850_c1 3300050493 Bacteria 7137
302 nmdc:mga0k408_89116_c1 3300050493 Bacteria 1812
303 nmdc:mga0k408_91830_c1 3300050493 Bacteria 1784
304 nmdc:mga06z11_899_c1 3300050494 Bacteria 10815
305 nmdc:mga04h51_478_c1 3300050495 Bacteria 9586
306 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
307 nmdc:mga07m45_29946_c1 3300050496 Bacteria 3013
308 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
309 nmdc:mga0sz30_409_c1 3300050516 Bacteria 16403
310 nmdc:mga0sz30_860_c1 3300050516 Bacteria 10933
311 Ga0500643_000001 3300053087 Bacteria 1440111
312 Ga0500607_001368 3300053121 Bacteria 22161
313 Ga0500607_003293 3300053121 Bacteria 11891
314 Ga0500608_000758 3300053122 Bacteria 11763
315 Ga0500608_133560 3300053122 Bacteria 1110
316 Ga0500618_005497 3300053125 Bacteria 3840
317 Ga0500618_028572 3300053125 Bacteria 1320
318 Ga0500559_0001235 3300053136 Bacteria 15068
319 Ga0500559_0015413 3300053136 Bacteria 3227
320 Ga0500564_009897 3300053138 Bacteria 4165
321 Ga0500590_028316 3300053148 Bacteria 2907
322 Ga0500604_0032141 3300053151 Bacteria 1545
323 Ga0500616_0006668 3300053153 Bacteria 7506
324 Ga0500622_0009092 3300053156 Bacteria 5516
325 Ga0500637_0015765 3300053178 Bacteria 4015
326 Ga0500567_002323 3300053723 Bacteria 8103
327 Ga0500625_000022 3300053729 Bacteria 78028
328 Ga0501082_0627950 3300060353 Bacteria 940

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10405873 Ga0163163_104058733 240
2 3300046539 Ga0495621_0011995 Ga0495621_0011995_1073_1834 240
3 3300048090 Ga0495615_0023263 Ga0495615_0023263_137_898 240
4 3300005843 Ga0068860_100237295 Ga0068860_1002372952 244
5 3300045051 Ga0451576_0000007 Ga0451576_0000007_503649_504401 244
6 iso_pu_bacteria 2510917021 2511126166 245
7 iso_pu_bacteria 2738541275 2738712521 245
8 iso_pu_bacteria 2738541301 2738850945 245
9 iso_pu_bacteria 2738541304 2738866675 245
10 iso_pu_bacteria 2738543022 2739299192 245
11 iso_pu_bacteria 2738543033 2739360871 245
12 iso_pu_bacteria 2818991438 2819552684 245
13 iso_pu_bacteria 2882806704 2882808163 245
14 iso_pu_bacteria 2895880812 2895883289 245
15 iso_pu_bacteria 2896184354 2896184501 245
16 iso_pu_bacteria 2896253425 2896256620 245
17 iso_pu_bacteria 2919138771 2919139925 245
18 iso_pu_bacteria 2928100450 2928103829 245
19 iso_pu_bacteria 2928959182 2928961758 245
20 iso_pu_bacteria 8054302542 8054302955 245
21 iso_pu_bacteria 3000865235 3000865451 247
22 3300005336 Ga0070680_100083172 Ga0070680_1000831722 248
23 3300005530 Ga0070679_100014264 Ga0070679_1000142644 248
24 3300014326 Ga0157380_10241694 Ga0157380_102416942 248
25 3300025921 Ga0207652_10002434 Ga0207652_1000243412 248
26 3300025921 Ga0207652_10104543 Ga0207652_101045432 248
27 iso_pu_bacteria 2643221588 2643949674 248
28 iso_pu_bacteria 2739367865 2740028895 248
29 2162886007 SwRhRL2b_contig_1691408 SwRhRL2b_0068.00007590 249
30 2162886007 SwRhRL2b_contig_1844621 SwRhRL2b_0644.00000630 249
31 2162886007 SwRhRL2b_contig_3413782 SwRhRL2b_0709.00002080 249
32 3300002459 JGI24751J29686_10000113 JGI24751J29686_1000011321 249
