F416758

General Info

Members Datasets Scaffolds Average Seq Length
346 198 343 141

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10558719|Ga0157371_105587191
Length 169
Sequence LVKSEVGRPATVEASDDQETFGDTDMRFMVIVKASKNSEAGIMPGAELLAAMGKFNEEMVKAGVMLAGEGLQPSSKGARIRFGLDGKRTVVDGPFAETKELVAGFWLIQVKSKEEAIEWMRRCPAPMPGEESELEIRQVFEAADFGAEFTPELREQEERLRDQIAAKTK

Samples

Sample ID Description Type Environment
1 2511231021 Pseudomonas sp. GM78 Isolate Nodule
2 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
198 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0.29
Rhizoplane 3.18
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100177816 3300005329 Bacteria 2020
2 Ga0070660_101194287 3300005339 Bacteria 645
3 Ga0070689_100004093 3300005340 Bacteria 9820
4 Ga0070689_100071239 3300005340 Bacteria 2715
5 Ga0070661_100008913 3300005344 Bacteria 6943
6 Ga0070668_100895668 3300005347 Bacteria 793
7 Ga0070675_101023556 3300005354 Bacteria 758
8 Ga0070674_100036112 3300005356 Bacteria 3315
9 Ga0070688_100260030 3300005365 Bacteria 1239
10 Ga0070659_100063485 3300005366 Bacteria 2922
11 Ga0070667_100026126 3300005367 Bacteria 4856
12 Ga0070667_100511851 3300005367 Bacteria 1101
13 Ga0070714_100010824 3300005435 Bacteria 7224
14 Ga0070663_100042597 3300005455 Bacteria 3191
15 Ga0070662_101380213 3300005457 Bacteria 607
16 Ga0070685_10008929 3300005466 Bacteria 5171
17 Ga0070706_100213272 3300005467 Bacteria 1802
18 Ga0070707_100235419 3300005468 Bacteria 1782
19 Ga0070707_102270387 3300005468 Bacteria 510
20 Ga0070699_100000445 3300005518 Bacteria 39754
21 Ga0070679_100677493 3300005530 Bacteria 974
22 Ga0070697_100253010 3300005536 Bacteria 1507
23 Ga0068853_100023505 3300005539 Bacteria 5161
24 Ga0070686_100959460 3300005544 Bacteria 699
25 Ga0070693_100038959 3300005547 Bacteria 2660
26 Ga0068855_100097841 3300005563 Bacteria 3380
27 Ga0068855_100177794 3300005563 Bacteria 2407
28 Ga0068855_100898875 3300005563 Bacteria 936
29 Ga0068857_100854049 3300005577 Bacteria 871
30 Ga0068856_101483295 3300005614 Bacteria 692
31 Ga0068852_100024815 3300005616 Bacteria 4850
32 Ga0068852_101594777 3300005616 Bacteria 675
33 Ga0068859_100165228 3300005617 Bacteria 2293
34 Ga0068859_100177327 3300005617 Bacteria 2213
35 Ga0068851_10419767 3300005834 Bacteria 790
36 Ga0068860_100281222 3300005843 Bacteria 1626
37 Ga0068860_100313223 3300005843 Bacteria 1539
38 Ga0068862_100094500 3300005844 Bacteria 2608
39 Ga0068862_100351494 3300005844 Bacteria 1368
40 Ga0081455_10130602 3300005937 Bacteria 1964
41 Ga0097621_100164198 3300006237 Bacteria 1911
42 Ga0097621_100278838 3300006237 Bacteria 1471
43 Ga0097621_101094035 3300006237 Bacteria 748
44 Ga0068871_100117732 3300006358 Bacteria 2241
45 Ga0068871_100309663 3300006358 Bacteria 1388
46 Ga0097620_100165228 3300006931 Bacteria 2293
47 Ga0097620_100177329 3300006931 Bacteria 2213
48 Ga0105240_10048078 3300009093 Bacteria 5394
49 Ga0111539_10054526 3300009094 Bacteria 4756
50 Ga0111539_10616000 3300009094 Bacteria 1264
51 Ga0105247_10003557 3300009101 Bacteria 10132
52 Ga0105243_10756921 3300009148 Bacteria 953
53 Ga0105248_10695476 3300009177 Bacteria 1147
54 Ga0105238_10059228 3300009551 Bacteria 3836
55 Ga0105238_10154418 3300009551 Bacteria 2270
56 Ga0105238_10212293 3300009551 Bacteria 1912
57 Ga0105238_10472158 3300009551 Bacteria 1253
58 Ga0105239_10565891 3300010375 Bacteria 1295
59 Ga0157371_10262329 3300013102 Bacteria 1246
60 Ga0157371_10558719 3300013102 Bacteria 849
61 Ga0157370_10816266 3300013104 Bacteria 848
62 Ga0157369_10002483 3300013105 Bacteria 22088
63 Ga0157369_10645569 3300013105 Bacteria 1092
64 Ga0157378_10000158 3300013297 Bacteria 64291
65 Ga0163162_10089022 3300013306 Bacteria 3167
66 Ga0157372_10007996 3300013307 Bacteria 11248
67 Ga0157372_10096201 3300013307 Bacteria 3374
68 Ga0157372_10683647 3300013307 Bacteria 1194
69 Ga0157372_10731049 3300013307 Bacteria 1151
70 Ga0157375_11357090 3300013308 Bacteria 837
71 Ga0163163_10249301 3300014325 Bacteria 1826
72 Ga0157380_12263062 3300014326 Bacteria 608
73 Ga0182008_10017220 3300014497 Bacteria 3749
74 Ga0157376_10027002 3300014969 Bacteria 4545
75 Ga0163161_10267645 3300017792 Bacteria 1336
76 Ga0209435_101530 3300025206 Bacteria 2889
77 Ga0209784_100143 3300025224 Bacteria 65902
78 Ga0209566_102059 3300025225 Bacteria 4193
79 Ga0209672_102706 3300025228 Bacteria 4117
80 Ga0207427_100059 3300025231 Bacteria 186680
81 Ga0209437_100123 3300025233 Bacteria 200393
82 Ga0209258_100281 3300025242 Bacteria 85049
83 Ga0209646_1000488 3300025246 Bacteria 19175
84 Ga0209026_1000174 3300025250 Bacteria 98063
85 Ga0209148_1000121 3300025254 Bacteria 186730
86 Ga0209759_1000216 3300025256 Bacteria 88494
87 Ga0209233_1000136 3300025261 Bacteria 200393
88 Ga0209233_1039624 3300025261 Bacteria 1031
89 Ga0209455_1000120 3300025272 Bacteria 173966
90 Ga0207710_10003510 3300025900 Bacteria 6969
91 Ga0207645_10421442 3300025907 Bacteria 899
