F416810

General Info

Members Datasets Scaffolds Average Seq Length
346 221 692 127

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10020048|Ga0316575_100200485
Length 168
Sequence MSAAAPTTPPTPSIARRLASMLYEAFVLAAIAFFAGSLFLLASTGQPASGLLRFALQLYLLAVFAAYFLWCWLRGGQTLPMRAWRIRLVAPGRARVPPRVALLRFVYATLFIGSFVASIAAAFVHRNPLLAFASLALTGISIGWALVDRDGQFLHDRLAGTRLIQVDK

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 0.29
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10020048 3300031665 Bacteria 2562
2 JGI25151J46595_10003261 3300003187 Bacteria 9022
3 rootL2_10257370 3300003322 Bacteria 1283
4 Ga0055526_1008407 3300003771 Bacteria 5159
5 Ga0055534_1003054 3300003784 Bacteria 5480
6 Ga0070683_100151473 3300005329 Bacteria 2199
7 Ga0070690_100000242 3300005330 Bacteria 28065
8 Ga0070690_100294492 3300005330 Bacteria 1162
9 Ga0070690_100529195 3300005330 Bacteria 886
10 Ga0070690_100627939 3300005330 Bacteria 818
11 Ga0068869_100000383 3300005334 Bacteria 24002
12 Ga0070666_11066807 3300005335 Bacteria 600
13 Ga0070680_100043551 3300005336 Bacteria 3646
14 Ga0070680_100749913 3300005336 Bacteria 841
15 Ga0070682_100072430 3300005337 Bacteria 2208
16 Ga0070682_100369470 3300005337 Bacteria 1075
17 Ga0068868_100000919 3300005338 Bacteria 20028
18 Ga0068868_100607083 3300005338 Bacteria 970
19 Ga0070689_100003789 3300005340 Bacteria 10127
20 Ga0070689_100246514 3300005340 Bacteria 1473
21 Ga0070691_10002942 3300005341 Bacteria 7636
22 Ga0070691_10030916 3300005341 Bacteria 2510
23 Ga0070687_100000648 3300005343 Bacteria 11529
24 Ga0070687_100959485 3300005343 Bacteria 617
25 Ga0070692_10006543 3300005345 Bacteria 5068
26 Ga0070692_10313001 3300005345 Bacteria 962
27 Ga0070669_100482406 3300005353 Bacteria 1026
28 Ga0070675_100178598 3300005354 Bacteria 1834
29 Ga0070675_101307613 3300005354 Bacteria 668
30 Ga0070671_100090064 3300005355 Bacteria 2568
31 Ga0070673_100245468 3300005364 Bacteria 1558
32 Ga0070667_100171453 3300005367 Bacteria 1916
33 Ga0070703_10006696 3300005406 Bacteria 3228
34 Ga0070703_10125314 3300005406 Bacteria 937
35 Ga0070714_100265838 3300005435 Bacteria 1589
36 Ga0070710_10377436 3300005437 Bacteria 945
37 Ga0070701_10003758 3300005438 Bacteria 6066
38 Ga0070701_10067007 3300005438 Bacteria 1909
39 Ga0070705_100001620 3300005440 Bacteria 11791
40 Ga0070705_100216811 3300005440 Bacteria 1323
41 Ga0070700_100036714 3300005441 Bacteria 2975
42 Ga0070700_100420672 3300005441 Bacteria 1009
43 Ga0070694_100030194 3300005444 Bacteria 3543
44 Ga0070694_100181625 3300005444 Unclassified 1557
45 Ga0070694_100324509 3300005444 Bacteria 1186
46 Ga0070694_100425549 3300005444 Bacteria 1044
47 Ga0070708_100075175 3300005445 Bacteria 3049
48 Ga0070678_100340087 3300005456 Bacteria 1287
49 Ga0070662_100055766 3300005457 Bacteria 2868
50 Ga0070681_10042709 3300005458 Bacteria 4542
51 Ga0068867_100005706 3300005459 Bacteria 8825
52 Ga0070685_10581711 3300005466 Unclassified 803
53 Ga0070707_100983483 3300005468 Bacteria 809
54 Ga0070699_100011061 3300005518 Bacteria 7804
55 Ga0070699_100056618 3300005518 Bacteria 3395
56 Ga0070679_100020509 3300005530 Bacteria 6445
57 Ga0070679_100082388 3300005530 Bacteria 3207
58 Ga0070679_100516653 3300005530 Bacteria 1138
59 Ga0070697_100030857 3300005536 Bacteria 4307
60 Ga0070697_100849678 3300005536 Unclassified 809
61 Ga0070697_101363650 3300005536 Unclassified 633