33 3300003791 Ga0055530_10044772 Ga0055530_100447721 249
34 3300005289 Ga0065704_10070220 Ga0065704_1007022026 249
35 3300005289 Ga0065704_10070273 Ga0065704_1007027337 249
36 3300005327 Ga0070658_10019846 Ga0070658_100198463 249
37 3300005327 Ga0070658_10089427 Ga0070658_100894272 249
38 3300005337 Ga0070682_100043129 Ga0070682_1000431294 249
39 3300005339 Ga0070660_100015071 Ga0070660_1000150713 249
40 3300005340 Ga0070689_100153321 Ga0070689_1001533212 249
41 3300005344 Ga0070661_100001958 Ga0070661_10000195810 249
42 3300005344 Ga0070661_100224723 Ga0070661_1002247232 249
43 3300005347 Ga0070668_100039287 Ga0070668_1000392873 249
44 3300005347 Ga0070668_100080051 Ga0070668_1000800512 249
45 3300005347 Ga0070668_100288080 Ga0070668_1002880802 249
46 3300005353 Ga0070669_100000062 Ga0070669_10000006234 249
47 3300005353 Ga0070669_100002282 Ga0070669_1000022827 249
48 3300005353 Ga0070669_100004070 Ga0070669_1000040701 249
49 3300005353 Ga0070669_100201566 Ga0070669_1002015661 249
50 3300005355 Ga0070671_100000117 Ga0070671_10000011751 249
51 3300005355 Ga0070671_100018185 Ga0070671_1000181853 249
52 3300005355 Ga0070671_100028550 Ga0070671_1000285503 249
53 3300005355 Ga0070671_100029973 Ga0070671_1000299735 249
54 3300005366 Ga0070659_100021875 Ga0070659_1000218752 249
55 3300005366 Ga0070659_100363797 Ga0070659_1003637972 249
56 3300005367 Ga0070667_100000261 Ga0070667_10000026160 249
57 3300005367 Ga0070667_100017243 Ga0070667_1000172434 249
58 3300005367 Ga0070667_100017865 Ga0070667_1000178655 249
59 3300005367 Ga0070667_100113230 Ga0070667_1001132303 249
60 3300005367 Ga0070667_100232942 Ga0070667_1002329423 249
61 3300005455 Ga0070663_100077663 Ga0070663_1000776632 249
62 3300005457 Ga0070662_100012000 Ga0070662_1000120007 249
63 3300005457 Ga0070662_100047013 Ga0070662_1000470132 249
64 3300005530 Ga0070679_100013374 Ga0070679_10001337410 249
65 3300005539 Ga0068853_100006137 Ga0068853_10000613710 249
66 3300005544 Ga0070686_100040500 Ga0070686_1000405002 249
67 3300005548 Ga0070665_100000319 Ga0070665_10000031984 249
68 3300005548 Ga0070665_100009816 Ga0070665_1000098165 249
69 3300005548 Ga0070665_100041550 Ga0070665_1000415504 249
70 3300005563 Ga0068855_100001503 Ga0068855_10000150314 249
71 3300005563 Ga0068855_100012513 Ga0068855_10001251310 249
72 3300005564 Ga0070664_100015493 Ga0070664_1000154934 249
73 3300005577 Ga0068857_100126400 Ga0068857_1001264003 249
74 3300005578 Ga0068854_100020859 Ga0068854_1000208593 249
75 3300005578 Ga0068854_100127095 Ga0068854_1001270952 249
76 3300005616 Ga0068852_100053923 Ga0068852_1000539235 249
77 3300005616 Ga0068852_100264697 Ga0068852_1002646972 249
78 3300005617 Ga0068859_100079086 Ga0068859_1000790862 249
79 3300005617 Ga0068859_100212320 Ga0068859_1002123203 249
80 3300005617 Ga0068859_101045496 Ga0068859_1010454961 249
81 3300005618 Ga0068864_100024888 Ga0068864_1000248881 249
82 3300005618 Ga0068864_100051711 Ga0068864_1000517113 249