92 Ga0207705_10361406 3300025909 Bacteria 1120
93 Ga0207705_11549220 3300025909 Bacteria 501
94 Ga0207684_10093627 3300025910 Bacteria 2562
95 Ga0207695_10091470 3300025913 Bacteria 3056
96 Ga0207663_10736233 3300025916 Bacteria 782
97 Ga0207649_10567708 3300025920 Bacteria 870
98 Ga0207652_10741369 3300025921 Bacteria 875
99 Ga0207646_10000904 3300025922 Bacteria 38211
100 Ga0207694_10034499 3300025924 Bacteria 3880
101 Ga0207694_10123874 3300025924 Bacteria 2066
102 Ga0207694_10317039 3300025924 Bacteria 1286
103 Ga0207694_10709762 3300025924 Bacteria 848
104 Ga0207659_10544506 3300025926 Bacteria 986
105 Ga0207664_10035254 3300025929 Bacteria 3859
106 Ga0207709_10583138 3300025935 Bacteria 883
107 Ga0207670_10003731 3300025936 Bacteria 8088
108 Ga0207670_10006013 3300025936 Bacteria 6706
109 Ga0207711_10387715 3300025941 Bacteria 1297
110 Ga0207679_10853995 3300025945 Bacteria 831
111 Ga0207667_10109452 3300025949 Bacteria 2849
112 Ga0207667_10156591 3300025949 Bacteria 2344
113 Ga0207668_10209602 3300025972 Bacteria 1558
114 Ga0207668_10995913 3300025972 Bacteria 749
115 Ga0207658_10016465 3300025986 Bacteria 5085
116 Ga0207658_10458445 3300025986 Bacteria 1130
117 Ga0207639_10040691 3300026041 Bacteria 3471
118 Ga0207641_11354785 3300026088 Bacteria 712
119 Ga0207698_10022760 3300026142 Bacteria 4364
120 Ga0209971_1111874 3300027682 Bacteria 670
121 Ga0209966_1136187 3300027695 Bacteria 568
122 Ga0209998_10089347 3300027717 Bacteria 754
123 Ga0207428_10006893 3300027907 Bacteria 10411
124 Ga0268266_12329203 3300028379 Bacteria 507
125 Ga0268265_10078480 3300028380 Bacteria 2597
126 Ga0268265_10088957 3300028380 Bacteria 2462
127 Ga0268265_11218394 3300028380 Bacteria 751
128 Ga0268264_10037555 3300028381 Bacteria 3994
129 Ga0265320_10163132 3300031240 Bacteria 1003
130 Ga0307408_100202503 3300031548 Bacteria 1608
131 Ga0265314_10140133 3300031711 Bacteria 1496
132 Ga0265342_10006393 3300031712 Bacteria 8780
133 Ga0307516_10142830 3300031730 Bacteria 2161
134 Ga0307516_10374645 3300031730 Bacteria 1086
135 Ga0307406_10100677 3300031901 Bacteria 1968
136 Ga0307407_10541272 3300031903 Bacteria 859
137 Ga0307407_11388989 3300031903 Bacteria 553
138 Ga0307411_10106621 3300032005 Bacteria 1995
139 Ga0307415_100264827 3300032126 Bacteria 1405
140 Ga0373961_0092624 3300035241 Bacteria 968
141 Ga0395899_0099815 3300037312 Bacteria 2096
142 Ga0395899_0371008 3300037312 Bacteria 953
143 Ga0395900_0198719 3300037418 Bacteria 2030
144 Ga0395900_0223393 3300037418 Bacteria 1897
145 Ga0395898_0432732 3300037466 Bacteria 1254
146 Ga0395905_0019609 3300037471 Bacteria 6410
147 Ga0395905_0047779 3300037471 Bacteria 4010
148 Ga0395905_0101066 3300037471 Bacteria 2707
149 Ga0395905_0685432 3300037471 Bacteria 927
150 Ga0395905_1105695 3300037471 Bacteria 696
151 Ga0395901_0031629 3300038443 Bacteria 5455
152 Ga0436361_0284091 3300039447 Bacteria 2934
153 Ga0436361_0803224 3300039447 Bacteria 18078
154 Ga0436363_1113167 3300039450 Bacteria 1111
155 Ga0451853_3519164 3300041512 Bacteria 817
156 Ga0466970_0404415 3300044765 Bacteria 779
157 Ga0466957_0002945 3300044842 Bacteria 9226
158 Ga0451576_2257446 3300045051 Bacteria 558
159 Ga0495617_112567 3300046452 Bacteria 880
160 Ga0495627_004140 3300046453 Bacteria 6155
161 Ga0495627_008951 3300046453 Bacteria 3702
162 Ga0495627_087279 3300046453 Bacteria 899
163 Ga0495603_0034324 3300046455 Bacteria 3049
164 Ga0495603_0140373 3300046455 Bacteria 1405
165 Ga0495590_0063016 3300046457 Bacteria 1297
166 Ga0495638_0000275 3300046460 Bacteria 69671
167 Ga0495638_0080592 3300046460 Bacteria 1978
168 Ga0495653_0009121 3300046463 Bacteria 8111
169 Ga0495650_0000409 3300046471 Bacteria 70670
170 Ga0495580_0003700 3300046472 Bacteria 12962
171 Ga0495605_0001089 3300046474 Bacteria 18098
172 Ga0495605_0003743 3300046474 Bacteria 9029
173 Ga0495605_0057946 3300046474 Bacteria 1863
174 Ga0495605_0098735 3300046474 Bacteria 1345
175 Ga0495584_0000936 3300046491 Bacteria 18423
176 Ga0495584_0013227 3300046491 Bacteria 4212
177 Ga0495584_0027339 3300046491 Bacteria 2890
178 Ga0495584_0038278 3300046491 Bacteria 2424
179 Ga0495585_0000752 3300046492 Bacteria 28704
180 Ga0495585_0002719 3300046492 Bacteria 12362
181 Ga0495585_0012411 3300046492 Bacteria 5020
182 Ga0495585_0032321 3300046492 Bacteria 2964
183 Ga0495585_0038037 3300046492 Bacteria 2709
184 Ga0495594_0007647 3300046499 Bacteria 5559
185 Ga0495594_0012321 3300046499 Bacteria 4454
186 Ga0495594_0085682 3300046499 Bacteria 1762
187 Ga0495596_0000776 3300046500 Bacteria 19474
188 Ga0495596_0003928 3300046500 Bacteria 7363
189 Ga0495596_0004014 3300046500 Bacteria 7261
190 Ga0495607_0010190 3300046501 Bacteria 6323
191 Ga0495607_0097384 3300046501 Bacteria 1582
192 Ga0495583_0019955 3300046506 Bacteria 3485
193 Ga0495583_0025239 3300046506 Bacteria 2972
194 Ga0495583_0027021 3300046506 Bacteria 2836
195 Ga0495583_0054520 3300046506 Bacteria 1810
196 Ga0495606_0010329 3300046507 Bacteria 7764