62 Ga0068853_100094925 3300005539 Bacteria 2629
63 Ga0070686_100000440 3300005544 Bacteria 25874
64 Ga0070686_100181443 3300005544 Bacteria 1496
65 Ga0070686_100547216 3300005544 Bacteria 905
66 Ga0070686_100549628 3300005544 Bacteria 903
67 Ga0070695_100005814 3300005545 Bacteria 7270
68 Ga0070695_100016813 3300005545 Bacteria 4432
69 Ga0070695_100095544 3300005545 Bacteria 1992
70 Ga0070695_100103549 3300005545 Bacteria 1920
71 Ga0070695_100831975 3300005545 Bacteria 742
72 Ga0070695_101546907 3300005545 Bacteria 553
73 Ga0070696_100000717 3300005546 Bacteria 21181
74 Ga0070696_100006018 3300005546 Bacteria 8093
75 Ga0070696_100007266 3300005546 Bacteria 7392
76 Ga0070696_100080694 3300005546 Bacteria 2304
77 Ga0070696_100282312 3300005546 Bacteria 1266
78 Ga0070696_100540049 3300005546 Bacteria 933
79 Ga0070696_100693017 3300005546 Bacteria 830
80 Ga0070693_100002416 3300005547 Bacteria 8594
81 Ga0070693_100293242 3300005547 Unclassified 1093
82 Ga0070693_100506282 3300005547 Bacteria 857
83 Ga0070693_101185091 3300005547 Bacteria 586
84 Ga0070704_100000205 3300005549 Bacteria 24552
85 Ga0070704_101081003 3300005549 Bacteria 728
86 Ga0068855_100002240 3300005563 Bacteria 23909
87 Ga0068854_100005248 3300005578 Bacteria 8174
88 Ga0068856_100112138 3300005614 Bacteria 2725
89 Ga0068856_100439411 3300005614 Bacteria 1325
90 Ga0070702_100001872 3300005615 Bacteria 8802
91 Ga0070702_100087159 3300005615 Bacteria 1885
92 Ga0068859_100001225 3300005617 Bacteria 26177
93 Ga0068859_100079964 3300005617 Bacteria 3310
94 Ga0068859_102718349 3300005617 Bacteria 544
95 Ga0068864_100035331 3300005618 Bacteria 4255
96 Ga0068864_100066813 3300005618 Bacteria 3122
97 Ga0068866_10001783 3300005718 Bacteria 9062
98 Ga0068866_10618621 3300005718 Bacteria 733
99 Ga0068861_100000491 3300005719 Bacteria 22991
100 Ga0068861_101393424 3300005719 Bacteria 684
101 Ga0068870_10034716 3300005840 Bacteria 2582
102 Ga0068870_10819622 3300005840 Bacteria 652
103 Ga0068858_100010952 3300005842 Bacteria 8570
104 Ga0068860_100012962 3300005843 Bacteria 8188
105 Ga0068860_100415360 3300005843 Bacteria 1333
106 Ga0068860_100632034 3300005843 Bacteria 1078
107 Ga0068862_100002102 3300005844 Bacteria 17947
108 Ga0081539_10001221 3300005985 Bacteria 45911
109 Ga0070715_10143227 3300006163 Bacteria 1163
110 Ga0070716_100032895 3300006173 Bacteria 2833
111 Ga0097621_100006839 3300006237 Bacteria 8107
112 Ga0097621_101032014 3300006237 Bacteria 770
113 Ga0068871_100002641 3300006358 Bacteria 12242
114 Ga0075428_100164414 3300006844 Bacteria 2407
115 Ga0075431_100005372 3300006847 Bacteria 12648
116 Ga0075433_10011678 3300006852 Bacteria 7072
117 Ga0075433_10091273 3300006852 Bacteria 2692
118 Ga0075433_10205502 3300006852 Bacteria 1751
119 Ga0075434_100000013 3300006871 Bacteria 83380
120 Ga0075434_100001497 3300006871 Bacteria 19730
121 Ga0075434_100641860 3300006871 Bacteria 1080
122 Ga0075429_100018892 3300006880 Bacteria 5971
123 Ga0075429_100029842 3300006880 Bacteria 4736
124 Ga0068865_100000760 3300006881 Bacteria 18094
125 Ga0068865_100226918 3300006881 Bacteria 1463
126 Ga0075436_100000342 3300006914 Bacteria 29761
127 Ga0075436_100000344 3300006914 Bacteria 29639
128 Ga0075436_100009901 3300006914 Bacteria 6518
129 Ga0075436_100019198 3300006914 Bacteria 4684
130 Ga0075436_100053851 3300006914 Bacteria 2777