83 3300005618 Ga0068864_100131807 Ga0068864_1001318072 249
84 3300005841 Ga0068863_100000058 Ga0068863_10000005863 249
85 3300005841 Ga0068863_100017997 Ga0068863_1000179977 249
86 3300005842 Ga0068858_100021669 Ga0068858_1000216694 249
87 3300005843 Ga0068860_100000057 Ga0068860_100000057155 249
88 3300005843 Ga0068860_100014159 Ga0068860_10001415912 249
89 3300005843 Ga0068860_100026686 Ga0068860_1000266865 249
90 3300005843 Ga0068860_100040430 Ga0068860_1000404303 249
91 3300005843 Ga0068860_100173658 Ga0068860_1001736583 249
92 3300005843 Ga0068860_100289137 Ga0068860_1002891372 249
93 3300005844 Ga0068862_100020989 Ga0068862_1000209893 249
94 3300005844 Ga0068862_100036225 Ga0068862_1000362253 249
95 3300006042 Ga0075368_10001005 Ga0075368_100010054 249
96 3300006048 Ga0075363_100000282 Ga0075363_10000028210 249
97 3300006048 Ga0075363_100003405 Ga0075363_1000034053 249
98 3300006051 Ga0075364_10026282 Ga0075364_100262825 249
99 3300006051 Ga0075364_10084544 Ga0075364_100845442 249
100 3300006051 Ga0075364_10178543 Ga0075364_101785432 249
101 3300006058 Ga0075432_10000402 Ga0075432_100004029 249
102 3300006177 Ga0075362_10000096 Ga0075362_100000962 249
103 3300006177 Ga0075362_10020905 Ga0075362_100209054 249
104 3300006178 Ga0075367_10249423 Ga0075367_102494232 249
105 3300006186 Ga0075369_10000872 Ga0075369_100008723 249
106 3300006186 Ga0075369_10040824 Ga0075369_100408241 249
107 3300006195 Ga0075366_10000243 Ga0075366_1000024313 249
108 3300006195 Ga0075366_10016794 Ga0075366_100167942 249
109 3300006195 Ga0075366_10119322 Ga0075366_101193222 249
110 3300006195 Ga0075366_10168311 Ga0075366_101683112 249
111 3300006353 Ga0075370_10000003 Ga0075370_1000000344 249
112 3300006353 Ga0075370_10087120 Ga0075370_100871203 249
113 3300006931 Ga0097620_100079085 Ga0097620_1000790852 249
114 3300006931 Ga0097620_100212302 Ga0097620_1002123022 249
115 3300006931 Ga0097620_101045499 Ga0097620_1010454991 249
116 3300006946 Ga0079104_1034464 Ga0079104_10344642 249
117 3300009011 Ga0105251_10001939 Ga0105251_100019396 249
118 3300009092 Ga0105250_10026697 Ga0105250_100266971 249
119 3300009094 Ga0111539_10877787 Ga0111539_108777871 249
120 3300009177 Ga0105248_10074182 Ga0105248_100741825 249
121 3300009177 Ga0105248_10364549 Ga0105248_103645492 249
122 3300009177 Ga0105248_10507104 Ga0105248_105071041 249
123 3300009553 Ga0105249_10364524 Ga0105249_103645242 249
124 3300011119 Ga0105246_10000150 Ga0105246_1000015014 249
125 3300013102 Ga0157371_10002149 Ga0157371_1000214921 249
126 3300013104 Ga0157370_10008444 Ga0157370_100084442 249
127 3300013105 Ga0157369_10032308 Ga0157369_100323082 249
128 3300013105 Ga0157369_10119611 Ga0157369_101196111 249
129 3300013306 Ga0163162_10031936 Ga0163162_100319365 249
130 3300013307 Ga0157372_10011328 Ga0157372_100113282 249
131 3300013308 Ga0157375_10687207 Ga0157375_106872071 249
132 3300025298 Ga0209050_1000119 Ga0209050_1000119101 249
133 3300025315 Ga0207697_10074593 Ga0207697_100745932 249
134 3300025711 Ga0207696_1016962 Ga0207696_10169622 249