197 Ga0495606_0030200 3300046507 Bacteria 3789
198 Ga0495610_0001568 3300046512 Bacteria 20138
199 Ga0495610_0020015 3300046512 Bacteria 3727
200 Ga0495616_0006793 3300046513 Bacteria 6896
201 Ga0495616_0014217 3300046513 Bacteria 4464
202 Ga0495616_0019124 3300046513 Bacteria 3743
203 Ga0495616_0059791 3300046513 Bacteria 1873
204 Ga0495616_0230042 3300046513 Bacteria 804
205 Ga0495630_0125116 3300046517 Bacteria 1951
206 Ga0495631_0001988 3300046518 Bacteria 11954
207 Ga0495631_0003557 3300046518 Bacteria 8518
208 Ga0495631_0007081 3300046518 Bacteria 5736
209 Ga0495631_0010308 3300046518 Bacteria 4627
210 Ga0495631_0276277 3300046518 Bacteria 715
211 Ga0495632_0000062 3300046519 Bacteria 118205
212 Ga0495632_0000235 3300046519 Bacteria 55317
213 Ga0495632_0064366 3300046519 Bacteria 1773
214 Ga0495644_0089366 3300046523 Bacteria 1162
215 Ga0495644_0113963 3300046523 Bacteria 1026
216 Ga0495644_0195385 3300046523 Bacteria 779
217 Ga0495648_0011902 3300046524 Bacteria 6525
218 Ga0495648_0119869 3300046524 Bacteria 1416
219 Ga0495648_0133560 3300046524 Bacteria 1316
220 Ga0495648_0204010 3300046524 Bacteria 987
221 Ga0495642_0000559 3300046528 Bacteria 18799
222 Ga0495642_0003074 3300046528 Bacteria 6636
223 Ga0495642_0008094 3300046528 Bacteria 4023
224 Ga0495642_0013850 3300046528 Bacteria 3123
225 Ga0495642_0038997 3300046528 Bacteria 1926
226 Ga0495642_0121437 3300046528 Bacteria 1121
227 Ga0495654_0009581 3300046530 Bacteria 5305
228 Ga0495654_0049930 3300046530 Bacteria 2046
229 Ga0495654_0169091 3300046530 Bacteria 954
230 Ga0495665_0053745 3300046531 Bacteria 2129
231 Ga0495587_0049680 3300046536 Bacteria 2483
232 Ga0495609_0005761 3300046538 Bacteria 6437
233 Ga0495609_0008133 3300046538 Bacteria 5163
234 Ga0495609_0031377 3300046538 Bacteria 2416
235 Ga0495609_0051967 3300046538 Bacteria 1823
236 Ga0495609_0239665 3300046538 Bacteria 749
237 Ga0495597_0001279 3300046542 Bacteria 18545
238 Ga0495597_0002219 3300046542 Bacteria 12720
239 Ga0495597_0002615 3300046542 Bacteria 11204
240 Ga0495597_0179352 3300046542 Bacteria 856
241 Ga0495633_0002672 3300046558 Bacteria 12403
242 Ga0495633_0019488 3300046558 Bacteria 3430
243 Ga0495633_0250829 3300046558 Bacteria 807
244 Ga0495656_0031934 3300046615 Bacteria 2139
245 Ga0495656_0068264 3300046615 Bacteria 1571
246 Ga0495656_0177972 3300046615 Bacteria 1044
247 Ga0495668_0001519 3300046616 Bacteria 22052
248 Ga0495668_0008100 3300046616 Bacteria 6617
249 Ga0495668_0012832 3300046616 Bacteria 4963
250 Ga0495668_0017148 3300046616 Bacteria 4206
251 Ga0495668_0175127 3300046616 Bacteria 1175
252 Ga0495611_0004228 3300046648 Bacteria 6250
253 Ga0495611_0009631 3300046648 Bacteria 4081
254 Ga0495611_0156783 3300046648 Bacteria 1063
255 Ga0495625_0031054 3300046660 Bacteria 3977
256 Ga0495625_0113612 3300046660 Bacteria 1849
257 Ga0495625_0117593 3300046660 Bacteria 1812
258 Ga0495635_0671953 3300046663 Bacteria 673
259 Ga0495635_0933503 3300046663 Bacteria 554
260 Ga0495661_0002081 3300046665 Bacteria 15698
261 Ga0495661_0010028 3300046665 Bacteria 6476
262 Ga0495661_0020527 3300046665 Bacteria 4311
263 Ga0495661_0045743 3300046665 Bacteria 2675
264 Ga0495661_0060350 3300046665 Bacteria 2253
265 Ga0495661_0121104 3300046665 Bacteria 1445
266 Ga0495661_0152667 3300046665 Bacteria 1246
267 Ga0495588_0060307 3300046674 Bacteria 1963
268 Ga0495588_0070294 3300046674 Bacteria 1819
269 Ga0495588_0235202 3300046674 Bacteria 966
270 Ga0495669_0020081 3300046684 Bacteria 2888
271 Ga0495669_0027346 3300046684 Bacteria 2495
272 Ga0495613_0087920 3300046689 Bacteria 2252
273 Ga0495670_0004330 3300046691 Bacteria 6958
274 Ga0495670_0015068 3300046691 Bacteria 3803
275 Ga0495670_0041976 3300046691 Bacteria 2282
276 Ga0495670_0073398 3300046691 Bacteria 1734
277 Ga0495670_0659333 3300046691 Bacteria 570
278 Ga0495671_0003583 3300046692 Bacteria 9485
279 Ga0495671_0008001 3300046692 Bacteria 5975
280 Ga0495671_0011158 3300046692 Bacteria 4956
281 Ga0495671_0327479 3300046692 Bacteria 735
282 Ga0495649_0053852 3300046694 Bacteria 2177
283 Ga0495649_0058352 3300046694 Bacteria 2079
284 Ga0495649_0074954 3300046694 Bacteria 1812
285 Ga0495649_0122537 3300046694 Bacteria 1374
286 Ga0495649_0248956 3300046694 Bacteria 913
287 Ga0495589_0067628 3300046794 Bacteria 1748
288 Ga0495589_0113435 3300046794 Bacteria 1307
289 Ga0495660_0009864 3300046810 Bacteria 5556
290 Ga0495660_0028729 3300046810 Bacteria 3139
291 Ga0495660_0487730 3300046810 Bacteria 528
292 Ga0495680_0003786 3300047322 Bacteria 14708
293 Ga0495683_0160880 3300047323 Bacteria 1038
294 Ga0495687_000002 3300047443 Bacteria 1085770
295 Ga0495687_004590 3300047443 Bacteria 9240
296 Ga0495677_0003618 3300047445 Bacteria 5991
297 Ga0495677_0093887 3300047445 Bacteria 1132
298 Ga0495677_0152454 3300047445 Bacteria 890
299 Ga0495677_0187965 3300047445 Bacteria 801
300 Ga0495677_0221846 3300047445 Bacteria 736
301 Ga0495681_0003523 3300047470 Bacteria 10879