131 Ga0075436_100101980 3300006914 Unclassified 1999
132 Ga0075436_100317909 3300006914 Bacteria 1118
133 Ga0075436_100325528 3300006914 Bacteria 1104
134 Ga0075436_100368227 3300006914 Unclassified 1038
135 Ga0097620_100001225 3300006931 Bacteria 26177
136 Ga0097620_100079966 3300006931 Bacteria 3310
137 Ga0097620_102717075 3300006931 Bacteria 544
138 Ga0075435_100000775 3300007076 Bacteria 19808
139 Ga0075435_100002732 3300007076 Bacteria 11780
140 Ga0075435_100010646 3300007076 Bacteria 6732
141 Ga0075435_100200621 3300007076 Bacteria 1690
142 Ga0075435_100203096 3300007076 Bacteria 1679
143 Ga0105250_10201984 3300009092 Bacteria 838
144 Ga0105240_11223736 3300009093 Bacteria 794
145 Ga0111539_10059742 3300009094 Bacteria 4520
146 Ga0111539_11304122 3300009094 Bacteria 843
147 Ga0111539_11485441 3300009094 Bacteria 786
148 Ga0105245_10000821 3300009098 Bacteria 28312
149 Ga0114129_10122978 3300009147 Bacteria 3570
150 Ga0114129_10346983 3300009147 Bacteria 1967
151 Ga0114129_11875850 3300009147 Bacteria 727
152 Ga0114129_12403484 3300009147 Unclassified 631
153 Ga0105243_10001858 3300009148 Bacteria 18028
154 Ga0105241_10059161 3300009174 Bacteria 2945
155 Ga0105242_10005729 3300009176 Bacteria 9578
156 Ga0105248_10481629 3300009177 Bacteria 1399
157 Ga0105248_10693567 3300009177 Bacteria 1149
158 Ga0105249_10000348 3300009553 Bacteria 46377
159 Ga0105239_10126507 3300010375 Bacteria 2840
160 Ga0105239_10992578 3300010375 Bacteria 965
161 Ga0105246_10210219 3300011119 Bacteria 1518
162 Ga0157371_10454462 3300013102 Bacteria 942
163 Ga0157369_11171722 3300013105 Unclassified 785
164 Ga0157378_10008721 3300013297 Bacteria 8825
165 Ga0157380_11376381 3300014326 Bacteria 755
166 Ga0157376_10035632 3300014969 Bacteria 4026
167 Ga0207653_10001993 3300025885 Bacteria 6525
168 Ga0207642_10001303 3300025899 Bacteria 7721
169 Ga0207685_10009435 3300025905 Bacteria 2835
170 Ga0207643_10011696 3300025908 Bacteria 4741
171 Ga0207654_10049254 3300025911 Bacteria 2415
172 Ga0207707_10001611 3300025912 Bacteria 20789
173 Ga0207707_10598626 3300025912 Bacteria 933
174 Ga0207660_10171541 3300025917 Bacteria 1679
175 Ga0207662_10000223 3300025918 Bacteria 26281
176 Ga0207662_10083563 3300025918 Bacteria 1952
177 Ga0207662_10768000 3300025918 Bacteria 678
178 Ga0207652_10034357 3300025921 Bacteria 4273
179 Ga0207652_10073021 3300025921 Bacteria 2984
180 Ga0207652_10587598 3300025921 Bacteria 999
181 Ga0207681_10397623 3300025923 Bacteria 1112
182 Ga0207659_10435048 3300025926 Bacteria 1102
183 Ga0207687_10006759 3300025927 Bacteria 7557
184 Ga0207687_10779878 3300025927 Bacteria 814
185 Ga0207664_10202933 3300025929 Bacteria 1712
186 Ga0207644_10063060 3300025931 Bacteria 2690
187 Ga0207706_10073550 3300025933 Bacteria 3005
188 Ga0207686_10000347 3300025934 Bacteria 33269
189 Ga0207709_10000980 3300025935 Bacteria 21307
190 Ga0207670_10000857 3300025936 Bacteria 15990
191 Ga0207670_10053905 3300025936 Bacteria 2711
192 Ga0207704_10001469 3300025938 Bacteria 10542
193 Ga0207665_10049917 3300025939 Bacteria 2813
194 Ga0207691_10073489 3300025940 Bacteria 3084
195 Ga0207689_10005776 3300025942 Bacteria 10987
196 Ga0207661_10112276 3300025944 Bacteria 2307
197 Ga0207667_10012884 3300025949 Bacteria 9607
198 Ga0207651_10733480 3300025960 Bacteria 872
199 Ga0207651_11133245 3300025960 Bacteria 701