135 3300025735 Ga0207713_1005977 Ga0207713_10059776 249
136 3300025735 Ga0207713_1041441 Ga0207713_10414413 249
137 3300025909 Ga0207705_10138160 Ga0207705_101381602 249
138 3300025912 Ga0207707_10010796 Ga0207707_100107963 249
139 3300025917 Ga0207660_10007624 Ga0207660_100076248 249
140 3300025919 Ga0207657_10000599 Ga0207657_1000059932 249
141 3300025920 Ga0207649_10016967 Ga0207649_100169673 249
142 3300025920 Ga0207649_10064025 Ga0207649_100640253 249
143 3300025920 Ga0207649_10439934 Ga0207649_104399342 249
144 3300025921 Ga0207652_10109382 Ga0207652_101093822 249
145 3300025923 Ga0207681_10000125 Ga0207681_1000012520 249
146 3300025923 Ga0207681_10000441 Ga0207681_100004419 249
147 3300025923 Ga0207681_10000667 Ga0207681_100006677 249
148 3300025931 Ga0207644_10000003 Ga0207644_10000003337 249
149 3300025931 Ga0207644_10012811 Ga0207644_100128115 249
150 3300025931 Ga0207644_10020391 Ga0207644_100203913 249
151 3300025932 Ga0207690_10004159 Ga0207690_100041598 249
152 3300025932 Ga0207690_10032821 Ga0207690_100328212 249
153 3300025933 Ga0207706_10015829 Ga0207706_100158295 249
154 3300025933 Ga0207706_10023799 Ga0207706_100237992 249
155 3300025933 Ga0207706_10185922 Ga0207706_101859221 249
156 3300025936 Ga0207670_10175558 Ga0207670_101755582 249
157 3300025941 Ga0207711_10095710 Ga0207711_100957102 249
158 3300025941 Ga0207711_10358541 Ga0207711_103585412 249
159 3300025941 Ga0207711_10543578 Ga0207711_105435781 249
160 3300025944 Ga0207661_10414256 Ga0207661_104142562 249
161 3300025945 Ga0207679_10041356 Ga0207679_100413562 249
162 3300025949 Ga0207667_10004266 Ga0207667_1000426616 249
163 3300025949 Ga0207667_10005265 Ga0207667_100052658 249
164 3300025949 Ga0207667_10148556 Ga0207667_101485562 249
165 3300025949 Ga0207667_10439501 Ga0207667_104395012 249
166 3300025972 Ga0207668_10021148 Ga0207668_100211484 249
167 3300025981 Ga0207640_10237770 Ga0207640_102377701 249
168 3300025986 Ga0207658_10000247 Ga0207658_1000024717 249
169 3300025986 Ga0207658_10011126 Ga0207658_100111263 249
170 3300025986 Ga0207658_10011699 Ga0207658_100116995 249
171 3300025986 Ga0207658_10140162 Ga0207658_101401622 249
172 3300026035 Ga0207703_10003571 Ga0207703_100035717 249
173 3300026035 Ga0207703_10015753 Ga0207703_100157534 249
174 3300026035 Ga0207703_10477201 Ga0207703_104772011 249
175 3300026041 Ga0207639_10008940 Ga0207639_100089402 249
176 3300026067 Ga0207678_10105062 Ga0207678_101050622 249
177 3300026078 Ga0207702_10010124 Ga0207702_1001012410 249
178 3300026088 Ga0207641_10000338 Ga0207641_1000033827 249
179 3300026088 Ga0207641_10002385 Ga0207641_100023855 249
180 3300026088 Ga0207641_10871132 Ga0207641_108711321 249
181 3300026095 Ga0207676_10003392 Ga0207676_1000339211 249
182 3300026095 Ga0207676_10332294 Ga0207676_103322941 249
183 3300026142 Ga0207698_10011878 Ga0207698_100118786 249
184 3300027111 Ga0209281_1005318 Ga0209281_10053184 249
185 3300027111 Ga0209281_1021911 Ga0209281_10219112 249
186 3300027866 Ga0209813_10000013 Ga0209813_1000001320 249
