F416758
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 198 | 343 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10558719|Ga0157371_105587191 |
| Length | 169 |
| Sequence | LVKSEVGRPATVEASDDQETFGDTDMRFMVIVKASKNSEAGIMPGAELLAAMGKFNEEMVKAGVMLAGEGLQPSSKGARIRFGLDGKRTVVDGPFAETKELVAGFWLIQVKSKEEAIEWMRRCPAPMPGEESELEIRQVFEAADFGAEFTPELREQEERLRDQIAAKTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 2 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 104 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 107 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 114 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 115 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 116 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 117 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 189 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 190 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 198 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 0.29 |
| Rhizoplane | 3.18 |
| Rhizosphere | 89.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100177816 | 3300005329 | Bacteria | 2020 |
| 2 | Ga0070660_101194287 | 3300005339 | Bacteria | 645 |
| 3 | Ga0070689_100004093 | 3300005340 | Bacteria | 9820 |
| 4 | Ga0070689_100071239 | 3300005340 | Bacteria | 2715 |
| 5 | Ga0070661_100008913 | 3300005344 | Bacteria | 6943 |
| 6 | Ga0070668_100895668 | 3300005347 | Bacteria | 793 |
| 7 | Ga0070675_101023556 | 3300005354 | Bacteria | 758 |
| 8 | Ga0070674_100036112 | 3300005356 | Bacteria | 3315 |
| 9 | Ga0070688_100260030 | 3300005365 | Bacteria | 1239 |
| 10 | Ga0070659_100063485 | 3300005366 | Bacteria | 2922 |
| 11 | Ga0070667_100026126 | 3300005367 | Bacteria | 4856 |
| 12 | Ga0070667_100511851 | 3300005367 | Bacteria | 1101 |
| 13 | Ga0070714_100010824 | 3300005435 | Bacteria | 7224 |
| 14 | Ga0070663_100042597 | 3300005455 | Bacteria | 3191 |
| 15 | Ga0070662_101380213 | 3300005457 | Bacteria | 607 |
| 16 | Ga0070685_10008929 | 3300005466 | Bacteria | 5171 |
| 17 | Ga0070706_100213272 | 3300005467 | Bacteria | 1802 |
| 18 | Ga0070707_100235419 | 3300005468 | Bacteria | 1782 |
| 19 | Ga0070707_102270387 | 3300005468 | Bacteria | 510 |
| 20 | Ga0070699_100000445 | 3300005518 | Bacteria | 39754 |
| 21 | Ga0070679_100677493 | 3300005530 | Bacteria | 974 |
| 22 | Ga0070697_100253010 | 3300005536 | Bacteria | 1507 |
| 23 | Ga0068853_100023505 | 3300005539 | Bacteria | 5161 |
| 24 | Ga0070686_100959460 | 3300005544 | Bacteria | 699 |
| 25 | Ga0070693_100038959 | 3300005547 | Bacteria | 2660 |
| 26 | Ga0068855_100097841 | 3300005563 | Bacteria | 3380 |
| 27 | Ga0068855_100177794 | 3300005563 | Bacteria | 2407 |
| 28 | Ga0068855_100898875 | 3300005563 | Bacteria | 936 |
| 29 | Ga0068857_100854049 | 3300005577 | Bacteria | 871 |
| 30 | Ga0068856_101483295 | 3300005614 | Bacteria | 692 |
| 31 | Ga0068852_100024815 | 3300005616 | Bacteria | 4850 |
| 32 | Ga0068852_101594777 | 3300005616 | Bacteria | 675 |
| 33 | Ga0068859_100165228 | 3300005617 | Bacteria | 2293 |
| 34 | Ga0068859_100177327 | 3300005617 | Bacteria | 2213 |
| 35 | Ga0068851_10419767 | 3300005834 | Bacteria | 790 |
| 36 | Ga0068860_100281222 | 3300005843 | Bacteria | 1626 |
| 37 | Ga0068860_100313223 | 3300005843 | Bacteria | 1539 |
| 38 | Ga0068862_100094500 | 3300005844 | Bacteria | 2608 |
| 39 | Ga0068862_100351494 | 3300005844 | Bacteria | 1368 |
| 40 | Ga0081455_10130602 | 3300005937 | Bacteria | 1964 |
| 41 | Ga0097621_100164198 | 3300006237 | Bacteria | 1911 |
| 42 | Ga0097621_100278838 | 3300006237 | Bacteria | 1471 |
| 43 | Ga0097621_101094035 | 3300006237 | Bacteria | 748 |
| 44 | Ga0068871_100117732 | 3300006358 | Bacteria | 2241 |
| 45 | Ga0068871_100309663 | 3300006358 | Bacteria | 1388 |
| 46 | Ga0097620_100165228 | 3300006931 | Bacteria | 2293 |
| 47 | Ga0097620_100177329 | 3300006931 | Bacteria | 2213 |
| 48 | Ga0105240_10048078 | 3300009093 | Bacteria | 5394 |
| 49 | Ga0111539_10054526 | 3300009094 | Bacteria | 4756 |
| 50 | Ga0111539_10616000 | 3300009094 | Bacteria | 1264 |
| 51 | Ga0105247_10003557 | 3300009101 | Bacteria | 10132 |
| 52 | Ga0105243_10756921 | 3300009148 | Bacteria | 953 |
| 53 | Ga0105248_10695476 | 3300009177 | Bacteria | 1147 |
| 54 | Ga0105238_10059228 | 3300009551 | Bacteria | 3836 |
| 55 | Ga0105238_10154418 | 3300009551 | Bacteria | 2270 |
| 56 | Ga0105238_10212293 | 3300009551 | Bacteria | 1912 |
| 57 | Ga0105238_10472158 | 3300009551 | Bacteria | 1253 |
| 58 | Ga0105239_10565891 | 3300010375 | Bacteria | 1295 |
| 59 | Ga0157371_10262329 | 3300013102 | Bacteria | 1246 |
| 60 | Ga0157371_10558719 | 3300013102 | Bacteria | 849 |
| 61 | Ga0157370_10816266 | 3300013104 | Bacteria | 848 |
| 62 | Ga0157369_10002483 | 3300013105 | Bacteria | 22088 |
| 63 | Ga0157369_10645569 | 3300013105 | Bacteria | 1092 |
| 64 | Ga0157378_10000158 | 3300013297 | Bacteria | 64291 |
| 65 | Ga0163162_10089022 | 3300013306 | Bacteria | 3167 |
| 66 | Ga0157372_10007996 | 3300013307 | Bacteria | 11248 |
| 67 | Ga0157372_10096201 | 3300013307 | Bacteria | 3374 |
| 68 | Ga0157372_10683647 | 3300013307 | Bacteria | 1194 |
| 69 | Ga0157372_10731049 | 3300013307 | Bacteria | 1151 |
| 70 | Ga0157375_11357090 | 3300013308 | Bacteria | 837 |
| 71 | Ga0163163_10249301 | 3300014325 | Bacteria | 1826 |
| 72 | Ga0157380_12263062 | 3300014326 | Bacteria | 608 |
| 73 | Ga0182008_10017220 | 3300014497 | Bacteria | 3749 |
| 74 | Ga0157376_10027002 | 3300014969 | Bacteria | 4545 |
| 75 | Ga0163161_10267645 | 3300017792 | Bacteria | 1336 |
| 76 | Ga0209435_101530 | 3300025206 | Bacteria | 2889 |
| 77 | Ga0209784_100143 | 3300025224 | Bacteria | 65902 |
| 78 | Ga0209566_102059 | 3300025225 | Bacteria | 4193 |
| 79 | Ga0209672_102706 | 3300025228 | Bacteria | 4117 |
| 80 | Ga0207427_100059 | 3300025231 | Bacteria | 186680 |
| 81 | Ga0209437_100123 | 3300025233 | Bacteria | 200393 |
| 82 | Ga0209258_100281 | 3300025242 | Bacteria | 85049 |
| 83 | Ga0209646_1000488 | 3300025246 | Bacteria | 19175 |
| 84 | Ga0209026_1000174 | 3300025250 | Bacteria | 98063 |