200 Ga0207712_10007202 3300025961 Bacteria 7016
201 Ga0207640_10004651 3300025981 Bacteria 7448
202 Ga0207677_10002066 3300026023 Bacteria 10574
203 Ga0207703_10004206 3300026035 Bacteria 11866
204 Ga0207639_10054780 3300026041 Bacteria 3050
205 Ga0207639_10755295 3300026041 Bacteria 904
206 Ga0207708_10043792 3300026075 Bacteria 3411
207 Ga0207708_10984600 3300026075 Bacteria 732
208 Ga0207702_10052130 3300026078 Bacteria 3461
209 Ga0207702_10364474 3300026078 Bacteria 1386
210 Ga0207641_10982713 3300026088 Bacteria 840
211 Ga0207648_10001327 3300026089 Bacteria 27511
212 Ga0207648_11975414 3300026089 Unclassified 545
213 Ga0207676_10008837 3300026095 Bacteria 7169
214 Ga0207675_100000334 3300026118 Bacteria 45029
215 Ga0207675_100963462 3300026118 Bacteria 871
216 Ga0207683_10405973 3300026121 Bacteria 1254
217 Ga0209995_1010077 3300027471 Bacteria 1530
218 Ga0207428_10348585 3300027907 Bacteria 1090
219 Ga0207428_10386106 3300027907 Bacteria 1027
220 Ga0268265_10001658 3300028380 Bacteria 18219
221 Ga0268264_10008988 3300028381 Bacteria 8289
222 Ga0265329_10120324 3300031242 Bacteria 842
223 Ga0307408_100034817 3300031548 Bacteria 3530
224 Ga0307408_100470030 3300031548 Bacteria 1095
225 Ga0307408_100529085 3300031548 Bacteria 1037
226 Ga0307405_10785861 3300031731 Bacteria 796
227 Ga0307416_102094089 3300032002 Bacteria 668
228 Ga0307411_10047251 3300032005 Bacteria 2782
229 Ga0373930_0026954 3300034816 Bacteria 1161
230 Ga0373959_0141182 3300034820 Bacteria 603
231 Ga0373940_0363408 3300035088 Bacteria 510
232 Ga0373944_0007324 3300035089 Bacteria 2953
233 Ga0373951_0203713 3300035091 Bacteria 577
234 Ga0373952_0025679 3300035092 Bacteria 1274
235 Ga0373923_0102946 3300035111 Bacteria 1261
236 Ga0373941_0531455 3300035115 Bacteria 504
237 Ga0373945_0007771 3300035116 Bacteria 3479
238 Ga0373960_0152640 3300035121 Bacteria 790
239 Ga0373943_0179613 3300035170 Bacteria 1162
240 Ga0373946_0017092 3300035171 Bacteria 2771
241 Ga0373955_0079573 3300035172 Bacteria 1849
242 Ga0373961_0446336 3300035241 Bacteria 504
243 Ga0373962_0249940 3300035242 Bacteria 615
244 Ga0316574_0000711 3300035398 Bacteria 14209
245 Ga0373924_0007771 3300035410 Bacteria 3878
246 Ga0373924_0254372 3300035410 Bacteria 778
247 Ga0373931_0052502 3300035691 Bacteria 2173
248 Ga0373931_0189174 3300035691 Bacteria 1224
249 Ga0373935_0249101 3300035692 Bacteria 1242
250 Ga0373927_0016369 3300035695 Bacteria 4891
251 Ga0373925_0372174 3300037068 Bacteria 1162
252 Ga0439436_0041605 3300041404 Bacteria 1315
253 Ga0439452_050715 3300042010 Bacteria 951
254 Ga0451577_0844235 3300042876 Bacteria 826
255 Ga0453684_0029995 3300044712 Bacteria 7699
256 Ga0451576_1098231 3300045051 Bacteria 832
257 Ga0451576_1340568 3300045051 Bacteria 745
258 Ga0495603_0059260 3300046455 Bacteria 2263
259 Ga0495580_0093186 3300046472 Bacteria 2096
260 Ga0495582_0027363 3300046473 Bacteria 3125
261 Ga0495639_0006183 3300046475 Bacteria 5140
262 Ga0495639_0045019 3300046475 Bacteria 1996
263 Ga0495662_0022897 3300046476 Bacteria 3015
264 Ga0495594_0064992 3300046499 Bacteria 2023
265 Ga0495666_0008435 3300046526 Bacteria 5168
266 Ga0495642_0013922 3300046528 Bacteria 3115
267 Ga0495665_0019217 3300046531 Bacteria 3673
268 Ga0495640_0266962 3300046533 Bacteria 1068
269 Ga0495586_0017722 3300046535 Bacteria 3788
270 Ga0495586_0020253 3300046535 Bacteria 3543