187 3300028379 Ga0268266_10000212 Ga0268266_1000021233 249
188 3300028379 Ga0268266_10006062 Ga0268266_1000606210 249
189 3300028379 Ga0268266_10022516 Ga0268266_100225167 249
190 3300028379 Ga0268266_10300167 Ga0268266_103001672 249
191 3300028380 Ga0268265_10005043 Ga0268265_100050434 249
192 3300028380 Ga0268265_10009009 Ga0268265_100090094 249
193 3300028380 Ga0268265_10668084 Ga0268265_106680842 249
194 3300028381 Ga0268264_10000078 Ga0268264_1000007836 249
195 3300028381 Ga0268264_10018259 Ga0268264_100182595 249
196 3300028381 Ga0268264_10028843 Ga0268264_100288434 249
197 3300028381 Ga0268264_10052997 Ga0268264_100529973 249
198 3300028381 Ga0268264_10100812 Ga0268264_101008123 249
199 3300031548 Ga0307408_100278734 Ga0307408_1002787341 249
200 3300031691 Ga0316579_10054247 Ga0316579_100542472 249
201 3300031730 Ga0307516_10204732 Ga0307516_102047321 249
202 3300031731 Ga0307405_10004030 Ga0307405_100040303 249
203 3300031731 Ga0307405_10155969 Ga0307405_101559693 249
204 3300031824 Ga0307413_10104404 Ga0307413_101044041 249
205 3300031824 Ga0307413_10170822 Ga0307413_101708222 249
206 3300031824 Ga0307413_10173464 Ga0307413_101734642 249
207 3300031824 Ga0307413_10340346 Ga0307413_103403461 249
208 3300031852 Ga0307410_10057890 Ga0307410_100578902 249
209 3300031852 Ga0307410_10216144 Ga0307410_102161442 249
210 3300031901 Ga0307406_10027127 Ga0307406_100271274 249
211 3300031911 Ga0307412_10027755 Ga0307412_100277552 249
212 3300031911 Ga0307412_10213379 Ga0307412_102133792 249
213 3300031995 Ga0307409_100145140 Ga0307409_1001451402 249
214 3300031995 Ga0307409_100200922 Ga0307409_1002009223 249
215 3300032002 Ga0307416_100153954 Ga0307416_1001539541 249
216 3300032004 Ga0307414_10018159 Ga0307414_100181594 249
217 3300032004 Ga0307414_10107767 Ga0307414_101077673 249
218 3300032004 Ga0307414_10664506 Ga0307414_106645062 249
219 3300032126 Ga0307415_100103014 Ga0307415_1001030144 249
220 3300032133 Ga0316583_10064811 Ga0316583_100648112 249
221 3300035112 Ga0373932_0039171 Ga0373932_0039171_296_1045 249
222 3300036712 Ga0316584_0216302 Ga0316584_0216302_110_862 249
223 3300042015 Ga0439462_0001116 Ga0439462_0001116_441_1202 249
224 3300042116 Ga0450912_000663 Ga0450912_000663_115_867 249
225 3300044842 Ga0466957_0521258 Ga0466957_0521258_29_778 249
226 3300046453 Ga0495627_001263 Ga0495627_001263_2240_2989 249
227 3300046460 Ga0495638_0033581 Ga0495638_0033581_2321_3070 249
228 3300046460 Ga0495638_0139240 Ga0495638_0139240_325_1077 249
229 3300046471 Ga0495650_0004264 Ga0495650_0004264_2095_2844 249
230 3300046500 Ga0495596_0001235 Ga0495596_0001235_2058_2813 249
231 3300046501 Ga0495607_0007510 Ga0495607_0007510_2218_2967 249
232 3300046512 Ga0495610_0000020 Ga0495610_0000020_70666_71415 249
233 3300046512 Ga0495610_0001450 Ga0495610_0001450_311_1066 249
234 3300046512 Ga0495610_0017398 Ga0495610_0017398_2032_2781 249
235 3300046515 Ga0495620_0065378 Ga0495620_0065378_741_1490 249
236 3300046519 Ga0495632_0002246 Ga0495632_0002246_11897_12646 249