| 85 | Ga0209148_1000121 | 3300025254 | Bacteria | 186730 |
| 86 | Ga0209759_1000216 | 3300025256 | Bacteria | 88494 |
| 87 | Ga0209233_1000136 | 3300025261 | Bacteria | 200393 |
| 88 | Ga0209233_1039624 | 3300025261 | Bacteria | 1031 |
| 89 | Ga0209455_1000120 | 3300025272 | Bacteria | 173966 |
| 90 | Ga0207710_10003510 | 3300025900 | Bacteria | 6969 |
| 91 | Ga0207645_10421442 | 3300025907 | Bacteria | 899 |
| 92 | Ga0207705_10361406 | 3300025909 | Bacteria | 1120 |
| 93 | Ga0207705_11549220 | 3300025909 | Bacteria | 501 |
| 94 | Ga0207684_10093627 | 3300025910 | Bacteria | 2562 |
| 95 | Ga0207695_10091470 | 3300025913 | Bacteria | 3056 |
| 96 | Ga0207663_10736233 | 3300025916 | Bacteria | 782 |
| 97 | Ga0207649_10567708 | 3300025920 | Bacteria | 870 |
| 98 | Ga0207652_10741369 | 3300025921 | Bacteria | 875 |
| 99 | Ga0207646_10000904 | 3300025922 | Bacteria | 38211 |
| 100 | Ga0207694_10034499 | 3300025924 | Bacteria | 3880 |
| 101 | Ga0207694_10123874 | 3300025924 | Bacteria | 2066 |
| 102 | Ga0207694_10317039 | 3300025924 | Bacteria | 1286 |
| 103 | Ga0207694_10709762 | 3300025924 | Bacteria | 848 |
| 104 | Ga0207659_10544506 | 3300025926 | Bacteria | 986 |
| 105 | Ga0207664_10035254 | 3300025929 | Bacteria | 3859 |
| 106 | Ga0207709_10583138 | 3300025935 | Bacteria | 883 |
| 107 | Ga0207670_10003731 | 3300025936 | Bacteria | 8088 |
| 108 | Ga0207670_10006013 | 3300025936 | Bacteria | 6706 |
| 109 | Ga0207711_10387715 | 3300025941 | Bacteria | 1297 |
| 110 | Ga0207679_10853995 | 3300025945 | Bacteria | 831 |
| 111 | Ga0207667_10109452 | 3300025949 | Bacteria | 2849 |
| 112 | Ga0207667_10156591 | 3300025949 | Bacteria | 2344 |
| 113 | Ga0207668_10209602 | 3300025972 | Bacteria | 1558 |
| 114 | Ga0207668_10995913 | 3300025972 | Bacteria | 749 |
| 115 | Ga0207658_10016465 | 3300025986 | Bacteria | 5085 |
| 116 | Ga0207658_10458445 | 3300025986 | Bacteria | 1130 |
| 117 | Ga0207639_10040691 | 3300026041 | Bacteria | 3471 |
| 118 | Ga0207641_11354785 | 3300026088 | Bacteria | 712 |
| 119 | Ga0207698_10022760 | 3300026142 | Bacteria | 4364 |
| 120 | Ga0209971_1111874 | 3300027682 | Bacteria | 670 |
| 121 | Ga0209966_1136187 | 3300027695 | Bacteria | 568 |
| 122 | Ga0209998_10089347 | 3300027717 | Bacteria | 754 |
| 123 | Ga0207428_10006893 | 3300027907 | Bacteria | 10411 |
| 124 | Ga0268266_12329203 | 3300028379 | Bacteria | 507 |
| 125 | Ga0268265_10078480 | 3300028380 | Bacteria | 2597 |
| 126 | Ga0268265_10088957 | 3300028380 | Bacteria | 2462 |
| 127 | Ga0268265_11218394 | 3300028380 | Bacteria | 751 |
| 128 | Ga0268264_10037555 | 3300028381 | Bacteria | 3994 |
| 129 | Ga0265320_10163132 | 3300031240 | Bacteria | 1003 |
| 130 | Ga0307408_100202503 | 3300031548 | Bacteria | 1608 |
| 131 | Ga0265314_10140133 | 3300031711 | Bacteria | 1496 |
| 132 | Ga0265342_10006393 | 3300031712 | Bacteria | 8780 |
| 133 | Ga0307516_10142830 | 3300031730 | Bacteria | 2161 |
| 134 | Ga0307516_10374645 | 3300031730 | Bacteria | 1086 |
| 135 | Ga0307406_10100677 | 3300031901 | Bacteria | 1968 |
| 136 | Ga0307407_10541272 | 3300031903 | Bacteria | 859 |
| 137 | Ga0307407_11388989 | 3300031903 | Bacteria | 553 |
| 138 | Ga0307411_10106621 | 3300032005 | Bacteria | 1995 |
| 139 | Ga0307415_100264827 | 3300032126 | Bacteria | 1405 |
| 140 | Ga0373961_0092624 | 3300035241 | Bacteria | 968 |
| 141 | Ga0395899_0099815 | 3300037312 | Bacteria | 2096 |
| 142 | Ga0395899_0371008 | 3300037312 | Bacteria | 953 |
| 143 | Ga0395900_0198719 | 3300037418 | Bacteria | 2030 |
| 144 | Ga0395900_0223393 | 3300037418 | Bacteria | 1897 |
| 145 | Ga0395898_0432732 | 3300037466 | Bacteria | 1254 |
| 146 | Ga0395905_0019609 | 3300037471 | Bacteria | 6410 |
| 147 | Ga0395905_0047779 | 3300037471 | Bacteria | 4010 |
| 148 | Ga0395905_0101066 | 3300037471 | Bacteria | 2707 |
| 149 | Ga0395905_0685432 | 3300037471 | Bacteria | 927 |
| 150 | Ga0395905_1105695 | 3300037471 | Bacteria | 696 |
| 151 | Ga0395901_0031629 | 3300038443 | Bacteria | 5455 |
| 152 | Ga0436361_0284091 | 3300039447 | Bacteria | 2934 |
| 153 | Ga0436361_0803224 | 3300039447 | Bacteria | 18078 |
| 154 | Ga0436363_1113167 | 3300039450 | Bacteria | 1111 |
| 155 | Ga0451853_3519164 | 3300041512 | Bacteria | 817 |
| 156 | Ga0466970_0404415 | 3300044765 | Bacteria | 779 |
| 157 | Ga0466957_0002945 | 3300044842 | Bacteria | 9226 |
| 158 | Ga0451576_2257446 | 3300045051 | Bacteria | 558 |
| 159 | Ga0495617_112567 | 3300046452 | Bacteria | 880 |
| 160 | Ga0495627_004140 | 3300046453 | Bacteria | 6155 |
| 161 | Ga0495627_008951 | 3300046453 | Bacteria | 3702 |
| 162 | Ga0495627_087279 | 3300046453 | Bacteria | 899 |
| 163 | Ga0495603_0034324 | 3300046455 | Bacteria | 3049 |
| 164 | Ga0495603_0140373 | 3300046455 | Bacteria | 1405 |
| 165 | Ga0495590_0063016 | 3300046457 | Bacteria | 1297 |
| 166 | Ga0495638_0000275 | 3300046460 | Bacteria | 69671 |
| 167 | Ga0495638_0080592 | 3300046460 | Bacteria | 1978 |
| 168 | Ga0495653_0009121 | 3300046463 | Bacteria | 8111 |
| 169 | Ga0495650_0000409 | 3300046471 | Bacteria | 70670 |
| 170 | Ga0495580_0003700 | 3300046472 | Bacteria | 12962 |
| 171 | Ga0495605_0001089 | 3300046474 | Bacteria | 18098 |
| 172 | Ga0495605_0003743 | 3300046474 | Bacteria | 9029 |
| 173 | Ga0495605_0057946 | 3300046474 | Bacteria | 1863 |
| 174 | Ga0495605_0098735 | 3300046474 | Bacteria | 1345 |
| 175 | Ga0495584_0000936 | 3300046491 | Bacteria | 18423 |
| 176 | Ga0495584_0013227 | 3300046491 | Bacteria | 4212 |
| 177 | Ga0495584_0027339 | 3300046491 | Bacteria | 2890 |
| 178 | Ga0495584_0038278 | 3300046491 | Bacteria | 2424 |
| 179 | Ga0495585_0000752 | 3300046492 | Bacteria | 28704 |
| 180 | Ga0495585_0002719 | 3300046492 | Bacteria | 12362 |
| 181 | Ga0495585_0012411 | 3300046492 | Bacteria | 5020 |
| 182 | Ga0495585_0032321 | 3300046492 | Bacteria | 2964 |
| 183 | Ga0495585_0038037 | 3300046492 | Bacteria | 2709 |
| 184 | Ga0495594_0007647 | 3300046499 | Bacteria | 5559 |
| 185 | Ga0495594_0012321 | 3300046499 | Bacteria | 4454 |
| 186 | Ga0495594_0085682 | 3300046499 | Bacteria | 1762 |