271 Ga0495598_0045477 3300046537 Bacteria 1301
272 Ga0495621_0009182 3300046539 Bacteria 2994
273 Ga0495621_0182838 3300046539 Bacteria 837
274 Ga0495634_0256451 3300046642 Bacteria 1068
275 Ga0495635_0329939 3300046663 Bacteria 1020
276 Ga0495659_0054763 3300046664 Bacteria 1460
277 Ga0495588_0042420 3300046674 Bacteria 2326
278 Ga0495647_0002134 3300046681 Bacteria 6182
279 Ga0495658_0005270 3300046683 Bacteria 6364
280 Ga0495669_0016925 3300046684 Bacteria 3127
281 Ga0495624_0239453 3300046690 Bacteria 1098
282 Ga0495581_0007619 3300047315 Bacteria 6262
283 Ga0495674_0518412 3300047319 Unclassified 952
284 Ga0495676_0137359 3300047321 Bacteria 1756
285 Ga0495593_0123170 3300047673 Bacteria 1319
286 Ga0496106_0820440 3300048909 Bacteria 737
287 Ga0501296_006413 3300049519 Bacteria 1333
288 Ga0501036_0296500 3300049572 Bacteria 1352
289 Ga0501038_0024969 3300049574 Bacteria 5329
290 Ga0501039_0085095 3300049575 Bacteria 2463
291 Ga0501040_0163042 3300049576 Bacteria 1576
292 Ga0501040_0843546 3300049576 Bacteria 663
293 Ga0501041_0050321 3300049577 Bacteria 2539
294 Ga0501042_0246413 3300049578 Bacteria 1289
295 Ga0501043_1131262 3300049579 Bacteria 552
296 Ga0501048_0022101 3300049582 Bacteria 4655
297 Ga0501067_0247776 3300049583 Bacteria 992
298 Ga0501068_0820008 3300049584 Bacteria 610
299 Ga0501071_0030468 3300049587 Bacteria 3816
300 Ga0501072_0047319 3300049588 Bacteria 3387
301 Ga0501074_0041431 3300049590 Bacteria 3334
302 Ga0501074_0540858 3300049590 Bacteria 825
303 Ga0501075_0051539 3300049591 Bacteria 3094
304 Ga0501076_0002166 3300049592 Bacteria 13470
305 Ga0501077_0153507 3300049593 Bacteria 1461
306 Ga0501233_293318 3300049668 Bacteria 500
307 Ga0501079_0083542 3300049741 Bacteria 2470
308 Ga0501080_0051525 3300049742 Bacteria 3830
309 Ga0501081_0011994 3300049743 Bacteria 5679
310 Ga0501081_0114855 3300049743 Bacteria 1913
311 Ga0501044_1099456 3300049823 Bacteria 664
312 Ga0501045_0061290 3300049824 Bacteria 2759
313 nmdc:mga05p37_149106_c1 3300050507 Bacteria 1256
314 nmdc:mga05p37_215754_c1 3300050507 Bacteria 2318
315 nmdc:mga09592_159731_c1 3300050508 Bacteria 1947
316 nmdc:mga0qj67_88655_c1 3300050509 Bacteria 2484
317 nmdc:mga06r32_31339_c1 3300050510 Bacteria 4993
318 nmdc:mga08y16_372508_c1 3300050511 Bacteria 1465
319 nmdc:mga08y16_471150_c1 3300050511 Bacteria 1279
320 nmdc:mga08y16_70267_c1 3300050511 Bacteria 3650
321 nmdc:mga0n895_1238043_c1 3300050512 Bacteria 719
322 nmdc:mga0n895_178_c1 3300050512 Bacteria 38979
323 nmdc:mga0n895_364272_c1 3300050512 Bacteria 1464
324 nmdc:mga0n895_46_c1 3300050512 Bacteria 73853
325 nmdc:mga0n895_920270_c1 3300050512 Bacteria 859
326 nmdc:mga0rr50_1042_c1 3300050513 Bacteria 15040
327 nmdc:mga0rr50_3803_c1 3300050513 Bacteria 8766
328 nmdc:mga0rr50_416834_c1 3300050513 Bacteria 1136
329 nmdc:mga0rr50_77896_c1 3300050513 Bacteria 2549
330 nmdc:mga08x19_1356296_c1 3300050514 Bacteria 503
331 nmdc:mga08x19_180505_c1 3300050514 Bacteria 1441
332 nmdc:mga08x19_212144_c1 3300050514 Bacteria 1329
333 nmdc:mga08x19_21752_c1 3300050514 Bacteria 3963
334 nmdc:mga08x19_23300_c1 3300050514 Bacteria 3840
335 nmdc:mga08x19_3153_c1 3300050514 Bacteria 9898
336 nmdc:mga08x19_41231_c1 3300050514 Bacteria 2940
337 nmdc:mga08x19_5052_c1 3300050514 Bacteria 7808
338 nmdc:mga08x19_52749_c1 3300050514 Bacteria 2616
339 nmdc:mga08x19_590182_c1 3300050514 Bacteria 787