302 Ga0495681_0004070 3300047470 Bacteria 10058
303 Ga0495681_0051008 3300047470 Bacteria 1947
304 Ga0495681_0152306 3300047470 Bacteria 969
305 Ga0495686_0001168 3300047472 Bacteria 30722
306 Ga0495593_0029660 3300047673 Bacteria 2998
307 Ga0495626_0017487 3300048091 Bacteria 3617
308 Ga0495626_0037713 3300048091 Bacteria 2295
309 Ga0496102_0000861 3300048905 Bacteria 29100
310 Ga0496104_0349574 3300048907 Bacteria 1391
311 Ga0496106_0205618 3300048909 Bacteria 1568
312 Ga0496107_0136973 3300048910 Bacteria 1809
313 Ga0496110_0000019 3300048913 Bacteria 79137
314 Ga0496110_0090009 3300048913 Bacteria 2743
315 Ga0496111_0048157 3300048914 Bacteria 3071
316 Ga0496111_0115975 3300048914 Bacteria 1975
317 Ga0496114_0119028 3300048917 Bacteria 2270
318 Ga0496114_0267441 3300048917 Bacteria 1506
319 Ga0496115_0117316 3300048918 Bacteria 2189
320 Ga0496121_0219104 3300048924 Bacteria 1342
321 Ga0496121_0334523 3300048924 Bacteria 1014
322 Ga0496125_0199037 3300048928 Bacteria 1314
323 Ga0496126_0488379 3300048929 Bacteria 986
324 Ga0496126_0601188 3300048929 Bacteria 866
325 Ga0495678_004221 3300049459 Bacteria 8442
326 Ga0495678_021533 3300049459 Bacteria 2836
327 Ga0495678_064039 3300049459 Bacteria 1370
328 Ga0495682_0002851 3300049460 Bacteria 7964
329 Ga0501039_0346302 3300049575 Bacteria 1168
330 Ga0501041_0091993 3300049577 Bacteria 1873
331 Ga0501072_1145937 3300049588 Bacteria 605
332 Ga0501077_0498309 3300049593 Bacteria 781
333 Ga0501235_042410 3300049669 Bacteria 1043
334 Ga0501238_002064 3300049671 Bacteria 2364
335 Ga0501257_068873 3300049686 Bacteria 902
336 Ga0501080_0609409 3300049742 Bacteria 969
337 Ga0501275_061458 3300049772 Bacteria 573
338 nmdc:mga0qj67_176404_c1 3300050509 Bacteria 1735
339 nmdc:mga08y16_308477_c1 3300050511 Bacteria 1630
340 nmdc:mga08y16_9544_c1 3300050511 Bacteria 10185
341 nmdc:mga0a205_67832_c1 3300050515 Bacteria 3445
342 Ga0501084_0093869 3300054114 Bacteria 2519
343 Ga0500661_002185 3300055283 Bacteria 3690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0432732 Ga0395898_0432732_894_1241 114
2 3300046558 Ga0495633_0250829 Ga0495633_0250829_442_792 114
3 3300046794 Ga0495589_0067628 Ga0495589_0067628_11_358 114
4 3300049588 Ga0501072_1145937 Ga0501072_1145937_12_377 120
5 3300031903 Ga0307407_11388989 Ga0307407_113889892 121
6 3300037471 Ga0395905_0019609 Ga0395905_0019609_24_398 123
7 3300046663 Ga0495635_0933503 Ga0495635_0933503_34_408 123
8 3300046691 Ga0495670_0659333 Ga0495670_0659333_27_401 123
9 3300046694 Ga0495649_0074954 Ga0495649_0074954_11_397 123
10 3300046474 Ga0495605_0057946 Ga0495605_0057946_794_1240 124
11 3300046491 Ga0495584_0027339 Ga0495584_0027339_360_806 124
12 3300046528 Ga0495642_0038997 Ga0495642_0038997_1061_1507 124
13 3300046530 Ga0495654_0049930 Ga0495654_0049930_875_1321 124
14 3300046542 Ga0495597_0002219 Ga0495597_0002219_11304_11750 124
15 3300046616 Ga0495668_0012832 Ga0495668_0012832_2213_2659 124
16 3300046794 Ga0495589_0113435 Ga0495589_0113435_416_862 124
17 3300046455 Ga0495603_0034324 Ga0495603_0034324_80_505 130
18 3300046474 Ga0495605_0003743 Ga0495605_0003743_8439_8864 130
19 3300046492 Ga0495585_0038037 Ga0495585_0038037_1728_2153 130
20 3300046499 Ga0495594_0085682 Ga0495594_0085682_511_936 130
21 3300046513 Ga0495616_0006793 Ga0495616_0006793_4953_5378 130
22 3300046518 Ga0495631_0007081 Ga0495631_0007081_4546_4971 130
23 3300046518 Ga0495631_0010308 Ga0495631_0010308_1816_2241 130
24 3300046524 Ga0495648_0204010 Ga0495648_0204010_43_468 130
25 3300046528 Ga0495642_0003074 Ga0495642_0003074_1792_2217 130
26 3300046530 Ga0495654_0009581 Ga0495654_0009581_4124_4549 130
27 3300046538 Ga0495609_0239665 Ga0495609_0239665_254_679 130
28 3300046660 Ga0495625_0031054 Ga0495625_0031054_969_1394 130
29 3300046665 Ga0495661_0045743 Ga0495661_0045743_1931_2356 130
30 3300046674 Ga0495588_0060307 Ga0495588_0060307_1069_1494 130
31 3300046691 Ga0495670_0073398 Ga0495670_0073398_605_1030 130
32 3300046810 Ga0495660_0009864 Ga0495660_0009864_1846_2271 130
33 3300046538 Ga0495609_0051967 Ga0495609_0051967_1058_1498 131
34 3300039447 Ga0436361_0803224 Ga0436361_0803224_15491_15889 132
35 3300048924 Ga0496121_0219104 Ga0496121_0219104_653_1099 132
36 3300039447 Ga0436361_0284091 Ga0436361_0284091_831_1238 135
37 iso_pu_bacteria 2511231021 2511354052 135
38 3300009148 Ga0105243_10756921 Ga0105243_107569212 136
39 3300009551 Ga0105238_10212293 Ga0105238_102122932 136
40 3300009551 Ga0105238_10472158 Ga0105238_104721582 136
41 3300013306 Ga0163162_10089022 Ga0163162_100890225 136
42 3300014325 Ga0163163_10249301 Ga0163163_102493012 136
43 3300014497 Ga0182008_10017220 Ga0182008_100172204 136
44 3300014969 Ga0157376_10027002 Ga0157376_100270026 136
45 3300041512 Ga0451853_3519164 Ga0451853_3519164_204_620 136
46 3300046452 Ga0495617_112567 Ga0495617_112567_102_515 136
47 3300046460 Ga0495638_0000275 Ga0495638_0000275_40647_41060 136