237 3300046522 Ga0495643_0000351 Ga0495643_0000351_11655_12404 249
238 3300046522 Ga0495643_0013407 Ga0495643_0013407_2384_3133 249
239 3300046522 Ga0495643_0085592 Ga0495643_0085592_586_1341 249
240 3300046530 Ga0495654_0028276 Ga0495654_0028276_582_1331 249
241 3300046530 Ga0495654_0062050 Ga0495654_0062050_524_1273 249
242 3300046660 Ga0495625_0034843 Ga0495625_0034843_2063_2812 249
243 3300046691 Ga0495670_0081676 Ga0495670_0081676_646_1395 249
244 3300046692 Ga0495671_0173198 Ga0495671_0173198_286_1035 249
245 3300047470 Ga0495681_0000052 Ga0495681_0000052_12631_13380 249
246 3300048091 Ga0495626_0001891 Ga0495626_0001891_2475_3230 249
247 3300048903 Ga0496100_0003126 Ga0496100_0003126_6422_7180 249
248 3300048904 Ga0496101_0009333 Ga0496101_0009333_1217_1975 249
249 3300048904 Ga0496101_0027853 Ga0496101_0027853_3094_3843 249
250 3300048905 Ga0496102_0000106 Ga0496102_0000106_20837_21586 249
251 3300048906 Ga0496103_0000095 Ga0496103_0000095_82443_83192 249
252 3300048906 Ga0496103_0058706 Ga0496103_0058706_1444_2202 249
253 3300048906 Ga0496103_0064384 Ga0496103_0064384_25_783 249
254 3300048907 Ga0496104_0000060 Ga0496104_0000060_67350_68099 249
255 3300048907 Ga0496104_0017089 Ga0496104_0017089_3888_4646 249
256 3300048907 Ga0496104_0034062 Ga0496104_0034062_2062_2811 249
257 3300048907 Ga0496104_0298643 Ga0496104_0298643_202_951 249
258 3300048908 Ga0496105_0000122 Ga0496105_0000122_19532_20281 249
259 3300048908 Ga0496105_0004473 Ga0496105_0004473_8157_8906 249
260 3300048909 Ga0496106_0000950 Ga0496106_0000950_16132_16890 249
261 3300048909 Ga0496106_0503423 Ga0496106_0503423_33_782 249
262 3300048910 Ga0496107_0004246 Ga0496107_0004246_2277_3035 249
263 3300048910 Ga0496107_0046360 Ga0496107_0046360_1792_2541 249
264 3300048912 Ga0496109_0015067 Ga0496109_0015067_1128_1886 249
265 3300048913 Ga0496110_0436761 Ga0496110_0436761_136_1080 249
266 3300048914 Ga0496111_0125765 Ga0496111_0125765_888_1637 249
267 3300048914 Ga0496111_0241507 Ga0496111_0241507_529_1287 249
268 3300048915 Ga0496112_0040529 Ga0496112_0040529_1983_2732 249
269 3300048915 Ga0496112_0248984 Ga0496112_0248984_325_1083 249
270 3300048916 Ga0496113_0000260 Ga0496113_0000260_6750_7508 249
271 3300048916 Ga0496113_0015486 Ga0496113_0015486_2632_3381 249
272 3300048917 Ga0496114_0059932 Ga0496114_0059932_755_1516 249
273 3300048918 Ga0496115_0295770 Ga0496115_0295770_362_1111 249
274 3300048919 Ga0496116_0000035 Ga0496116_0000035_51453_52202 249
275 3300048919 Ga0496116_0045432 Ga0496116_0045432_1406_2164 249
276 3300048920 Ga0496117_0014179 Ga0496117_0014179_197_946 249
277 3300048920 Ga0496117_0147902 Ga0496117_0147902_231_980 249
278 3300048921 Ga0496118_0002769 Ga0496118_0002769_6377_7126 249
279 3300048921 Ga0496118_0038992 Ga0496118_0038992_1631_2380 249
280 3300048921 Ga0496118_0045198 Ga0496118_0045198_1298_2047 249
281 3300048922 Ga0496119_0000222 Ga0496119_0000222_47976_48725 249
282 3300048923 Ga0496120_0000747 Ga0496120_0000747_43548_44297 249