340 nmdc:mga08x19_652984_c1 3300050514 Bacteria 746
341 nmdc:mga0a205_218637_c1 3300050515 Bacteria 1792
342 nmdc:mga0a205_3395_c1 3300050515 Bacteria 14193
343 Ga0501084_0055526 3300054114 Bacteria 3313
344 Ga0590071_221729 3300059421 Bacteria 500
345 Ga0501082_0015639 3300060353 Bacteria 6530
346 Ga0530510_0000384 3300061734 Bacteria 28758
347 Ga0316575_10020048
348 JGI25151J46595_10003261
349 rootL2_10257370
350 Ga0055526_1008407
351 Ga0055534_1003054
352 Ga0070683_100151473
353 Ga0070690_100000242
354 Ga0070690_100294492
355 Ga0070690_100529195
356 Ga0070690_100627939
357 Ga0068869_100000383
358 Ga0070666_11066807
359 Ga0070680_100043551
360 Ga0070680_100749913
361 Ga0070682_100072430
362 Ga0070682_100369470
363 Ga0068868_100000919
364 Ga0068868_100607083
365 Ga0070689_100003789
366 Ga0070689_100246514
367 Ga0070691_10002942
368 Ga0070691_10030916
369 Ga0070687_100000648
370 Ga0070687_100959485
371 Ga0070692_10006543
372 Ga0070692_10313001
373 Ga0070669_100482406
374 Ga0070675_100178598
375 Ga0070675_101307613
376 Ga0070671_100090064
377 Ga0070673_100245468
378 Ga0070667_100171453
379 Ga0070703_10006696
380 Ga0070703_10125314
381 Ga0070714_100265838
382 Ga0070710_10377436
383 Ga0070701_10003758
384 Ga0070701_10067007
385 Ga0070705_100001620
386 Ga0070705_100216811
387 Ga0070700_100036714
388 Ga0070700_100420672
389 Ga0070694_100030194
390 Ga0070694_100181625
391 Ga0070694_100324509
392 Ga0070694_100425549
393 Ga0070708_100075175
394 Ga0070678_100340087
395 Ga0070662_100055766
396 Ga0070681_10042709
397 Ga0068867_100005706
398 Ga0070685_10581711
399 Ga0070707_100983483
400 Ga0070699_100011061
401 Ga0070699_100056618
402 Ga0070679_100020509
403 Ga0070679_100082388
404 Ga0070679_100516653
405 Ga0070697_100030857
406 Ga0070697_100849678
407 Ga0070697_101363650
408 Ga0068853_100094925
409 Ga0070686_100000440
410 Ga0070686_100181443
411 Ga0070686_100547216
412 Ga0070686_100549628
413 Ga0070695_100005814
414 Ga0070695_100016813
415 Ga0070695_100095544
416 Ga0070695_100103549
417 Ga0070695_100831975
418 Ga0070695_101546907
419 Ga0070696_100000717
420 Ga0070696_100006018
421 Ga0070696_100007266
422 Ga0070696_100080694
423 Ga0070696_100282312
424 Ga0070696_100540049
425 Ga0070696_100693017
426 Ga0070693_100002416
427 Ga0070693_100293242
428 Ga0070693_100506282
429 Ga0070693_101185091
430 Ga0070704_100000205
431 Ga0070704_101081003
432 Ga0068855_100002240
433 Ga0068854_100005248
434 Ga0068856_100112138
435 Ga0068856_100439411
436 Ga0070702_100001872
437 Ga0070702_100087159
438 Ga0068859_100001225
439 Ga0068859_100079964
440 Ga0068859_102718349
441 Ga0068864_100035331
442 Ga0068864_100066813
443 Ga0068866_10001783
444 Ga0068866_10618621
445 Ga0068861_100000491
446 Ga0068861_101393424
447 Ga0068870_10034716
448 Ga0068870_10819622
449 Ga0068858_100010952
450 Ga0068860_100012962
451 Ga0068860_100415360
452 Ga0068860_100632034
453 Ga0068862_100002102
454 Ga0081539_10001221
455 Ga0070715_10143227
456 Ga0070716_100032895
457 Ga0097621_100006839
458 Ga0097621_101032014
459 Ga0068871_100002641
460 Ga0075428_100164414
461 Ga0075431_100005372
462 Ga0075433_10011678
463 Ga0075433_10091273
464 Ga0075433_10205502
465 Ga0075434_100000013
466 Ga0075434_100001497
467 Ga0075434_100641860
468 Ga0075429_100018892
469 Ga0075429_100029842
470 Ga0068865_100000760
471 Ga0068865_100226918
472 Ga0075436_100000342