48 3300046471 Ga0495650_0000409 Ga0495650_0000409_28791_29204 136
49 3300046507 Ga0495606_0010329 Ga0495606_0010329_2577_2990 136
50 3300046512 Ga0495610_0020015 Ga0495610_0020015_1458_1871 136
51 3300046694 Ga0495649_0122537 Ga0495649_0122537_949_1362 136
52 3300048907 Ga0496104_0349574 Ga0496104_0349574_33_446 136
53 3300048917 Ga0496114_0119028 Ga0496114_0119028_645_1058 136
54 3300048918 Ga0496115_0117316 Ga0496115_0117316_60_473 136
55 3300048924 Ga0496121_0334523 Ga0496121_0334523_146_559 136
56 3300048928 Ga0496125_0199037 Ga0496125_0199037_355_768 136
57 3300048929 Ga0496126_0601188 Ga0496126_0601188_108_521 136
58 iso_pu_bacteria 3007619802 3007620778 136
59 iso_pu_bacteria 8056177738 8056178421 136
60 3300005435 Ga0070714_100010824 Ga0070714_1000108247 137
61 3300005547 Ga0070693_100038959 Ga0070693_1000389591 137
62 3300009101 Ga0105247_10003557 Ga0105247_100035573 137
63 3300025929 Ga0207664_10035254 Ga0207664_100352546 137
64 3300031730 Ga0307516_10374645 Ga0307516_103746452 137
65 3300039450 Ga0436363_1113167 Ga0436363_1113167_59_478 137
66 3300046517 Ga0495630_0125116 Ga0495630_0125116_1005_1421 137
67 3300046536 Ga0495587_0049680 Ga0495587_0049680_1781_2197 137
68 3300047322 Ga0495680_0003786 Ga0495680_0003786_1813_2229 137
69 3300047673 Ga0495593_0029660 Ga0495593_0029660_2289_2705 137
70 3300048917 Ga0496114_0267441 Ga0496114_0267441_457_873 137
71 3300049577 Ga0501041_0091993 Ga0501041_0091993_27_446 137
72 3300049593 Ga0501077_0498309 Ga0501077_0498309_217_636 137
73 3300009094 Ga0111539_10054526 Ga0111539_100545264 138
74 3300013104 Ga0157370_10816266 Ga0157370_108162662 138
75 3300014326 Ga0157380_12263062 Ga0157380_122630622 138
76 3300045051 Ga0451576_2257446 Ga0451576_2257446_49_471 138
77 3300050511 nmdc:mga08y16_9544_c1 nmdc:mga08y16_9544_c1_2712_3137 138
78 3300035241 Ga0373961_0092624 Ga0373961_0092624_148_570 139
79 3300046542 Ga0495597_0002615 Ga0495597_0002615_8815_9237 139
80 3300048913 Ga0496110_0000019 Ga0496110_0000019_16096_16518 139
81 3300048914 Ga0496111_0048157 Ga0496111_0048157_2611_3033 139
82 3300049671 Ga0501238_002064 Ga0501238_002064_611_1036 139
83 3300005367 Ga0070667_100026126 Ga0070667_1000261265 140
84 3300005457 Ga0070662_101380213 Ga0070662_1013802131 140
85 3300005467 Ga0070706_100213272 Ga0070706_1002132721 140
86 3300005468 Ga0070707_100235419 Ga0070707_1002354192 140
87 3300005518 Ga0070699_100000445 Ga0070699_10000044541 140
88 3300005617 Ga0068859_100165228 Ga0068859_1001652284 140
89 3300005843 Ga0068860_100313223 Ga0068860_1003132233 140
90 3300006931 Ga0097620_100165228 Ga0097620_1001652284 140
91 3300009551 Ga0105238_10059228 Ga0105238_100592282 140
92 3300013102 Ga0157371_10262329 Ga0157371_102623292 140
93 3300013105 Ga0157369_10002483 Ga0157369_1000248322 140
94 3300017792 Ga0163161_10267645 Ga0163161_102676452 140
95 3300025900 Ga0207710_10003510 Ga0207710_100035105 140
96 3300025910 Ga0207684_10093627 Ga0207684_100936272 140
97 3300025922 Ga0207646_10000904 Ga0207646_1000090447 140
98 3300025986 Ga0207658_10016465 Ga0207658_100164653 140
99 3300027717 Ga0209998_10089347 Ga0209998_100893472 140
100 3300037312 Ga0395899_0099815 Ga0395899_0099815_1634_2059 140
101 3300037312 Ga0395899_0371008 Ga0395899_0371008_187_609 140
102 3300037418 Ga0395900_0223393 Ga0395900_0223393_1268_1693 140
103 3300037471 Ga0395905_0047779 Ga0395905_0047779_525_947 140
104 3300037471 Ga0395905_0101066 Ga0395905_0101066_405_830 140
105 3300037471 Ga0395905_0685432 Ga0395905_0685432_148_573 140
106 3300038443 Ga0395901_0031629 Ga0395901_0031629_1941_2363 140
107 3300044765 Ga0466970_0404415 Ga0466970_0404415_253_675 140
108 3300046453 Ga0495627_004140 Ga0495627_004140_1331_1756 140
109 3300046453 Ga0495627_008951 Ga0495627_008951_1617_2048 140
110 3300046453 Ga0495627_087279 Ga0495627_087279_25_450 140
111 3300046455 Ga0495603_0140373 Ga0495603_0140373_312_737 140
112 3300046457 Ga0495590_0063016 Ga0495590_0063016_333_758 140
113 3300046460 Ga0495638_0080592 Ga0495638_0080592_1343_1768 140
114 3300046463 Ga0495653_0009121 Ga0495653_0009121_7458_7883 140
115 3300046474 Ga0495605_0001089 Ga0495605_0001089_16006_16431 140
116 3300046474 Ga0495605_0098735 Ga0495605_0098735_652_1083 140
117 3300046491 Ga0495584_0000936 Ga0495584_0000936_369_794 140
118 3300046491 Ga0495584_0013227 Ga0495584_0013227_3600_4025 140
119 3300046491 Ga0495584_0038278 Ga0495584_0038278_1342_1773 140
120 3300046492 Ga0495585_0000752 Ga0495585_0000752_4728_5153 140
121 3300046492 Ga0495585_0002719 Ga0495585_0002719_11158_11583 140
122 3300046492 Ga0495585_0012411 Ga0495585_0012411_2875_3300 140
123 3300046492 Ga0495585_0032321 Ga0495585_0032321_1344_1769 140
124 3300046499 Ga0495594_0007647 Ga0495594_0007647_4993_5418 140
125 3300046499 Ga0495594_0012321 Ga0495594_0012321_1777_2202 140
126 3300046500 Ga0495596_0000776 Ga0495596_0000776_5824_6255 140
127 3300046500 Ga0495596_0003928 Ga0495596_0003928_885_1310 140
128 3300046500 Ga0495596_0004014 Ga0495596_0004014_6709_7134 140