| 187 | Ga0495596_0000776 | 3300046500 | Bacteria | 19474 |
| 188 | Ga0495596_0003928 | 3300046500 | Bacteria | 7363 |
| 189 | Ga0495596_0004014 | 3300046500 | Bacteria | 7261 |
| 190 | Ga0495607_0010190 | 3300046501 | Bacteria | 6323 |
| 191 | Ga0495607_0097384 | 3300046501 | Bacteria | 1582 |
| 192 | Ga0495583_0019955 | 3300046506 | Bacteria | 3485 |
| 193 | Ga0495583_0025239 | 3300046506 | Bacteria | 2972 |
| 194 | Ga0495583_0027021 | 3300046506 | Bacteria | 2836 |
| 195 | Ga0495583_0054520 | 3300046506 | Bacteria | 1810 |
| 196 | Ga0495606_0010329 | 3300046507 | Bacteria | 7764 |
| 197 | Ga0495606_0030200 | 3300046507 | Bacteria | 3789 |
| 198 | Ga0495610_0001568 | 3300046512 | Bacteria | 20138 |
| 199 | Ga0495610_0020015 | 3300046512 | Bacteria | 3727 |
| 200 | Ga0495616_0006793 | 3300046513 | Bacteria | 6896 |
| 201 | Ga0495616_0014217 | 3300046513 | Bacteria | 4464 |
| 202 | Ga0495616_0019124 | 3300046513 | Bacteria | 3743 |
| 203 | Ga0495616_0059791 | 3300046513 | Bacteria | 1873 |
| 204 | Ga0495616_0230042 | 3300046513 | Bacteria | 804 |
| 205 | Ga0495630_0125116 | 3300046517 | Bacteria | 1951 |
| 206 | Ga0495631_0001988 | 3300046518 | Bacteria | 11954 |
| 207 | Ga0495631_0003557 | 3300046518 | Bacteria | 8518 |
| 208 | Ga0495631_0007081 | 3300046518 | Bacteria | 5736 |
| 209 | Ga0495631_0010308 | 3300046518 | Bacteria | 4627 |
| 210 | Ga0495631_0276277 | 3300046518 | Bacteria | 715 |
| 211 | Ga0495632_0000062 | 3300046519 | Bacteria | 118205 |
| 212 | Ga0495632_0000235 | 3300046519 | Bacteria | 55317 |
| 213 | Ga0495632_0064366 | 3300046519 | Bacteria | 1773 |
| 214 | Ga0495644_0089366 | 3300046523 | Bacteria | 1162 |
| 215 | Ga0495644_0113963 | 3300046523 | Bacteria | 1026 |
| 216 | Ga0495644_0195385 | 3300046523 | Bacteria | 779 |
| 217 | Ga0495648_0011902 | 3300046524 | Bacteria | 6525 |
| 218 | Ga0495648_0119869 | 3300046524 | Bacteria | 1416 |
| 219 | Ga0495648_0133560 | 3300046524 | Bacteria | 1316 |
| 220 | Ga0495648_0204010 | 3300046524 | Bacteria | 987 |
| 221 | Ga0495642_0000559 | 3300046528 | Bacteria | 18799 |
| 222 | Ga0495642_0003074 | 3300046528 | Bacteria | 6636 |
| 223 | Ga0495642_0008094 | 3300046528 | Bacteria | 4023 |
| 224 | Ga0495642_0013850 | 3300046528 | Bacteria | 3123 |
| 225 | Ga0495642_0038997 | 3300046528 | Bacteria | 1926 |
| 226 | Ga0495642_0121437 | 3300046528 | Bacteria | 1121 |
| 227 | Ga0495654_0009581 | 3300046530 | Bacteria | 5305 |
| 228 | Ga0495654_0049930 | 3300046530 | Bacteria | 2046 |
| 229 | Ga0495654_0169091 | 3300046530 | Bacteria | 954 |
| 230 | Ga0495665_0053745 | 3300046531 | Bacteria | 2129 |
| 231 | Ga0495587_0049680 | 3300046536 | Bacteria | 2483 |
| 232 | Ga0495609_0005761 | 3300046538 | Bacteria | 6437 |
| 233 | Ga0495609_0008133 | 3300046538 | Bacteria | 5163 |
| 234 | Ga0495609_0031377 | 3300046538 | Bacteria | 2416 |
| 235 | Ga0495609_0051967 | 3300046538 | Bacteria | 1823 |
| 236 | Ga0495609_0239665 | 3300046538 | Bacteria | 749 |
| 237 | Ga0495597_0001279 | 3300046542 | Bacteria | 18545 |
| 238 | Ga0495597_0002219 | 3300046542 | Bacteria | 12720 |
| 239 | Ga0495597_0002615 | 3300046542 | Bacteria | 11204 |
| 240 | Ga0495597_0179352 | 3300046542 | Bacteria | 856 |
| 241 | Ga0495633_0002672 | 3300046558 | Bacteria | 12403 |
| 242 | Ga0495633_0019488 | 3300046558 | Bacteria | 3430 |
| 243 | Ga0495633_0250829 | 3300046558 | Bacteria | 807 |
| 244 | Ga0495656_0031934 | 3300046615 | Bacteria | 2139 |
| 245 | Ga0495656_0068264 | 3300046615 | Bacteria | 1571 |
| 246 | Ga0495656_0177972 | 3300046615 | Bacteria | 1044 |
| 247 | Ga0495668_0001519 | 3300046616 | Bacteria | 22052 |
| 248 | Ga0495668_0008100 | 3300046616 | Bacteria | 6617 |
| 249 | Ga0495668_0012832 | 3300046616 | Bacteria | 4963 |
| 250 | Ga0495668_0017148 | 3300046616 | Bacteria | 4206 |
| 251 | Ga0495668_0175127 | 3300046616 | Bacteria | 1175 |
| 252 | Ga0495611_0004228 | 3300046648 | Bacteria | 6250 |
| 253 | Ga0495611_0009631 | 3300046648 | Bacteria | 4081 |
| 254 | Ga0495611_0156783 | 3300046648 | Bacteria | 1063 |
| 255 | Ga0495625_0031054 | 3300046660 | Bacteria | 3977 |
| 256 | Ga0495625_0113612 | 3300046660 | Bacteria | 1849 |
| 257 | Ga0495625_0117593 | 3300046660 | Bacteria | 1812 |
| 258 | Ga0495635_0671953 | 3300046663 | Bacteria | 673 |
| 259 | Ga0495635_0933503 | 3300046663 | Bacteria | 554 |
| 260 | Ga0495661_0002081 | 3300046665 | Bacteria | 15698 |
| 261 | Ga0495661_0010028 | 3300046665 | Bacteria | 6476 |
| 262 | Ga0495661_0020527 | 3300046665 | Bacteria | 4311 |
| 263 | Ga0495661_0045743 | 3300046665 | Bacteria | 2675 |
| 264 | Ga0495661_0060350 | 3300046665 | Bacteria | 2253 |
| 265 | Ga0495661_0121104 | 3300046665 | Bacteria | 1445 |
| 266 | Ga0495661_0152667 | 3300046665 | Bacteria | 1246 |
| 267 | Ga0495588_0060307 | 3300046674 | Bacteria | 1963 |
| 268 | Ga0495588_0070294 | 3300046674 | Bacteria | 1819 |
| 269 | Ga0495588_0235202 | 3300046674 | Bacteria | 966 |
| 270 | Ga0495669_0020081 | 3300046684 | Bacteria | 2888 |
| 271 | Ga0495669_0027346 | 3300046684 | Bacteria | 2495 |
| 272 | Ga0495613_0087920 | 3300046689 | Bacteria | 2252 |
| 273 | Ga0495670_0004330 | 3300046691 | Bacteria | 6958 |
| 274 | Ga0495670_0015068 | 3300046691 | Bacteria | 3803 |
| 275 | Ga0495670_0041976 | 3300046691 | Bacteria | 2282 |
| 276 | Ga0495670_0073398 | 3300046691 | Bacteria | 1734 |
| 277 | Ga0495670_0659333 | 3300046691 | Bacteria | 570 |
| 278 | Ga0495671_0003583 | 3300046692 | Bacteria | 9485 |
| 279 | Ga0495671_0008001 | 3300046692 | Bacteria | 5975 |
| 280 | Ga0495671_0011158 | 3300046692 | Bacteria | 4956 |
| 281 | Ga0495671_0327479 | 3300046692 | Bacteria | 735 |
| 282 | Ga0495649_0053852 | 3300046694 | Bacteria | 2177 |
| 283 | Ga0495649_0058352 | 3300046694 | Bacteria | 2079 |
| 284 | Ga0495649_0074954 | 3300046694 | Bacteria | 1812 |
| 285 | Ga0495649_0122537 | 3300046694 | Bacteria | 1374 |
| 286 | Ga0495649_0248956 | 3300046694 | Bacteria | 913 |
| 287 | Ga0495589_0067628 | 3300046794 | Bacteria | 1748 |
| 288 | Ga0495589_0113435 | 3300046794 | Bacteria | 1307 |