473 Ga0075436_100000344
474 Ga0075436_100009901
475 Ga0075436_100019198
476 Ga0075436_100053851
477 Ga0075436_100101980
478 Ga0075436_100317909
479 Ga0075436_100325528
480 Ga0075436_100368227
481 Ga0097620_100001225
482 Ga0097620_100079966
483 Ga0097620_102717075
484 Ga0075435_100000775
485 Ga0075435_100002732
486 Ga0075435_100010646
487 Ga0075435_100200621
488 Ga0075435_100203096
489 Ga0105250_10201984
490 Ga0105240_11223736
491 Ga0111539_10059742
492 Ga0111539_11304122
493 Ga0111539_11485441
494 Ga0105245_10000821
495 Ga0114129_10122978
496 Ga0114129_10346983
497 Ga0114129_11875850
498 Ga0114129_12403484
499 Ga0105243_10001858
500 Ga0105241_10059161
501 Ga0105242_10005729
502 Ga0105248_10481629
503 Ga0105248_10693567
504 Ga0105249_10000348
505 Ga0105239_10126507
506 Ga0105239_10992578
507 Ga0105246_10210219
508 Ga0157371_10454462
509 Ga0157369_11171722
510 Ga0157378_10008721
511 Ga0157380_11376381
512 Ga0157376_10035632
513 Ga0207653_10001993
514 Ga0207642_10001303
515 Ga0207685_10009435
516 Ga0207643_10011696
517 Ga0207654_10049254
518 Ga0207707_10001611
519 Ga0207707_10598626
520 Ga0207660_10171541
521 Ga0207662_10000223
522 Ga0207662_10083563
523 Ga0207662_10768000
524 Ga0207652_10034357
525 Ga0207652_10073021
526 Ga0207652_10587598
527 Ga0207681_10397623
528 Ga0207659_10435048
529 Ga0207687_10006759
530 Ga0207687_10779878
531 Ga0207664_10202933
532 Ga0207644_10063060
533 Ga0207706_10073550
534 Ga0207686_10000347
535 Ga0207709_10000980
536 Ga0207670_10000857
537 Ga0207670_10053905
538 Ga0207704_10001469
539 Ga0207665_10049917
540 Ga0207691_10073489
541 Ga0207689_10005776
542 Ga0207661_10112276
543 Ga0207667_10012884
544 Ga0207651_10733480
545 Ga0207651_11133245
546 Ga0207712_10007202
547 Ga0207640_10004651
548 Ga0207677_10002066
549 Ga0207703_10004206
550 Ga0207639_10054780
551 Ga0207639_10755295
552 Ga0207708_10043792
553 Ga0207708_10984600
554 Ga0207702_10052130
555 Ga0207702_10364474
556 Ga0207641_10982713
557 Ga0207648_10001327
558 Ga0207648_11975414
559 Ga0207676_10008837
560 Ga0207675_100000334
561 Ga0207675_100963462
562 Ga0207683_10405973
563 Ga0209995_1010077
564 Ga0207428_10348585
565 Ga0207428_10386106
566 Ga0268265_10001658
567 Ga0268264_10008988
568 Ga0265329_10120324
569 Ga0307408_100034817
570 Ga0307408_100470030
571 Ga0307408_100529085
572 Ga0307405_10785861
573 Ga0307416_102094089
574 Ga0307411_10047251
575 Ga0373930_0026954
576 Ga0373959_0141182
577 Ga0373940_0363408
578 Ga0373944_0007324
579 Ga0373951_0203713
580 Ga0373952_0025679
581 Ga0373923_0102946
582 Ga0373941_0531455
583 Ga0373945_0007771
584 Ga0373960_0152640
585 Ga0373943_0179613
586 Ga0373946_0017092
587 Ga0373955_0079573
588 Ga0373961_0446336
589 Ga0373962_0249940
590 Ga0316574_0000711
591 Ga0373924_0007771
592 Ga0373924_0254372
593 Ga0373931_0052502
594 Ga0373931_0189174
595 Ga0373935_0249101
596 Ga0373927_0016369
597 Ga0373925_0372174
598 Ga0439436_0041605
599 Ga0439452_050715
600 Ga0451577_0844235
601 Ga0453684_0029995
602 Ga0451576_1098231
603 Ga0451576_1340568
604 Ga0495603_0059260
605 Ga0495580_0093186
606 Ga0495582_0027363
607 Ga0495639_0006183
608 Ga0495639_0045019
609 Ga0495662_0022897
610 Ga0495594_0064992
611 Ga0495666_0008435
612 Ga0495642_0013922
613 Ga0495665_0019217
614 Ga0495640_0266962
615 Ga0495586_0017722
616 Ga0495586_0020253
617 Ga0495598_0045477
618 Ga0495621_0009182
619 Ga0495621_0182838