129 3300046501 Ga0495607_0010190 Ga0495607_0010190_4514_4939 140
130 3300046501 Ga0495607_0097384 Ga0495607_0097384_441_875 140
131 3300046506 Ga0495583_0019955 Ga0495583_0019955_263_694 140
132 3300046506 Ga0495583_0025239 Ga0495583_0025239_1440_1865 140
133 3300046506 Ga0495583_0027021 Ga0495583_0027021_1572_2003 140
134 3300046506 Ga0495583_0054520 Ga0495583_0054520_1214_1645 140
135 3300046507 Ga0495606_0030200 Ga0495606_0030200_2857_3288 140
136 3300046512 Ga0495610_0001568 Ga0495610_0001568_17014_17439 140
137 3300046513 Ga0495616_0014217 Ga0495616_0014217_3045_3476 140
138 3300046513 Ga0495616_0019124 Ga0495616_0019124_789_1214 140
139 3300046513 Ga0495616_0059791 Ga0495616_0059791_674_1105 140
140 3300046513 Ga0495616_0230042 Ga0495616_0230042_313_738 140
141 3300046518 Ga0495631_0001988 Ga0495631_0001988_580_1005 140
142 3300046518 Ga0495631_0003557 Ga0495631_0003557_4819_5244 140
143 3300046518 Ga0495631_0276277 Ga0495631_0276277_246_677 140
144 3300046519 Ga0495632_0000235 Ga0495632_0000235_17406_17837 140
145 3300046519 Ga0495632_0064366 Ga0495632_0064366_341_766 140
146 3300046523 Ga0495644_0089366 Ga0495644_0089366_364_795 140
147 3300046523 Ga0495644_0113963 Ga0495644_0113963_74_499 140
148 3300046523 Ga0495644_0195385 Ga0495644_0195385_237_668 140
149 3300046524 Ga0495648_0011902 Ga0495648_0011902_4532_4957 140
150 3300046524 Ga0495648_0119869 Ga0495648_0119869_622_1047 140
151 3300046524 Ga0495648_0133560 Ga0495648_0133560_373_798 140
152 3300046528 Ga0495642_0000559 Ga0495642_0000559_1504_1929 140
153 3300046528 Ga0495642_0008094 Ga0495642_0008094_1661_2092 140
154 3300046528 Ga0495642_0013850 Ga0495642_0013850_1247_1672 140
155 3300046528 Ga0495642_0121437 Ga0495642_0121437_425_850 140
156 3300046530 Ga0495654_0169091 Ga0495654_0169091_202_633 140
157 3300046531 Ga0495665_0053745 Ga0495665_0053745_556_981 140
158 3300046538 Ga0495609_0008133 Ga0495609_0008133_1344_1769 140
159 3300046538 Ga0495609_0031377 Ga0495609_0031377_1396_1821 140
160 3300046542 Ga0495597_0179352 Ga0495597_0179352_78_503 140
161 3300046558 Ga0495633_0002672 Ga0495633_0002672_863_1288 140
162 3300046558 Ga0495633_0019488 Ga0495633_0019488_1462_1893 140
163 3300046615 Ga0495656_0031934 Ga0495656_0031934_271_696 140
164 3300046615 Ga0495656_0068264 Ga0495656_0068264_320_751 140
165 3300046615 Ga0495656_0177972 Ga0495656_0177972_566_991 140
166 3300046616 Ga0495668_0001519 Ga0495668_0001519_16225_16650 140
167 3300046616 Ga0495668_0008100 Ga0495668_0008100_4481_4906 140
168 3300046616 Ga0495668_0017148 Ga0495668_0017148_2995_3420 140
169 3300046616 Ga0495668_0175127 Ga0495668_0175127_44_475 140
170 3300046648 Ga0495611_0004228 Ga0495611_0004228_190_615 140
171 3300046648 Ga0495611_0009631 Ga0495611_0009631_1131_1556 140
172 3300046648 Ga0495611_0156783 Ga0495611_0156783_622_1047 140
173 3300046660 Ga0495625_0113612 Ga0495625_0113612_190_615 140
174 3300046660 Ga0495625_0117593 Ga0495625_0117593_496_921 140
175 3300046663 Ga0495635_0671953 Ga0495635_0671953_177_602 140
176 3300046665 Ga0495661_0002081 Ga0495661_0002081_973_1398 140
177 3300046665 Ga0495661_0010028 Ga0495661_0010028_1520_1945 140
178 3300046665 Ga0495661_0020527 Ga0495661_0020527_3190_3615 140
179 3300046665 Ga0495661_0121104 Ga0495661_0121104_423_848 140
180 3300046665 Ga0495661_0152667 Ga0495661_0152667_20_451 140
181 3300046674 Ga0495588_0070294 Ga0495588_0070294_1279_1704 140
182 3300046674 Ga0495588_0235202 Ga0495588_0235202_105_530 140
183 3300046684 Ga0495669_0020081 Ga0495669_0020081_1321_1746 140
184 3300046684 Ga0495669_0027346 Ga0495669_0027346_941_1366 140
185 3300046689 Ga0495613_0087920 Ga0495613_0087920_393_818 140
186 3300046691 Ga0495670_0004330 Ga0495670_0004330_554_979 140
187 3300046691 Ga0495670_0015068 Ga0495670_0015068_1865_2290 140
188 3300046691 Ga0495670_0041976 Ga0495670_0041976_172_603 140
189 3300046692 Ga0495671_0003583 Ga0495671_0003583_5473_5904 140
190 3300046692 Ga0495671_0008001 Ga0495671_0008001_4589_5014 140
191 3300046692 Ga0495671_0011158 Ga0495671_0011158_3912_4343 140
192 3300046692 Ga0495671_0327479 Ga0495671_0327479_245_676 140
193 3300046694 Ga0495649_0053852 Ga0495649_0053852_1038_1469 140
194 3300046694 Ga0495649_0058352 Ga0495649_0058352_649_1074 140
195 3300046810 Ga0495660_0028729 Ga0495660_0028729_1088_1519 140
196 3300046810 Ga0495660_0487730 Ga0495660_0487730_22_447 140
197 3300047323 Ga0495683_0160880 Ga0495683_0160880_541_972 140
198 3300047443 Ga0495687_000002 Ga0495687_000002_950865_951290 140
199 3300047443 Ga0495687_004590 Ga0495687_004590_1145_1576 140
200 3300047445 Ga0495677_0003618 Ga0495677_0003618_1051_1476 140
201 3300047445 Ga0495677_0093887 Ga0495677_0093887_352_777 140
202 3300047445 Ga0495677_0152454 Ga0495677_0152454_435_860 140
203 3300047445 Ga0495677_0187965 Ga0495677_0187965_177_608 140
204 3300047445 Ga0495677_0221846 Ga0495677_0221846_15_446 140
205 3300047470 Ga0495681_0003523 Ga0495681_0003523_9031_9456 140