| 289 | Ga0495660_0009864 | 3300046810 | Bacteria | 5556 |
| 290 | Ga0495660_0028729 | 3300046810 | Bacteria | 3139 |
| 291 | Ga0495660_0487730 | 3300046810 | Bacteria | 528 |
| 292 | Ga0495680_0003786 | 3300047322 | Bacteria | 14708 |
| 293 | Ga0495683_0160880 | 3300047323 | Bacteria | 1038 |
| 294 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 295 | Ga0495687_004590 | 3300047443 | Bacteria | 9240 |
| 296 | Ga0495677_0003618 | 3300047445 | Bacteria | 5991 |
| 297 | Ga0495677_0093887 | 3300047445 | Bacteria | 1132 |
| 298 | Ga0495677_0152454 | 3300047445 | Bacteria | 890 |
| 299 | Ga0495677_0187965 | 3300047445 | Bacteria | 801 |
| 300 | Ga0495677_0221846 | 3300047445 | Bacteria | 736 |
| 301 | Ga0495681_0003523 | 3300047470 | Bacteria | 10879 |
| 302 | Ga0495681_0004070 | 3300047470 | Bacteria | 10058 |
| 303 | Ga0495681_0051008 | 3300047470 | Bacteria | 1947 |
| 304 | Ga0495681_0152306 | 3300047470 | Bacteria | 969 |
| 305 | Ga0495686_0001168 | 3300047472 | Bacteria | 30722 |
| 306 | Ga0495593_0029660 | 3300047673 | Bacteria | 2998 |
| 307 | Ga0495626_0017487 | 3300048091 | Bacteria | 3617 |
| 308 | Ga0495626_0037713 | 3300048091 | Bacteria | 2295 |
| 309 | Ga0496102_0000861 | 3300048905 | Bacteria | 29100 |
| 310 | Ga0496104_0349574 | 3300048907 | Bacteria | 1391 |
| 311 | Ga0496106_0205618 | 3300048909 | Bacteria | 1568 |
| 312 | Ga0496107_0136973 | 3300048910 | Bacteria | 1809 |
| 313 | Ga0496110_0000019 | 3300048913 | Bacteria | 79137 |
| 314 | Ga0496110_0090009 | 3300048913 | Bacteria | 2743 |
| 315 | Ga0496111_0048157 | 3300048914 | Bacteria | 3071 |
| 316 | Ga0496111_0115975 | 3300048914 | Bacteria | 1975 |
| 317 | Ga0496114_0119028 | 3300048917 | Bacteria | 2270 |
| 318 | Ga0496114_0267441 | 3300048917 | Bacteria | 1506 |
| 319 | Ga0496115_0117316 | 3300048918 | Bacteria | 2189 |
| 320 | Ga0496121_0219104 | 3300048924 | Bacteria | 1342 |
| 321 | Ga0496121_0334523 | 3300048924 | Bacteria | 1014 |
| 322 | Ga0496125_0199037 | 3300048928 | Bacteria | 1314 |
| 323 | Ga0496126_0488379 | 3300048929 | Bacteria | 986 |
| 324 | Ga0496126_0601188 | 3300048929 | Bacteria | 866 |
| 325 | Ga0495678_004221 | 3300049459 | Bacteria | 8442 |
| 326 | Ga0495678_021533 | 3300049459 | Bacteria | 2836 |
| 327 | Ga0495678_064039 | 3300049459 | Bacteria | 1370 |
| 328 | Ga0495682_0002851 | 3300049460 | Bacteria | 7964 |
| 329 | Ga0501039_0346302 | 3300049575 | Bacteria | 1168 |
| 330 | Ga0501041_0091993 | 3300049577 | Bacteria | 1873 |
| 331 | Ga0501072_1145937 | 3300049588 | Bacteria | 605 |
| 332 | Ga0501077_0498309 | 3300049593 | Bacteria | 781 |
| 333 | Ga0501235_042410 | 3300049669 | Bacteria | 1043 |
| 334 | Ga0501238_002064 | 3300049671 | Bacteria | 2364 |
| 335 | Ga0501257_068873 | 3300049686 | Bacteria | 902 |
| 336 | Ga0501080_0609409 | 3300049742 | Bacteria | 969 |
| 337 | Ga0501275_061458 | 3300049772 | Bacteria | 573 |
| 338 | nmdc:mga0qj67_176404_c1 | 3300050509 | Bacteria | 1735 |
| 339 | nmdc:mga08y16_308477_c1 | 3300050511 | Bacteria | 1630 |
| 340 | nmdc:mga08y16_9544_c1 | 3300050511 | Bacteria | 10185 |
| 341 | nmdc:mga0a205_67832_c1 | 3300050515 | Bacteria | 3445 |
| 342 | Ga0501084_0093869 | 3300054114 | Bacteria | 2519 |
| 343 | Ga0500661_002185 | 3300055283 | Bacteria | 3690 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0432732 | Ga0395898_0432732_894_1241 | 114 |
| 2 | 3300046558 | Ga0495633_0250829 | Ga0495633_0250829_442_792 | 114 |
| 3 | 3300046794 | Ga0495589_0067628 | Ga0495589_0067628_11_358 | 114 |
| 4 | 3300049588 | Ga0501072_1145937 | Ga0501072_1145937_12_377 | 120 |
| 5 | 3300031903 | Ga0307407_11388989 | Ga0307407_113889892 | 121 |
| 6 | 3300037471 | Ga0395905_0019609 | Ga0395905_0019609_24_398 | 123 |
| 7 | 3300046663 | Ga0495635_0933503 | Ga0495635_0933503_34_408 | 123 |
| 8 | 3300046691 | Ga0495670_0659333 | Ga0495670_0659333_27_401 | 123 |
| 9 | 3300046694 | Ga0495649_0074954 | Ga0495649_0074954_11_397 | 123 |
| 10 | 3300046474 | Ga0495605_0057946 | Ga0495605_0057946_794_1240 | 124 |
| 11 | 3300046491 | Ga0495584_0027339 | Ga0495584_0027339_360_806 | 124 |
| 12 | 3300046528 | Ga0495642_0038997 | Ga0495642_0038997_1061_1507 | 124 |
| 13 | 3300046530 | Ga0495654_0049930 | Ga0495654_0049930_875_1321 | 124 |
| 14 | 3300046542 | Ga0495597_0002219 | Ga0495597_0002219_11304_11750 | 124 |
| 15 | 3300046616 | Ga0495668_0012832 | Ga0495668_0012832_2213_2659 | 124 |
| 16 | 3300046794 | Ga0495589_0113435 | Ga0495589_0113435_416_862 | 124 |
| 17 | 3300046455 | Ga0495603_0034324 | Ga0495603_0034324_80_505 | 130 |
| 18 | 3300046474 | Ga0495605_0003743 | Ga0495605_0003743_8439_8864 | 130 |
| 19 | 3300046492 | Ga0495585_0038037 | Ga0495585_0038037_1728_2153 | 130 |
| 20 | 3300046499 | Ga0495594_0085682 | Ga0495594_0085682_511_936 | 130 |
| 21 | 3300046513 | Ga0495616_0006793 | Ga0495616_0006793_4953_5378 | 130 |
| 22 | 3300046518 | Ga0495631_0007081 | Ga0495631_0007081_4546_4971 | 130 |
| 23 | 3300046518 | Ga0495631_0010308 | Ga0495631_0010308_1816_2241 | 130 |
| 24 | 3300046524 | Ga0495648_0204010 | Ga0495648_0204010_43_468 | 130 |
| 25 | 3300046528 | Ga0495642_0003074 | Ga0495642_0003074_1792_2217 | 130 |
| 26 | 3300046530 | Ga0495654_0009581 | Ga0495654_0009581_4124_4549 | 130 |
| 27 | 3300046538 | Ga0495609_0239665 | Ga0495609_0239665_254_679 | 130 |
| 28 | 3300046660 | Ga0495625_0031054 | Ga0495625_0031054_969_1394 | 130 |
| 29 | 3300046665 | Ga0495661_0045743 | Ga0495661_0045743_1931_2356 | 130 |
| 30 | 3300046674 | Ga0495588_0060307 | Ga0495588_0060307_1069_1494 | 130 |
| 31 | 3300046691 | Ga0495670_0073398 | Ga0495670_0073398_605_1030 | 130 |
| 32 | 3300046810 | Ga0495660_0009864 | Ga0495660_0009864_1846_2271 | 130 |
| 33 | 3300046538 | Ga0495609_0051967 | Ga0495609_0051967_1058_1498 | 131 |
| 34 | 3300039447 | Ga0436361_0803224 | Ga0436361_0803224_15491_15889 | 132 |
| 35 | 3300048924 | Ga0496121_0219104 | Ga0496121_0219104_653_1099 | 132 |
| 36 | 3300039447 | Ga0436361_0284091 | Ga0436361_0284091_831_1238 | 135 |
| 37 | iso_pu_bacteria | 2511231021 | 2511354052 | 135 |