620 Ga0495634_0256451
621 Ga0495635_0329939
622 Ga0495659_0054763
623 Ga0495588_0042420
624 Ga0495647_0002134
625 Ga0495658_0005270
626 Ga0495669_0016925
627 Ga0495624_0239453
628 Ga0495581_0007619
629 Ga0495674_0518412
630 Ga0495676_0137359
631 Ga0495593_0123170
632 Ga0496106_0820440
633 Ga0501296_006413
634 Ga0501036_0296500
635 Ga0501038_0024969
636 Ga0501039_0085095
637 Ga0501040_0163042
638 Ga0501040_0843546
639 Ga0501041_0050321
640 Ga0501042_0246413
641 Ga0501043_1131262
642 Ga0501048_0022101
643 Ga0501067_0247776
644 Ga0501068_0820008
645 Ga0501071_0030468
646 Ga0501072_0047319
647 Ga0501074_0041431
648 Ga0501074_0540858
649 Ga0501075_0051539
650 Ga0501076_0002166
651 Ga0501077_0153507
652 Ga0501233_293318
653 Ga0501079_0083542
654 Ga0501080_0051525
655 Ga0501081_0011994
656 Ga0501081_0114855
657 Ga0501044_1099456
658 Ga0501045_0061290
659 nmdc:mga05p37_149106_c1
660 nmdc:mga05p37_215754_c1
661 nmdc:mga09592_159731_c1
662 nmdc:mga0qj67_88655_c1
663 nmdc:mga06r32_31339_c1
664 nmdc:mga08y16_372508_c1
665 nmdc:mga08y16_471150_c1
666 nmdc:mga08y16_70267_c1
667 nmdc:mga0n895_1238043_c1
668 nmdc:mga0n895_178_c1
669 nmdc:mga0n895_364272_c1
670 nmdc:mga0n895_46_c1
671 nmdc:mga0n895_920270_c1
672 nmdc:mga0rr50_1042_c1
673 nmdc:mga0rr50_3803_c1
674 nmdc:mga0rr50_416834_c1
675 nmdc:mga0rr50_77896_c1
676 nmdc:mga08x19_1356296_c1
677 nmdc:mga08x19_180505_c1
678 nmdc:mga08x19_212144_c1
679 nmdc:mga08x19_21752_c1
680 nmdc:mga08x19_23300_c1
681 nmdc:mga08x19_3153_c1
682 nmdc:mga08x19_41231_c1
683 nmdc:mga08x19_5052_c1
684 nmdc:mga08x19_52749_c1
685 nmdc:mga08x19_590182_c1
686 nmdc:mga08x19_652984_c1
687 nmdc:mga0a205_218637_c1
688 nmdc:mga0a205_3395_c1
689 Ga0501084_0055526
690 Ga0590071_221729
691 Ga0501082_0015639
692 Ga0530510_0000384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06271

RDD

RDD family

11

160

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t92-assembly1.cif.gz_C structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.5012 15 146
8q4h-assembly1.cif.gz_D a membrane-bound menaquinol:organohalide oxidoreductase complex rdh complex 0.4777 3 64
7t92-assembly1.cif.gz_C structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4465 15 146
7t92-assembly1.cif.gz_B structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4401 1 148
7t92-assembly1.cif.gz_B structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex 0.4324 1 148
ID Description Score Start End Superfamily
af_A5A630_30_91_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6693 8 44 1.10.287.70
af_Q79FG7_24_134_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6473 8 139 1.10.287.1260
af_Q79FG7_24_134_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5897 8 139 1.10.287.1260
3lr6B01 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Spidroin, N-terminal domain 0.5726 12 59 1.10.274.70
af_O69663_16_156_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.505 8 151 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A5E4VT38-F1-model_v4 Membrane protein 0.8183 1 145 GO:0005886
AF-A0A6L9L0X4-F1-model_v4 RDD family protein 0.8177 1 145 GO:0005886
AF-A0A208XRJ7-F1-model_v4 RDD domain-containing protein 0.8133 1 147 GO:0005886
AF-A0A0K6IQF8-F1-model_v4 Uncharacterized membrane protein YckC, RDD family 0.8104 2 148 GO:0005886
AF-A0A1K1Q747-F1-model_v4 RDD family protein 0.8085 8 145 GO:0016020

Map