206 3300047470 Ga0495681_0004070 Ga0495681_0004070_836_1267 140
207 3300047470 Ga0495681_0051008 Ga0495681_0051008_685_1116 140
208 3300047470 Ga0495681_0152306 Ga0495681_0152306_17_442 140
209 3300047472 Ga0495686_0001168 Ga0495686_0001168_28499_28924 140
210 3300048091 Ga0495626_0017487 Ga0495626_0017487_2252_2677 140
211 3300048091 Ga0495626_0037713 Ga0495626_0037713_1137_1568 140
212 3300048905 Ga0496102_0000861 Ga0496102_0000861_19232_19657 140
213 3300048909 Ga0496106_0205618 Ga0496106_0205618_814_1239 140
214 3300048910 Ga0496107_0136973 Ga0496107_0136973_301_726 140
215 3300048913 Ga0496110_0090009 Ga0496110_0090009_844_1269 140
216 3300048914 Ga0496111_0115975 Ga0496111_0115975_445_870 140
217 3300048929 Ga0496126_0488379 Ga0496126_0488379_244_669 140
218 3300049459 Ga0495678_004221 Ga0495678_004221_1685_2116 140
219 3300049459 Ga0495678_021533 Ga0495678_021533_2295_2726 140
220 3300049459 Ga0495678_064039 Ga0495678_064039_829_1260 140
221 3300049460 Ga0495682_0002851 Ga0495682_0002851_1445_1876 140
222 3300049575 Ga0501039_0346302 Ga0501039_0346302_609_1082 140
223 3300049742 Ga0501080_0609409 Ga0501080_0609409_255_728 140
224 3300050509 nmdc:mga0qj67_176404_c1 nmdc:mga0qj67_176404_c1_588_1028 140
225 3300050515 nmdc:mga0a205_67832_c1 nmdc:mga0a205_67832_c1_558_986 140
226 3300005339 Ga0070660_101194287 Ga0070660_1011942872 141
227 3300005340 Ga0070689_100004093 Ga0070689_1000040935 141
228 3300005340 Ga0070689_100071239 Ga0070689_1000712394 141
229 3300005344 Ga0070661_100008913 Ga0070661_1000089136 141
230 3300005347 Ga0070668_100895668 Ga0070668_1008956682 141
231 3300005354 Ga0070675_101023556 Ga0070675_1010235561 141
232 3300005356 Ga0070674_100036112 Ga0070674_1000361122 141
233 3300005365 Ga0070688_100260030 Ga0070688_1002600302 141
234 3300005367 Ga0070667_100511851 Ga0070667_1005118512 141
235 3300005455 Ga0070663_100042597 Ga0070663_1000425975 141
236 3300005466 Ga0070685_10008929 Ga0070685_100089294 141
237 3300005468 Ga0070707_102270387 Ga0070707_1022703871 141
238 3300005544 Ga0070686_100959460 Ga0070686_1009594601 141
239 3300005563 Ga0068855_100898875 Ga0068855_1008988752 141
240 3300005577 Ga0068857_100854049 Ga0068857_1008540492 141
241 3300005614 Ga0068856_101483295 Ga0068856_1014832951 141
242 3300005616 Ga0068852_101594777 Ga0068852_1015947771 141
243 3300005617 Ga0068859_100177327 Ga0068859_1001773273 141
244 3300005834 Ga0068851_10419767 Ga0068851_104197671 141
245 3300005843 Ga0068860_100281222 Ga0068860_1002812221 141
246 3300005844 Ga0068862_100094500 Ga0068862_1000945003 141
247 3300005844 Ga0068862_100351494 Ga0068862_1003514942 141
248 3300005937 Ga0081455_10130602 Ga0081455_101306023 141
249 3300006237 Ga0097621_100164198 Ga0097621_1001641983 141
250 3300006237 Ga0097621_100278838 Ga0097621_1002788382 141
251 3300006358 Ga0068871_100117732 Ga0068871_1001177324 141
252 3300006358 Ga0068871_100309663 Ga0068871_1003096632 141
253 3300006931 Ga0097620_100177329 Ga0097620_1001773292 141
254 3300009094 Ga0111539_10616000 Ga0111539_106160002 141
255 3300009177 Ga0105248_10695476 Ga0105248_106954761 141
256 3300009551 Ga0105238_10154418 Ga0105238_101544182 141
257 3300010375 Ga0105239_10565891 Ga0105239_105658912 141
258 3300013297 Ga0157378_10000158 Ga0157378_100001587 141
259 3300013307 Ga0157372_10096201 Ga0157372_100962012 141
260 3300013308 Ga0157375_11357090 Ga0157375_113570901 141
261 3300025206 Ga0209435_101530 Ga0209435_1015302 141
262 3300025224 Ga0209784_100143 Ga0209784_10014344 141
263 3300025225 Ga0209566_102059 Ga0209566_1020592 141
264 3300025228 Ga0209672_102706 Ga0209672_1027063 141
265 3300025231 Ga0207427_100059 Ga0207427_100059119 141
266 3300025233 Ga0209437_100123 Ga0209437_100123119 141
267 3300025242 Ga0209258_100281 Ga0209258_10028136 141
268 3300025246 Ga0209646_1000488 Ga0209646_100048812 141
269 3300025250 Ga0209026_1000174 Ga0209026_100017457 141
270 3300025254 Ga0209148_1000121 Ga0209148_1000121119 141
271 3300025256 Ga0209759_1000216 Ga0209759_100021649 141
272 3300025261 Ga0209233_1000136 Ga0209233_1000136119 141
273 3300025261 Ga0209233_1039624 Ga0209233_10396241 141
274 3300025272 Ga0209455_1000120 Ga0209455_1000120128 141
275 3300025907 Ga0207645_10421442 Ga0207645_104214422 141
276 3300025909 Ga0207705_10361406 Ga0207705_103614062 141
277 3300025916 Ga0207663_10736233 Ga0207663_107362331 141
278 3300025920 Ga0207649_10567708 Ga0207649_105677081 141
279 3300025924 Ga0207694_10123874 Ga0207694_101238742 141
280 3300025924 Ga0207694_10317039 Ga0207694_103170393 141
281 3300025924 Ga0207694_10709762 Ga0207694_107097622 141
282 3300025926 Ga0207659_10544506 Ga0207659_105445061 141
283 3300025935 Ga0207709_10583138 Ga0207709_105831382 141
284 3300025936 Ga0207670_10003731 Ga0207670_100037317 141
285 3300025936 Ga0207670_10006013 Ga0207670_100060132 141
286 3300025941 Ga0207711_10387715 Ga0207711_103877152 141
287 3300025972 Ga0207668_10209602 Ga0207668_102096021 141