283 3300048924 Ga0496121_0000022 Ga0496121_0000022_172911_173660 249
284 3300048924 Ga0496121_0000312 Ga0496121_0000312_99612_100361 249
285 3300048924 Ga0496121_0004707 Ga0496121_0004707_14633_15382 249
286 3300048924 Ga0496121_0013641 Ga0496121_0013641_4092_4841 249
287 3300048925 Ga0496122_0010607 Ga0496122_0010607_5527_6276 249
288 3300048925 Ga0496122_0015995 Ga0496122_0015995_3720_4469 249
289 3300048926 Ga0496123_0003060 Ga0496123_0003060_12642_13391 249
290 3300048926 Ga0496123_0013961 Ga0496123_0013961_2665_3414 249
291 3300048926 Ga0496123_0018495 Ga0496123_0018495_2077_2826 249
292 3300048927 Ga0496124_0001019 Ga0496124_0001019_6152_6901 249
293 3300048927 Ga0496124_0004374 Ga0496124_0004374_551_1300 249
294 3300048927 Ga0496124_0050061 Ga0496124_0050061_2594_3343 249
295 3300048928 Ga0496125_0011528 Ga0496125_0011528_2660_3409 249
296 3300048928 Ga0496125_0011588 Ga0496125_0011588_7612_8370 249
297 3300048928 Ga0496125_0057307 Ga0496125_0057307_1842_2591 249
298 3300048929 Ga0496126_0000084 Ga0496126_0000084_181802_182551 249
299 3300048929 Ga0496126_0000294 Ga0496126_0000294_9278_10027 249
300 3300048929 Ga0496126_0006152 Ga0496126_0006152_3279_4028 249
301 3300048929 Ga0496126_0093424 Ga0496126_0093424_394_1152 249
302 3300049572 Ga0501036_0356066 Ga0501036_0356066_313_1065 249
303 3300049573 Ga0501037_0066000 Ga0501037_0066000_1816_2574 249
304 3300049575 Ga0501039_0181939 Ga0501039_0181939_721_1479 249
305 3300049581 Ga0501047_0329703 Ga0501047_0329703_113_862 249
306 3300049664 Ga0501224_009522 Ga0501224_009522_20_769 249
307 3300049823 Ga0501044_0001521 Ga0501044_0001521_5067_5825 249
308 3300050489 nmdc:mga03683_15716_c1 nmdc:mga03683_15716_c1_78_836 249
309 3300050489 nmdc:mga03683_16633_c1 nmdc:mga03683_16633_c1_954_1712 249
310 3300050489 nmdc:mga03683_5315_c1 nmdc:mga03683_5315_c1_3295_4044 249
311 3300050489 nmdc:mga03683_95_c1 nmdc:mga03683_95_c1_26638_27387 249
312 3300050490 nmdc:mga03n38_15075_c1 nmdc:mga03n38_15075_c1_1157_1906 249
313 3300050490 nmdc:mga03n38_741_c1 nmdc:mga03n38_741_c1_7618_8376 249
314 3300050491 nmdc:mga00v17_304846_c1 nmdc:mga00v17_304846_c1_32_790 249
315 3300050491 nmdc:mga00v17_382_c1 nmdc:mga00v17_382_c1_1716_2465 249
316 3300050491 nmdc:mga00v17_66972_c1 nmdc:mga00v17_66972_c1_971_1729 249
317 3300050493 nmdc:mga0k408_27450_c1 nmdc:mga0k408_27450_c1_1626_2375 249
318 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_154930_155679 249
319 3300050493 nmdc:mga0k408_4850_c1 nmdc:mga0k408_4850_c1_1208_1957 249
320 3300050493 nmdc:mga0k408_89116_c1 nmdc:mga0k408_89116_c1_779_1537 249
321 3300050493 nmdc:mga0k408_91830_c1 nmdc:mga0k408_91830_c1_327_1076 249
322 3300050494 nmdc:mga06z11_899_c1 nmdc:mga06z11_899_c1_7696_8583 249
323 3300050495 nmdc:mga04h51_478_c1 nmdc:mga04h51_478_c1_846_1733 249
324 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_137235_138122 249
325 3300050496 nmdc:mga07m45_29946_c1 nmdc:mga07m45_29946_c1_2044_2793 249
326 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_90875_91624 249