| 38 | 3300009148 | Ga0105243_10756921 | Ga0105243_107569212 | 136 |
| 39 | 3300009551 | Ga0105238_10212293 | Ga0105238_102122932 | 136 |
| 40 | 3300009551 | Ga0105238_10472158 | Ga0105238_104721582 | 136 |
| 41 | 3300013306 | Ga0163162_10089022 | Ga0163162_100890225 | 136 |
| 42 | 3300014325 | Ga0163163_10249301 | Ga0163163_102493012 | 136 |
| 43 | 3300014497 | Ga0182008_10017220 | Ga0182008_100172204 | 136 |
| 44 | 3300014969 | Ga0157376_10027002 | Ga0157376_100270026 | 136 |
| 45 | 3300041512 | Ga0451853_3519164 | Ga0451853_3519164_204_620 | 136 |
| 46 | 3300046452 | Ga0495617_112567 | Ga0495617_112567_102_515 | 136 |
| 47 | 3300046460 | Ga0495638_0000275 | Ga0495638_0000275_40647_41060 | 136 |
| 48 | 3300046471 | Ga0495650_0000409 | Ga0495650_0000409_28791_29204 | 136 |
| 49 | 3300046507 | Ga0495606_0010329 | Ga0495606_0010329_2577_2990 | 136 |
| 50 | 3300046512 | Ga0495610_0020015 | Ga0495610_0020015_1458_1871 | 136 |
| 51 | 3300046694 | Ga0495649_0122537 | Ga0495649_0122537_949_1362 | 136 |
| 52 | 3300048907 | Ga0496104_0349574 | Ga0496104_0349574_33_446 | 136 |
| 53 | 3300048917 | Ga0496114_0119028 | Ga0496114_0119028_645_1058 | 136 |
| 54 | 3300048918 | Ga0496115_0117316 | Ga0496115_0117316_60_473 | 136 |
| 55 | 3300048924 | Ga0496121_0334523 | Ga0496121_0334523_146_559 | 136 |
| 56 | 3300048928 | Ga0496125_0199037 | Ga0496125_0199037_355_768 | 136 |
| 57 | 3300048929 | Ga0496126_0601188 | Ga0496126_0601188_108_521 | 136 |
| 58 | iso_pu_bacteria | 3007619802 | 3007620778 | 136 |
| 59 | iso_pu_bacteria | 8056177738 | 8056178421 | 136 |
| 60 | 3300005435 | Ga0070714_100010824 | Ga0070714_1000108247 | 137 |
| 61 | 3300005547 | Ga0070693_100038959 | Ga0070693_1000389591 | 137 |
| 62 | 3300009101 | Ga0105247_10003557 | Ga0105247_100035573 | 137 |
| 63 | 3300025929 | Ga0207664_10035254 | Ga0207664_100352546 | 137 |
| 64 | 3300031730 | Ga0307516_10374645 | Ga0307516_103746452 | 137 |
| 65 | 3300039450 | Ga0436363_1113167 | Ga0436363_1113167_59_478 | 137 |
| 66 | 3300046517 | Ga0495630_0125116 | Ga0495630_0125116_1005_1421 | 137 |
| 67 | 3300046536 | Ga0495587_0049680 | Ga0495587_0049680_1781_2197 | 137 |
| 68 | 3300047322 | Ga0495680_0003786 | Ga0495680_0003786_1813_2229 | 137 |
| 69 | 3300047673 | Ga0495593_0029660 | Ga0495593_0029660_2289_2705 | 137 |
| 70 | 3300048917 | Ga0496114_0267441 | Ga0496114_0267441_457_873 | 137 |
| 71 | 3300049577 | Ga0501041_0091993 | Ga0501041_0091993_27_446 | 137 |
| 72 | 3300049593 | Ga0501077_0498309 | Ga0501077_0498309_217_636 | 137 |
| 73 | 3300009094 | Ga0111539_10054526 | Ga0111539_100545264 | 138 |
| 74 | 3300013104 | Ga0157370_10816266 | Ga0157370_108162662 | 138 |
| 75 | 3300014326 | Ga0157380_12263062 | Ga0157380_122630622 | 138 |
| 76 | 3300045051 | Ga0451576_2257446 | Ga0451576_2257446_49_471 | 138 |
| 77 | 3300050511 | nmdc:mga08y16_9544_c1 | nmdc:mga08y16_9544_c1_2712_3137 | 138 |
| 78 | 3300035241 | Ga0373961_0092624 | Ga0373961_0092624_148_570 | 139 |
| 79 | 3300046542 | Ga0495597_0002615 | Ga0495597_0002615_8815_9237 | 139 |
| 80 | 3300048913 | Ga0496110_0000019 | Ga0496110_0000019_16096_16518 | 139 |
| 81 | 3300048914 | Ga0496111_0048157 | Ga0496111_0048157_2611_3033 | 139 |
| 82 | 3300049671 | Ga0501238_002064 | Ga0501238_002064_611_1036 | 139 |
| 83 | 3300005367 | Ga0070667_100026126 | Ga0070667_1000261265 | 140 |
| 84 | 3300005457 | Ga0070662_101380213 | Ga0070662_1013802131 | 140 |
| 85 | 3300005467 | Ga0070706_100213272 | Ga0070706_1002132721 | 140 |
| 86 | 3300005468 | Ga0070707_100235419 | Ga0070707_1002354192 | 140 |
| 87 | 3300005518 | Ga0070699_100000445 | Ga0070699_10000044541 | 140 |
| 88 | 3300005617 | Ga0068859_100165228 | Ga0068859_1001652284 | 140 |
| 89 | 3300005843 | Ga0068860_100313223 | Ga0068860_1003132233 | 140 |
| 90 | 3300006931 | Ga0097620_100165228 | Ga0097620_1001652284 | 140 |
| 91 | 3300009551 | Ga0105238_10059228 | Ga0105238_100592282 | 140 |
| 92 | 3300013102 | Ga0157371_10262329 | Ga0157371_102623292 | 140 |
| 93 | 3300013105 | Ga0157369_10002483 | Ga0157369_1000248322 | 140 |
| 94 | 3300017792 | Ga0163161_10267645 | Ga0163161_102676452 | 140 |
| 95 | 3300025900 | Ga0207710_10003510 | Ga0207710_100035105 | 140 |
| 96 | 3300025910 | Ga0207684_10093627 | Ga0207684_100936272 | 140 |
| 97 | 3300025922 | Ga0207646_10000904 | Ga0207646_1000090447 | 140 |
| 98 | 3300025986 | Ga0207658_10016465 | Ga0207658_100164653 | 140 |
| 99 | 3300027717 | Ga0209998_10089347 | Ga0209998_100893472 | 140 |
| 100 | 3300037312 | Ga0395899_0099815 | Ga0395899_0099815_1634_2059 | 140 |
| 101 | 3300037312 | Ga0395899_0371008 | Ga0395899_0371008_187_609 | 140 |
| 102 | 3300037418 | Ga0395900_0223393 | Ga0395900_0223393_1268_1693 | 140 |
| 103 | 3300037471 | Ga0395905_0047779 | Ga0395905_0047779_525_947 | 140 |
| 104 | 3300037471 | Ga0395905_0101066 | Ga0395905_0101066_405_830 | 140 |
| 105 | 3300037471 | Ga0395905_0685432 | Ga0395905_0685432_148_573 | 140 |
| 106 | 3300038443 | Ga0395901_0031629 | Ga0395901_0031629_1941_2363 | 140 |
| 107 | 3300044765 | Ga0466970_0404415 | Ga0466970_0404415_253_675 | 140 |
| 108 | 3300046453 | Ga0495627_004140 | Ga0495627_004140_1331_1756 | 140 |
| 109 | 3300046453 | Ga0495627_008951 | Ga0495627_008951_1617_2048 | 140 |
| 110 | 3300046453 | Ga0495627_087279 | Ga0495627_087279_25_450 | 140 |
| 111 | 3300046455 | Ga0495603_0140373 | Ga0495603_0140373_312_737 | 140 |
| 112 | 3300046457 | Ga0495590_0063016 | Ga0495590_0063016_333_758 | 140 |
| 113 | 3300046460 | Ga0495638_0080592 | Ga0495638_0080592_1343_1768 | 140 |
| 114 | 3300046463 | Ga0495653_0009121 | Ga0495653_0009121_7458_7883 | 140 |
| 115 | 3300046474 | Ga0495605_0001089 | Ga0495605_0001089_16006_16431 | 140 |
| 116 | 3300046474 | Ga0495605_0098735 | Ga0495605_0098735_652_1083 | 140 |
| 117 | 3300046491 | Ga0495584_0000936 | Ga0495584_0000936_369_794 | 140 |
| 118 | 3300046491 | Ga0495584_0013227 | Ga0495584_0013227_3600_4025 | 140 |
| 119 | 3300046491 | Ga0495584_0038278 | Ga0495584_0038278_1342_1773 | 140 |
| 120 | 3300046492 | Ga0495585_0000752 | Ga0495585_0000752_4728_5153 | 140 |