288 3300025972 Ga0207668_10995913 Ga0207668_109959132 141
289 3300025986 Ga0207658_10458445 Ga0207658_104584452 141
290 3300026088 Ga0207641_11354785 Ga0207641_113547851 141
291 3300027682 Ga0209971_1111874 Ga0209971_11118741 141
292 3300027695 Ga0209966_1136187 Ga0209966_11361871 141
293 3300027907 Ga0207428_10006893 Ga0207428_100068937 141
294 3300028379 Ga0268266_12329203 Ga0268266_123292031 141
295 3300028380 Ga0268265_10078480 Ga0268265_100784802 141
296 3300028380 Ga0268265_10088957 Ga0268265_100889572 141
297 3300028380 Ga0268265_11218394 Ga0268265_112183942 141
298 3300028381 Ga0268264_10037555 Ga0268264_100375553 141
299 3300031240 Ga0265320_10163132 Ga0265320_101631321 141
300 3300031548 Ga0307408_100202503 Ga0307408_1002025032 141
301 3300031711 Ga0265314_10140133 Ga0265314_101401332 141
302 3300031712 Ga0265342_10006393 Ga0265342_100063937 141
303 3300031730 Ga0307516_10142830 Ga0307516_101428303 141
304 3300031901 Ga0307406_10100677 Ga0307406_101006773 141
305 3300032005 Ga0307411_10106621 Ga0307411_101066213 141
306 3300032126 Ga0307415_100264827 Ga0307415_1002648272 141
307 3300044842 Ga0466957_0002945 Ga0466957_0002945_1359_1793 141
308 3300046519 Ga0495632_0000062 Ga0495632_0000062_37790_38218 141
309 3300046665 Ga0495661_0060350 Ga0495661_0060350_1420_1848 141
310 3300046694 Ga0495649_0248956 Ga0495649_0248956_232_669 141
311 3300049669 Ga0501235_042410 Ga0501235_042410_528_959 141
312 3300049686 Ga0501257_068873 Ga0501257_068873_214_645 141
313 3300049772 Ga0501275_061458 Ga0501275_061458_96_527 141
314 3300050511 nmdc:mga08y16_308477_c1 nmdc:mga08y16_308477_c1_615_1043 141
315 3300055283 Ga0500661_002185 Ga0500661_002185_2233_2661 141
316 3300005536 Ga0070697_100253010 Ga0070697_1002530103 142
317 3300006237 Ga0097621_101094035 Ga0097621_1010940352 142
318 3300031903 Ga0307407_10541272 Ga0307407_105412722 142
319 3300046472 Ga0495580_0003700 Ga0495580_0003700_6658_7107 142
320 3300046538 Ga0495609_0005761 Ga0495609_0005761_5060_5509 142
321 3300046542 Ga0495597_0001279 Ga0495597_0001279_2260_2709 142
322 3300005329 Ga0070683_100177816 Ga0070683_1001778162 143
323 3300005366 Ga0070659_100063485 Ga0070659_1000634853 143
324 3300005530 Ga0070679_100677493 Ga0070679_1006774931 143
325 3300005539 Ga0068853_100023505 Ga0068853_1000235056 143
326 3300005563 Ga0068855_100097841 Ga0068855_1000978413 143
327 3300005563 Ga0068855_100177794 Ga0068855_1001777943 143
328 3300005616 Ga0068852_100024815 Ga0068852_1000248152 143
329 3300009093 Ga0105240_10048078 Ga0105240_100480783 143
330 3300013102 Ga0157371_10558719 Ga0157371_105587191 143
331 3300013105 Ga0157369_10645569 Ga0157369_106455691 143
332 3300013307 Ga0157372_10007996 Ga0157372_100079966 143
333 3300013307 Ga0157372_10683647 Ga0157372_106836471 143
334 3300013307 Ga0157372_10731049 Ga0157372_107310492 143
335 3300025909 Ga0207705_11549220 Ga0207705_115492201 143
336 3300025913 Ga0207695_10091470 Ga0207695_100914703 143
337 3300025921 Ga0207652_10741369 Ga0207652_107413692 143
338 3300025924 Ga0207694_10034499 Ga0207694_100344994 143
339 3300025945 Ga0207679_10853995 Ga0207679_108539952 143
340 3300025949 Ga0207667_10109452 Ga0207667_101094523 143
341 3300025949 Ga0207667_10156591 Ga0207667_101565911 143
342 3300026041 Ga0207639_10040691 Ga0207639_100406913 143
343 3300026142 Ga0207698_10022760 Ga0207698_100227606 143
344 3300037418 Ga0395900_0198719 Ga0395900_0198719_20_451 143
345 3300037471 Ga0395905_1105695 Ga0395905_1105695_28_459 143
346 3300054114 Ga0501084_0093869 Ga0501084_0093869_226_657 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

26

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7282 1 116
8bi8-assembly2.cif.gz_B structure of a cyclic beta-hairpin peptide derived from neuronal nitric oxide synthase 0.697 51 66
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6831 1 116
8bi8-assembly1.cif.gz_A structure of a cyclic beta-hairpin peptide derived from neuronal nitric oxide synthase 0.6429 51 66
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.635 1 116
ID Description Score Start End Superfamily
af_P35421_862_1029_3.90.650.10 Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain 0.7794 18 43 3.90.650.10
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7282 1 116 3.30.70.1060
2icsA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.7269 51 67 2.30.40.10
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6831 1 116 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6829 1 116 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A366GCQ1-F1-model_v4 deleted 0.9244 1 121
AF-A0A142YAK4-F1-model_v4 YCII-related domain protein 0.9204 1 137
AF-A0A5C4T2R4-F1-model_v4 YciI family protein 0.918 1 119
AF-A0A261TB04-F1-model_v4 YCII-related domain-containing protein 0.9175 1 120
AF-A0A1W6ZJC4-F1-model_v4 Dehydrogenase 0.9167 1 121

Feature Viewer

pLDDT pTM Quality
92.12 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map