327 3300050516 nmdc:mga0sz30_409_c1 nmdc:mga0sz30_409_c1_15363_16121 249
328 3300050516 nmdc:mga0sz30_860_c1 nmdc:mga0sz30_860_c1_8470_9219 249
329 3300053087 Ga0500643_000001 Ga0500643_000001_917661_918413 249
330 3300053121 Ga0500607_001368 Ga0500607_001368_2026_2775 249
331 3300053121 Ga0500607_003293 Ga0500607_003293_7600_8358 249
332 3300053122 Ga0500608_000758 Ga0500608_000758_9774_10532 249
333 3300053122 Ga0500608_133560 Ga0500608_133560_165_914 249
334 3300053125 Ga0500618_005497 Ga0500618_005497_1779_2528 249
335 3300053125 Ga0500618_028572 Ga0500618_028572_421_1170 249
336 3300053136 Ga0500559_0001235 Ga0500559_0001235_2026_2775 249
337 3300053136 Ga0500559_0015413 Ga0500559_0015413_626_1375 249
338 3300053138 Ga0500564_009897 Ga0500564_009897_1592_2350 249
339 3300053148 Ga0500590_028316 Ga0500590_028316_696_1445 249
340 3300053151 Ga0500604_0032141 Ga0500604_0032141_26_775 249
341 3300053153 Ga0500616_0006668 Ga0500616_0006668_581_1333 249
342 3300053156 Ga0500622_0009092 Ga0500622_0009092_4391_5140 249
343 3300053178 Ga0500637_0015765 Ga0500637_0015765_51_800 249
344 3300053723 Ga0500567_002323 Ga0500567_002323_1668_2426 249
345 3300053729 Ga0500625_000022 Ga0500625_000022_1821_2579 249
346 3300060353 Ga0501082_0627950 Ga0501082_0627950_148_897 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

58

237

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xmk-assembly1.cif.gz_M cryo-em structure of the atp-bound vps4 mutant-e233q complex with vta1 (masked) 0.8033 24 60
7rdh-assembly1.cif.gz_H crystal structure of the de novo designed binding protein h3mb in complex with the 1968 influenza a virus hemagglutinin 0.8004 24 58
6oo2-assembly1.cif.gz_P vps4 with cyclic peptide bound in the central pore 0.7888 22 60
6oo2-assembly1.cif.gz_P vps4 with cyclic peptide bound in the central pore 0.7453 22 60
8bpo-assembly1.cif.gz_g2 structure of rabbit 80s ribosome translating beta-tubulin in complex with tetratricopeptide protein 5 (ttc5) and s-phase cyclin a associated protein residing in the er (scaper) 0.6322 27 60
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.936 61 236 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8947 61 236 2.70.70.10
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8189 24 58 1.20.1260.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8095 56 236 2.70.70.10
3mhvA00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.8085 24 60 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A3D3JDM5-F1-model_v4 deleted 0.9401 75 241
AF-A0A1A3DMM6-F1-model_v4 Phosphatidylserine decarboxylase 0.9373 72 238 GO:0004609
GO:0005886
GO:0008654
AF-A0A3D5QZE4-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9365 122 238 GO:0004609
GO:0005886
GO:0008654
AF-A0A656KSX9-F1-model_v4 deleted 0.9363 76 238
AF-A0A7Z9S1G0-F1-model_v4 Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) 0.9358 127 238 GO:0004609
GO:0005886
GO:0008654

Feature Viewer

pLDDT pTM Quality
80.7 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map