| 121 | 3300046492 | Ga0495585_0002719 | Ga0495585_0002719_11158_11583 | 140 |
| 122 | 3300046492 | Ga0495585_0012411 | Ga0495585_0012411_2875_3300 | 140 |
| 123 | 3300046492 | Ga0495585_0032321 | Ga0495585_0032321_1344_1769 | 140 |
| 124 | 3300046499 | Ga0495594_0007647 | Ga0495594_0007647_4993_5418 | 140 |
| 125 | 3300046499 | Ga0495594_0012321 | Ga0495594_0012321_1777_2202 | 140 |
| 126 | 3300046500 | Ga0495596_0000776 | Ga0495596_0000776_5824_6255 | 140 |
| 127 | 3300046500 | Ga0495596_0003928 | Ga0495596_0003928_885_1310 | 140 |
| 128 | 3300046500 | Ga0495596_0004014 | Ga0495596_0004014_6709_7134 | 140 |
| 129 | 3300046501 | Ga0495607_0010190 | Ga0495607_0010190_4514_4939 | 140 |
| 130 | 3300046501 | Ga0495607_0097384 | Ga0495607_0097384_441_875 | 140 |
| 131 | 3300046506 | Ga0495583_0019955 | Ga0495583_0019955_263_694 | 140 |
| 132 | 3300046506 | Ga0495583_0025239 | Ga0495583_0025239_1440_1865 | 140 |
| 133 | 3300046506 | Ga0495583_0027021 | Ga0495583_0027021_1572_2003 | 140 |
| 134 | 3300046506 | Ga0495583_0054520 | Ga0495583_0054520_1214_1645 | 140 |
| 135 | 3300046507 | Ga0495606_0030200 | Ga0495606_0030200_2857_3288 | 140 |
| 136 | 3300046512 | Ga0495610_0001568 | Ga0495610_0001568_17014_17439 | 140 |
| 137 | 3300046513 | Ga0495616_0014217 | Ga0495616_0014217_3045_3476 | 140 |
| 138 | 3300046513 | Ga0495616_0019124 | Ga0495616_0019124_789_1214 | 140 |
| 139 | 3300046513 | Ga0495616_0059791 | Ga0495616_0059791_674_1105 | 140 |
| 140 | 3300046513 | Ga0495616_0230042 | Ga0495616_0230042_313_738 | 140 |
| 141 | 3300046518 | Ga0495631_0001988 | Ga0495631_0001988_580_1005 | 140 |
| 142 | 3300046518 | Ga0495631_0003557 | Ga0495631_0003557_4819_5244 | 140 |
| 143 | 3300046518 | Ga0495631_0276277 | Ga0495631_0276277_246_677 | 140 |
| 144 | 3300046519 | Ga0495632_0000235 | Ga0495632_0000235_17406_17837 | 140 |
| 145 | 3300046519 | Ga0495632_0064366 | Ga0495632_0064366_341_766 | 140 |
| 146 | 3300046523 | Ga0495644_0089366 | Ga0495644_0089366_364_795 | 140 |
| 147 | 3300046523 | Ga0495644_0113963 | Ga0495644_0113963_74_499 | 140 |
| 148 | 3300046523 | Ga0495644_0195385 | Ga0495644_0195385_237_668 | 140 |
| 149 | 3300046524 | Ga0495648_0011902 | Ga0495648_0011902_4532_4957 | 140 |
| 150 | 3300046524 | Ga0495648_0119869 | Ga0495648_0119869_622_1047 | 140 |
| 151 | 3300046524 | Ga0495648_0133560 | Ga0495648_0133560_373_798 | 140 |
| 152 | 3300046528 | Ga0495642_0000559 | Ga0495642_0000559_1504_1929 | 140 |
| 153 | 3300046528 | Ga0495642_0008094 | Ga0495642_0008094_1661_2092 | 140 |
| 154 | 3300046528 | Ga0495642_0013850 | Ga0495642_0013850_1247_1672 | 140 |
| 155 | 3300046528 | Ga0495642_0121437 | Ga0495642_0121437_425_850 | 140 |
| 156 | 3300046530 | Ga0495654_0169091 | Ga0495654_0169091_202_633 | 140 |
| 157 | 3300046531 | Ga0495665_0053745 | Ga0495665_0053745_556_981 | 140 |
| 158 | 3300046538 | Ga0495609_0008133 | Ga0495609_0008133_1344_1769 | 140 |
| 159 | 3300046538 | Ga0495609_0031377 | Ga0495609_0031377_1396_1821 | 140 |
| 160 | 3300046542 | Ga0495597_0179352 | Ga0495597_0179352_78_503 | 140 |
| 161 | 3300046558 | Ga0495633_0002672 | Ga0495633_0002672_863_1288 | 140 |
| 162 | 3300046558 | Ga0495633_0019488 | Ga0495633_0019488_1462_1893 | 140 |
| 163 | 3300046615 | Ga0495656_0031934 | Ga0495656_0031934_271_696 | 140 |
| 164 | 3300046615 | Ga0495656_0068264 | Ga0495656_0068264_320_751 | 140 |
| 165 | 3300046615 | Ga0495656_0177972 | Ga0495656_0177972_566_991 | 140 |
| 166 | 3300046616 | Ga0495668_0001519 | Ga0495668_0001519_16225_16650 | 140 |
| 167 | 3300046616 | Ga0495668_0008100 | Ga0495668_0008100_4481_4906 | 140 |
| 168 | 3300046616 | Ga0495668_0017148 | Ga0495668_0017148_2995_3420 | 140 |
| 169 | 3300046616 | Ga0495668_0175127 | Ga0495668_0175127_44_475 | 140 |
| 170 | 3300046648 | Ga0495611_0004228 | Ga0495611_0004228_190_615 | 140 |
| 171 | 3300046648 | Ga0495611_0009631 | Ga0495611_0009631_1131_1556 | 140 |
| 172 | 3300046648 | Ga0495611_0156783 | Ga0495611_0156783_622_1047 | 140 |
| 173 | 3300046660 | Ga0495625_0113612 | Ga0495625_0113612_190_615 | 140 |
| 174 | 3300046660 | Ga0495625_0117593 | Ga0495625_0117593_496_921 | 140 |
| 175 | 3300046663 | Ga0495635_0671953 | Ga0495635_0671953_177_602 | 140 |
| 176 | 3300046665 | Ga0495661_0002081 | Ga0495661_0002081_973_1398 | 140 |
| 177 | 3300046665 | Ga0495661_0010028 | Ga0495661_0010028_1520_1945 | 140 |
| 178 | 3300046665 | Ga0495661_0020527 | Ga0495661_0020527_3190_3615 | 140 |
| 179 | 3300046665 | Ga0495661_0121104 | Ga0495661_0121104_423_848 | 140 |
| 180 | 3300046665 | Ga0495661_0152667 | Ga0495661_0152667_20_451 | 140 |
| 181 | 3300046674 | Ga0495588_0070294 | Ga0495588_0070294_1279_1704 | 140 |
| 182 | 3300046674 | Ga0495588_0235202 | Ga0495588_0235202_105_530 | 140 |
| 183 | 3300046684 | Ga0495669_0020081 | Ga0495669_0020081_1321_1746 | 140 |
| 184 | 3300046684 | Ga0495669_0027346 | Ga0495669_0027346_941_1366 | 140 |
| 185 | 3300046689 | Ga0495613_0087920 | Ga0495613_0087920_393_818 | 140 |
| 186 | 3300046691 | Ga0495670_0004330 | Ga0495670_0004330_554_979 | 140 |
| 187 | 3300046691 | Ga0495670_0015068 | Ga0495670_0015068_1865_2290 | 140 |
| 188 | 3300046691 | Ga0495670_0041976 | Ga0495670_0041976_172_603 | 140 |
| 189 | 3300046692 | Ga0495671_0003583 | Ga0495671_0003583_5473_5904 | 140 |
| 190 | 3300046692 | Ga0495671_0008001 | Ga0495671_0008001_4589_5014 | 140 |
| 191 | 3300046692 | Ga0495671_0011158 | Ga0495671_0011158_3912_4343 | 140 |
| 192 | 3300046692 | Ga0495671_0327479 | Ga0495671_0327479_245_676 | 140 |
| 193 | 3300046694 | Ga0495649_0053852 | Ga0495649_0053852_1038_1469 | 140 |
| 194 | 3300046694 | Ga0495649_0058352 | Ga0495649_0058352_649_1074 | 140 |
| 195 | 3300046810 | Ga0495660_0028729 | Ga0495660_0028729_1088_1519 | 140 |
| 196 | 3300046810 | Ga0495660_0487730 | Ga0495660_0487730_22_447 | 140 |
| 197 | 3300047323 | Ga0495683_0160880 | Ga0495683_0160880_541_972 | 140 |
| 198 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_950865_951290 | 140 |
| 199 | 3300047443 | Ga0495687_004590 | Ga0495687_004590_1145_1576 | 140 |
| 200 | 3300047445 | Ga0495677_0003618 | Ga0495677_0003618_1051_1476 | 140 |
| 201 | 3300047445 | Ga0495677_0093887 | Ga0495677_0093887_352_777 | 140 |
| 202 | 3300047445 | Ga0495677_0152454 | Ga0495677_0152454_435_860 | 140 |
| 203 | 3300047445 | Ga0495677_0187965 | Ga0495677_0187965_177_608 | 140 |
| 204 | 3300047445 | Ga0495677_0221846 | Ga0495677_0221846_15_446 | 140 |
| 205 | 3300047470 | Ga0495681_0003523 | Ga0495681_0003523_9031_9456 | 140 |
| 206 | 3300047470 | Ga0495681_0004070 | Ga0495681_0004070_836_1267 | 140 |
| 207 | 3300047470 | Ga0495681_0051008 | Ga0495681_0051008_685_1116 | 140 |
| 208 | 3300047470 | Ga0495681_0152306 | Ga0495681_0152306_17_442 | 140 |
| 209 | 3300047472 | Ga0495686_0001168 | Ga0495686_0001168_28499_28924 | 140 |
| 210 | 3300048091 | Ga0495626_0017487 | Ga0495626_0017487_2252_2677 | 140 |
| 211 | 3300048091 | Ga0495626_0037713 | Ga0495626_0037713_1137_1568 | 140 |
| 212 | 3300048905 | Ga0496102_0000861 | Ga0496102_0000861_19232_19657 | 140 |
| 213 | 3300048909 | Ga0496106_0205618 | Ga0496106_0205618_814_1239 | 140 |
| 214 | 3300048910 | Ga0496107_0136973 | Ga0496107_0136973_301_726 | 140 |
| 215 | 3300048913 | Ga0496110_0090009 | Ga0496110_0090009_844_1269 | 140 |
| 216 | 3300048914 | Ga0496111_0115975 | Ga0496111_0115975_445_870 | 140 |
| 217 | 3300048929 | Ga0496126_0488379 | Ga0496126_0488379_244_669 | 140 |
| 218 | 3300049459 | Ga0495678_004221 | Ga0495678_004221_1685_2116 | 140 |
| 219 | 3300049459 | Ga0495678_021533 | Ga0495678_021533_2295_2726 | 140 |
| 220 | 3300049459 | Ga0495678_064039 | Ga0495678_064039_829_1260 | 140 |
| 221 | 3300049460 | Ga0495682_0002851 | Ga0495682_0002851_1445_1876 | 140 |
| 222 | 3300049575 | Ga0501039_0346302 | Ga0501039_0346302_609_1082 | 140 |
| 223 | 3300049742 | Ga0501080_0609409 | Ga0501080_0609409_255_728 | 140 |
| 224 | 3300050509 | nmdc:mga0qj67_176404_c1 | nmdc:mga0qj67_176404_c1_588_1028 | 140 |
| 225 | 3300050515 | nmdc:mga0a205_67832_c1 | nmdc:mga0a205_67832_c1_558_986 | 140 |
| 226 | 3300005339 | Ga0070660_101194287 | Ga0070660_1011942872 | 141 |
| 227 | 3300005340 | Ga0070689_100004093 | Ga0070689_1000040935 | 141 |
| 228 | 3300005340 | Ga0070689_100071239 | Ga0070689_1000712394 | 141 |
| 229 | 3300005344 | Ga0070661_100008913 | Ga0070661_1000089136 | 141 |
| 230 | 3300005347 | Ga0070668_100895668 | Ga0070668_1008956682 | 141 |
| 231 | 3300005354 | Ga0070675_101023556 | Ga0070675_1010235561 | 141 |
| 232 | 3300005356 | Ga0070674_100036112 | Ga0070674_1000361122 | 141 |
| 233 | 3300005365 | Ga0070688_100260030 | Ga0070688_1002600302 | 141 |
| 234 | 3300005367 | Ga0070667_100511851 | Ga0070667_1005118512 | 141 |
| 235 | 3300005455 | Ga0070663_100042597 | Ga0070663_1000425975 | 141 |
| 236 | 3300005466 | Ga0070685_10008929 | Ga0070685_100089294 | 141 |
| 237 | 3300005468 | Ga0070707_102270387 | Ga0070707_1022703871 | 141 |
| 238 | 3300005544 | Ga0070686_100959460 | Ga0070686_1009594601 | 141 |
| 239 | 3300005563 | Ga0068855_100898875 | Ga0068855_1008988752 | 141 |
| 240 | 3300005577 | Ga0068857_100854049 | Ga0068857_1008540492 | 141 |
| 241 | 3300005614 | Ga0068856_101483295 | Ga0068856_1014832951 | 141 |
| 242 | 3300005616 | Ga0068852_101594777 | Ga0068852_1015947771 | 141 |
| 243 | 3300005617 | Ga0068859_100177327 | Ga0068859_1001773273 | 141 |
| 244 | 3300005834 | Ga0068851_10419767 | Ga0068851_104197671 | 141 |
| 245 | 3300005843 | Ga0068860_100281222 | Ga0068860_1002812221 | 141 |
| 246 | 3300005844 | Ga0068862_100094500 | Ga0068862_1000945003 | 141 |
| 247 | 3300005844 | Ga0068862_100351494 | Ga0068862_1003514942 | 141 |
| 248 | 3300005937 | Ga0081455_10130602 | Ga0081455_101306023 | 141 |
| 249 | 3300006237 | Ga0097621_100164198 | Ga0097621_1001641983 | 141 |
| 250 | 3300006237 | Ga0097621_100278838 | Ga0097621_1002788382 | 141 |
| 251 | 3300006358 | Ga0068871_100117732 | Ga0068871_1001177324 | 141 |
| 252 | 3300006358 | Ga0068871_100309663 | Ga0068871_1003096632 | 141 |
| 253 | 3300006931 | Ga0097620_100177329 | Ga0097620_1001773292 | 141 |
| 254 | 3300009094 | Ga0111539_10616000 | Ga0111539_106160002 | 141 |
| 255 | 3300009177 | Ga0105248_10695476 | Ga0105248_106954761 | 141 |
| 256 | 3300009551 | Ga0105238_10154418 | Ga0105238_101544182 | 141 |
| 257 | 3300010375 | Ga0105239_10565891 | Ga0105239_105658912 | 141 |
| 258 | 3300013297 | Ga0157378_10000158 | Ga0157378_100001587 | 141 |
| 259 | 3300013307 | Ga0157372_10096201 | Ga0157372_100962012 | 141 |
| 260 | 3300013308 | Ga0157375_11357090 | Ga0157375_113570901 | 141 |
| 261 | 3300025206 | Ga0209435_101530 | Ga0209435_1015302 | 141 |
| 262 | 3300025224 | Ga0209784_100143 | Ga0209784_10014344 | 141 |
| 263 | 3300025225 | Ga0209566_102059 | Ga0209566_1020592 | 141 |
| 264 | 3300025228 | Ga0209672_102706 | Ga0209672_1027063 | 141 |
| 265 | 3300025231 | Ga0207427_100059 | Ga0207427_100059119 | 141 |
| 266 | 3300025233 | Ga0209437_100123 | Ga0209437_100123119 | 141 |
| 267 | 3300025242 | Ga0209258_100281 | Ga0209258_10028136 | 141 |
| 268 | 3300025246 | Ga0209646_1000488 | Ga0209646_100048812 | 141 |
| 269 | 3300025250 | Ga0209026_1000174 | Ga0209026_100017457 | 141 |
| 270 | 3300025254 | Ga0209148_1000121 | Ga0209148_1000121119 | 141 |
| 271 | 3300025256 | Ga0209759_1000216 | Ga0209759_100021649 | 141 |
| 272 | 3300025261 | Ga0209233_1000136 | Ga0209233_1000136119 | 141 |
| 273 | 3300025261 | Ga0209233_1039624 | Ga0209233_10396241 | 141 |
| 274 | 3300025272 | Ga0209455_1000120 | Ga0209455_1000120128 | 141 |
| 275 | 3300025907 | Ga0207645_10421442 | Ga0207645_104214422 | 141 |
| 276 | 3300025909 | Ga0207705_10361406 | Ga0207705_103614062 | 141 |
| 277 | 3300025916 | Ga0207663_10736233 | Ga0207663_107362331 | 141 |
| 278 | 3300025920 | Ga0207649_10567708 | Ga0207649_105677081 | 141 |
| 279 | 3300025924 | Ga0207694_10123874 | Ga0207694_101238742 | 141 |
| 280 | 3300025924 | Ga0207694_10317039 | Ga0207694_103170393 | 141 |
| 281 | 3300025924 | Ga0207694_10709762 | Ga0207694_107097622 | 141 |
| 282 | 3300025926 | Ga0207659_10544506 | Ga0207659_105445061 | 141 |
| 283 | 3300025935 | Ga0207709_10583138 | Ga0207709_105831382 | 141 |
| 284 | 3300025936 | Ga0207670_10003731 | Ga0207670_100037317 | 141 |
| 285 | 3300025936 | Ga0207670_10006013 | Ga0207670_100060132 | 141 |
| 286 | 3300025941 | Ga0207711_10387715 | Ga0207711_103877152 | 141 |
| 287 | 3300025972 | Ga0207668_10209602 | Ga0207668_102096021 | 141 |
| 288 | 3300025972 | Ga0207668_10995913 | Ga0207668_109959132 | 141 |
| 289 | 3300025986 | Ga0207658_10458445 | Ga0207658_104584452 | 141 |
| 290 | 3300026088 | Ga0207641_11354785 | Ga0207641_113547851 | 141 |
| 291 | 3300027682 | Ga0209971_1111874 | Ga0209971_11118741 | 141 |
| 292 | 3300027695 | Ga0209966_1136187 | Ga0209966_11361871 | 141 |
| 293 | 3300027907 | Ga0207428_10006893 | Ga0207428_100068937 | 141 |
| 294 | 3300028379 | Ga0268266_12329203 | Ga0268266_123292031 | 141 |
| 295 | 3300028380 | Ga0268265_10078480 | Ga0268265_100784802 | 141 |
| 296 | 3300028380 | Ga0268265_10088957 | Ga0268265_100889572 | 141 |
| 297 | 3300028380 | Ga0268265_11218394 | Ga0268265_112183942 | 141 |
| 298 | 3300028381 | Ga0268264_10037555 | Ga0268264_100375553 | 141 |
| 299 | 3300031240 | Ga0265320_10163132 | Ga0265320_101631321 | 141 |
| 300 | 3300031548 | Ga0307408_100202503 | Ga0307408_1002025032 | 141 |
| 301 | 3300031711 | Ga0265314_10140133 | Ga0265314_101401332 | 141 |
| 302 | 3300031712 | Ga0265342_10006393 | Ga0265342_100063937 | 141 |
| 303 | 3300031730 | Ga0307516_10142830 | Ga0307516_101428303 | 141 |
| 304 | 3300031901 | Ga0307406_10100677 | Ga0307406_101006773 | 141 |
| 305 | 3300032005 | Ga0307411_10106621 | Ga0307411_101066213 | 141 |
| 306 | 3300032126 | Ga0307415_100264827 | Ga0307415_1002648272 | 141 |
| 307 | 3300044842 | Ga0466957_0002945 | Ga0466957_0002945_1359_1793 | 141 |
| 308 | 3300046519 | Ga0495632_0000062 | Ga0495632_0000062_37790_38218 | 141 |
| 309 | 3300046665 | Ga0495661_0060350 | Ga0495661_0060350_1420_1848 | 141 |
| 310 | 3300046694 | Ga0495649_0248956 | Ga0495649_0248956_232_669 | 141 |
| 311 | 3300049669 | Ga0501235_042410 | Ga0501235_042410_528_959 | 141 |
| 312 | 3300049686 | Ga0501257_068873 | Ga0501257_068873_214_645 | 141 |
| 313 | 3300049772 | Ga0501275_061458 | Ga0501275_061458_96_527 | 141 |
| 314 | 3300050511 | nmdc:mga08y16_308477_c1 | nmdc:mga08y16_308477_c1_615_1043 | 141 |
| 315 | 3300055283 | Ga0500661_002185 | Ga0500661_002185_2233_2661 | 141 |
| 316 | 3300005536 | Ga0070697_100253010 | Ga0070697_1002530103 | 142 |
| 317 | 3300006237 | Ga0097621_101094035 | Ga0097621_1010940352 | 142 |
| 318 | 3300031903 | Ga0307407_10541272 | Ga0307407_105412722 | 142 |
| 319 | 3300046472 | Ga0495580_0003700 | Ga0495580_0003700_6658_7107 | 142 |
| 320 | 3300046538 | Ga0495609_0005761 | Ga0495609_0005761_5060_5509 | 142 |
| 321 | 3300046542 | Ga0495597_0001279 | Ga0495597_0001279_2260_2709 | 142 |
| 322 | 3300005329 | Ga0070683_100177816 | Ga0070683_1001778162 | 143 |
| 323 | 3300005366 | Ga0070659_100063485 | Ga0070659_1000634853 | 143 |
| 324 | 3300005530 | Ga0070679_100677493 | Ga0070679_1006774931 | 143 |
| 325 | 3300005539 | Ga0068853_100023505 | Ga0068853_1000235056 | 143 |
| 326 | 3300005563 | Ga0068855_100097841 | Ga0068855_1000978413 | 143 |
| 327 | 3300005563 | Ga0068855_100177794 | Ga0068855_1001777943 | 143 |
| 328 | 3300005616 | Ga0068852_100024815 | Ga0068852_1000248152 | 143 |
| 329 | 3300009093 | Ga0105240_10048078 | Ga0105240_100480783 | 143 |
| 330 | 3300013102 | Ga0157371_10558719 | Ga0157371_105587191 | 143 |
| 331 | 3300013105 | Ga0157369_10645569 | Ga0157369_106455691 | 143 |
| 332 | 3300013307 | Ga0157372_10007996 | Ga0157372_100079966 | 143 |
| 333 | 3300013307 | Ga0157372_10683647 | Ga0157372_106836471 | 143 |
| 334 | 3300013307 | Ga0157372_10731049 | Ga0157372_107310492 | 143 |
| 335 | 3300025909 | Ga0207705_11549220 | Ga0207705_115492201 | 143 |
| 336 | 3300025913 | Ga0207695_10091470 | Ga0207695_100914703 | 143 |
| 337 | 3300025921 | Ga0207652_10741369 | Ga0207652_107413692 | 143 |
| 338 | 3300025924 | Ga0207694_10034499 | Ga0207694_100344994 | 143 |
| 339 | 3300025945 | Ga0207679_10853995 | Ga0207679_108539952 | 143 |
| 340 | 3300025949 | Ga0207667_10109452 | Ga0207667_101094523 | 143 |
| 341 | 3300025949 | Ga0207667_10156591 | Ga0207667_101565911 | 143 |
| 342 | 3300026041 | Ga0207639_10040691 | Ga0207639_100406913 | 143 |
| 343 | 3300026142 | Ga0207698_10022760 | Ga0207698_100227606 | 143 |
| 344 | 3300037418 | Ga0395900_0198719 | Ga0395900_0198719_20_451 | 143 |
| 345 | 3300037471 | Ga0395905_1105695 | Ga0395905_1105695_28_459 | 143 |
| 346 | 3300054114 | Ga0501084_0093869 | Ga0501084_0093869_226_657 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7282 | 1 | 116 |
| 8bi8-assembly2.cif.gz_B | structure of a cyclic beta-hairpin peptide derived from neuronal nitric oxide synthase | 0.697 | 51 | 66 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.6831 | 1 | 116 |
| 8bi8-assembly1.cif.gz_A | structure of a cyclic beta-hairpin peptide derived from neuronal nitric oxide synthase | 0.6429 | 51 | 66 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.635 | 1 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P35421_862_1029_3.90.650.10 | Alpha Beta;Alpha-Beta Complex;Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2;PurM-like C-terminal domain | 0.7794 | 18 | 43 | 3.90.650.10 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7282 | 1 | 116 | 3.30.70.1060 |
| 2icsA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.7269 | 51 | 67 | 2.30.40.10 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6831 | 1 | 116 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6829 | 1 | 116 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A366GCQ1-F1-model_v4 | deleted | 0.9244 | 1 | 121 |
|
| AF-A0A142YAK4-F1-model_v4 | YCII-related domain protein | 0.9204 | 1 | 137 |
|
| AF-A0A5C4T2R4-F1-model_v4 | YciI family protein | 0.918 | 1 | 119 |
|
| AF-A0A261TB04-F1-model_v4 | YCII-related domain-containing protein | 0.9175 | 1 | 120 |
|
| AF-A0A1W6ZJC4-F1-model_v4 | Dehydrogenase | 0.9167 | 1 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar