F416749

General Info

Members Datasets Scaffolds Average Seq Length
346 234 338 343

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10136005|Ga0105242_101360052
Length 389
Sequence LTVLEEVNTTTKAAAAAVFLRDAQNVGSLARSRQPSAHCSPALTHRVSVDYRSVGASDLTVSALSFGTATFGGGSDFYRAWGATDVAEATRLVDIALDAGVTLFDTADSYSGGLAEEILGKAIAGRRNRILISTKAAFRTGPGADDIGSSRKHLIPACEASLRRLGVDHIDLWSMHGFDSFTPVDETLRAIEEVVRAGKVRYVGCSNFSGWHLMKSLALSDRHGWPRYVSHQAYYSLVARDYEWELMPLALDQKIGTVVWSPLSGGQLSGKFDRDHPPPEGTRVATLGIRPGLSREQFYDVVDELRAIAAETDRTVPQVALNWVLHRPTVSTLVIGARNEAQLADSLGTTAFSLTIDQIQRLDAASARQPAYPYWHQRTIYGERNPPPV

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
3 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
4 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
5 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
6 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
233 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
234 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0.29
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 0.87
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003021 3300001977 Bacteria 2643
2 JGI25151J46595_10001549 3300003187 Bacteria 15340
3 Ga0065712_10007828 3300005290 Bacteria 3204
4 Ga0065707_10211055 3300005295 Bacteria 1265
5 Ga0070676_10020002 3300005328 Bacteria 3731
6 Ga0070683_100019693 3300005329 Bacteria 5996
7 Ga0070683_100061912 3300005329 Bacteria 3479
8 Ga0070690_100003124 3300005330 Bacteria 9016
9 Ga0070666_10227175 3300005335 Bacteria 1318
10 Ga0070680_100005778 3300005336 Bacteria 9390
11 Ga0070680_100036300 3300005336 Bacteria 3982
12 Ga0070680_100112807 3300005336 Bacteria 2264
13 Ga0070682_100063294 3300005337 Bacteria 2345
14 Ga0070682_100197966 3300005337 Bacteria 1415
15 Ga0070689_100024558 3300005340 Bacteria 4522
16 Ga0070687_100074287 3300005343 Bacteria 1835
17 Ga0070661_100094944 3300005344 Bacteria 2211
18 Ga0070661_100196711 3300005344 Bacteria 1539
19 Ga0070669_100004783 3300005353 Bacteria 9769
20 Ga0070671_100019511 3300005355 Bacteria 5519
21 Ga0070674_100090108 3300005356 Bacteria 2211
22 Ga0070673_100062241 3300005364 Bacteria 2964
23 Ga0070659_100021302 3300005366 Bacteria 4935
24 Ga0070667_100026472 3300005367 Bacteria 4825
25 Ga0070709_10000842 3300005434 Bacteria 17172
26 Ga0070713_100055089 3300005436 Bacteria 3303
27 Ga0070700_100010451 3300005441 Bacteria 5127
28 Ga0070708_100000022 3300005445 Bacteria 113297
29 Ga0070663_100038822 3300005455 Bacteria 3323
30 Ga0070678_100007572 3300005456 Bacteria 6450
31 Ga0070678_100166527 3300005456 Bacteria 1791
32 Ga0070662_100025443 3300005457 Bacteria 4087
33 Ga0070681_10005472 3300005458 Bacteria 12266
34 Ga0070681_10007156 3300005458 Bacteria 10869
35 Ga0070681_10007446 3300005458 Bacteria 10699
36 Ga0070681_10017654 3300005458 Bacteria 7131
37 Ga0070681_10046842 3300005458 Bacteria 4322
38 Ga0070681_10264296 3300005458 Bacteria 1632
39 Ga0068867_100085265 3300005459 Bacteria 2388
40 Ga0070685_10029976 3300005466 Bacteria 3027
41 Ga0070679_100004500 3300005530 Bacteria 12876
42 Ga0070679_100013945 3300005530 Bacteria 7701
43 Ga0070679_100029984 3300005530 Bacteria 5368
44 Ga0070679_100153269 3300005530 Bacteria 2281
45 Ga0070679_100247693 3300005530 Bacteria 1738
46 Ga0070684_100054613 3300005535 Bacteria 3480
47 Ga0070684_100066909 3300005535 Bacteria 3155
48 Ga0068853_100030578 3300005539 Bacteria 4550
49 Ga0070672_100002501 3300005543 Bacteria 11702
50 Ga0070672_100053959 3300005543 Bacteria 3145
51 Ga0070672_100212339 3300005543 Bacteria 1621
52 Ga0070672_100236643 3300005543 Bacteria 1535
53 Ga0068855_100000604 3300005563 Bacteria 44010
54 Ga0068855_100004878 3300005563 Bacteria 16370
55 Ga0068855_100048250 3300005563 Bacteria 5027
56 Ga0068855_100086670 3300005563 Bacteria 3621
57 Ga0070664_100041730 3300005564 Bacteria 3872
58 Ga0070664_100067268 3300005564 Bacteria 3062
59 Ga0068857_100004735 3300005577 Bacteria 11528
60 Ga0068856_100004784 3300005614 Bacteria 13419
61 Ga0068856_100011511 3300005614 Bacteria 8586
62 Ga0068856_100116617 3300005614 Bacteria 2671
63 Ga0068864_100042007 3300005618 Bacteria 3912
64 Ga0068866_10038724 3300005718 Bacteria 2350
65 Ga0068861_100015415 3300005719 Bacteria 5385
66 Ga0068861_100092440 3300005719 Bacteria 2390
67 Ga0068870_10010604 3300005840 Bacteria 4240
68 Ga0068863_100020020 3300005841 Bacteria 6400
69 Ga0068858_100053732 3300005842 Bacteria 3725
70 Ga0068858_100102978 3300005842 Bacteria 2663
71 Ga0081455_10002045 3300005937 Bacteria 24113
72 Ga0070717_10002690 3300006028 Bacteria 12527
73 Ga0070717_10003941 3300006028 Bacteria 10683
74 Ga0070716_100018808 3300006173 Bacteria 3603
75 Ga0075362_10044670 3300006177 Bacteria 1966
76 Ga0097621_100089408 3300006237 Bacteria 2575
77 Ga0097621_100093415 3300006237 Bacteria 2521
78 Ga0097621_100127665 3300006237 Bacteria 2161
79 Ga0068871_100040610 3300006358 Bacteria 3727
80 Ga0075428_100000042 3300006844 Bacteria 102264
81 Ga0075428_100132189 3300006844 Bacteria 2714
82 Ga0075430_100008611 3300006846 Bacteria 8609
83 Ga0075430_100050253 3300006846 Bacteria 3517
84 Ga0075430_100070581 3300006846 Bacteria 2930
85 Ga0075430_100121377 3300006846 Bacteria 2179
86 Ga0075431_100117407 3300006847 Bacteria 2745
87 Ga0075431_100169204 3300006847 Bacteria 2246
88 Ga0075431_100279130 3300006847 Bacteria 1691
89 Ga0075433_10019673 3300006852 Bacteria 5630
90 Ga0075433_10025943 3300006852 Bacteria 4957
91 Ga0075434_100026200 3300006871 Bacteria 5711
92 Ga0075434_100125165 3300006871 Bacteria 2588
93 Ga0075429_100214451 3300006880 Bacteria 1686
94 Ga0105240_10000587 3300009093 Bacteria 67507
95 Ga0105240_10023997 3300009093 Bacteria 8056
96 Ga0105240_10028285 3300009093 Bacteria 7323
97 Ga0105240_10075665 3300009093 Bacteria 4152
98 Ga0105240_10522020 3300009093 Bacteria 1318
99 Ga0111539_10000002 3300009094 Bacteria 983359
100 Ga0105245_10067930 3300009098 Bacteria 3229
101 Ga0105247_10021334 3300009101 Bacteria 3898
102 Ga0114129_10074713 3300009147 Bacteria 4721
103 Ga0105243_10031366 3300009148 Bacteria 4097
104 Ga0105241_10050861 3300009174 Bacteria 3158
105 Ga0105242_10031242 3300009176 Bacteria 4251
106 Ga0105242_10136005 3300009176 Bacteria 2127
107 Ga0105242_10241221 3300009176 Bacteria 1625
108 Ga0105248_10124474 3300009177 Bacteria 2908
109 Ga0105237_10000094 3300009545 Bacteria 121776
110 Ga0105237_10015243 3300009545 Bacteria 8007
111 Ga0105238_10002763 3300009551 Bacteria 17513
112 Ga0105238_10046267 3300009551 Bacteria 4392
113 Ga0105238_10070315 3300009551 Bacteria 3499
114 Ga0105238_10098541 3300009551 Bacteria 2907
115 Ga0157373_10002840 3300013100 Bacteria 13098
116 Ga0157370_10015457 3300013104 Bacteria 7759
117 Ga0157369_10003665 3300013105 Bacteria 18238
118 Ga0157369_10005908 3300013105 Bacteria 14219
119 Ga0157369_10044898 3300013105 Bacteria 4808
120 Ga0157369_10471788 3300013105 Bacteria 1299
121 Ga0157369_10512346 3300013105 Bacteria 1241
122 Ga0157369_10521434 3300013105 Bacteria 1229
123 Ga0157374_10004560 3300013296 Bacteria 11621
124 Ga0157374_10043594 3300013296 Bacteria 4145
125 Ga0157372_10130422 3300013307 Bacteria 2892
126 Ga0157372_10318513 3300013307 Bacteria 1811
127 Ga0157375_10368444 3300013308 Bacteria 1603
128 Ga0163163_10054254 3300014325 Bacteria 3959
129 Ga0157380_10034474 3300014326 Bacteria 3905
130 Ga0157377_10025471 3300014745 Bacteria 3155
131 Ga0157379_10031528 3300014968 Bacteria 4722
132 Ga0157376_10022701 3300014969 Bacteria 4897
133 Ga0182006_1012961 3300015261 Bacteria 3635
134 Ga0182007_10023389 3300015262 Bacteria 2173
135 Ga0163161_10021615 3300017792 Bacteria 4522
136 Ga0206354_10456157 3300020081 Bacteria 1527
137 Ga0213876_10000717 3300021384 Bacteria 23188
138 Ga0209025_1001085 3300025294 Bacteria 39382
139 Ga0209050_1000490 3300025298 Bacteria 68371
140 Ga0209257_1009307 3300025304 Bacteria 5306
141 Ga0207697_10003452 3300025315 Bacteria 7806
142 Ga0207682_10008714 3300025893 Bacteria 4012
143 Ga0207688_10002015 3300025901 Bacteria 10898
144 Ga0207699_10005231 3300025906 Bacteria 6210
145 Ga0207643_10001901 3300025908 Bacteria 11523
146 Ga0207684_10047100 3300025910 Bacteria 3658
147 Ga0207654_10223913 3300025911 Bacteria 1249
148 Ga0207707_10002551 3300025912 Bacteria 16324
149 Ga0207707_10011923 3300025912 Bacteria 7562
150 Ga0207707_10027851 3300025912 Bacteria 4941
151 Ga0207707_10065309 3300025912 Bacteria 3170
152 Ga0207695_10002340 3300025913 Bacteria 28186
153 Ga0207695_10016507 3300025913 Bacteria 8633
154 Ga0207695_10191117 3300025913 Bacteria 1965
155 Ga0207671_10000006 3300025914 Bacteria 836809
156 Ga0207671_10053313 3300025914 Bacteria 2997
157 Ga0207660_10008038 3300025917 Bacteria 6821
158 Ga0207660_10184156 3300025917 Bacteria 1623
159 Ga0207662_10000636 3300025918 Bacteria 15792
160 Ga0207662_10008944 3300025918 Bacteria 5497
161 Ga0207657_10108720 3300025919 Bacteria 2292
162 Ga0207649_10024136 3300025920 Bacteria 3531
163 Ga0207649_10070676 3300025920 Bacteria 2227
164 Ga0207652_10002296 3300025921 Bacteria 16211
165 Ga0207652_10137918 3300025921 Bacteria 2179
166 Ga0207652_10419921 3300025921 Bacteria 1206
167 Ga0207646_10320655 3300025922 Bacteria 1400
168 Ga0207700_10036636 3300025928 Bacteria 3546
169 Ga0207644_10027190 3300025931 Bacteria 3952
170 Ga0207706_10011313 3300025933 Bacteria 8131
171 Ga0207706_10154942 3300025933 Bacteria 2015
172 Ga0207686_10072148 3300025934 Bacteria 2224
173 Ga0207669_10172152 3300025937 Bacteria 1542
174 Ga0207665_10063260 3300025939 Bacteria 2513
175 Ga0207691_10018394 3300025940 Bacteria 6621
176 Ga0207691_10193922 3300025940 Bacteria 1771
177 Ga0207691_10224240 3300025940 Bacteria 1629
178 Ga0207689_10004611 3300025942 Bacteria 12468
179 Ga0207689_10084006 3300025942 Bacteria 2617
180 Ga0207661_10010997 3300025944 Bacteria 6539
181 Ga0207679_10038890 3300025945 Bacteria 3394
182 Ga0207667_10017935 3300025949 Bacteria 7955
183 Ga0207667_10018674 3300025949 Bacteria 7769
184 Ga0207667_10027082 3300025949 Bacteria 6249
185 Ga0207667_10069417 3300025949 Bacteria 3667
186 Ga0207667_10192955 3300025949 Bacteria 2090
187 Ga0207651_10170816 3300025960 Bacteria 1714
188 Ga0207712_10013817 3300025961 Bacteria 5179
189 Ga0207712_10295374 3300025961 Bacteria 1328
190 Ga0207668_10069424 3300025972 Bacteria 2509
191 Ga0207640_10111675 3300025981 Bacteria 1939
192 Ga0207658_10186488 3300025986 Bacteria 1721
193 Ga0207658_10299789 3300025986 Bacteria 1384
194 Ga0207703_10091553 3300026035 Bacteria 2558
195 Ga0207703_10230963 3300026035 Bacteria 1658
196 Ga0207678_10035093 3300026067 Bacteria 4367
197 Ga0207708_10003601 3300026075 Bacteria 11416
198 Ga0207702_10006467 3300026078 Bacteria 10102
199 Ga0207702_10142746 3300026078 Bacteria 2169
200 Ga0207702_10204180 3300026078 Bacteria 1834
201 Ga0207648_10028131 3300026089 Bacteria 4986
202 Ga0207648_10095886 3300026089 Bacteria 2595
203 Ga0207674_10007398 3300026116 Bacteria 12793
204 Ga0207675_100018548 3300026118 Bacteria 6491
205 Ga0207683_10009439 3300026121 Bacteria 8312
206 Ga0207428_10000004 3300027907 Bacteria 727800
207 Ga0268265_10146940 3300028380 Bacteria 1982
208 Ga0268264_10036631 3300028381 Bacteria 4042
209 Ga0268264_10254565 3300028381 Bacteria 1633
210 Ga0307515_10000001 3300028794 Bacteria 4259510
211 Ga0307515_10149748 3300028794 Bacteria 2447
212 Ga0265320_10007700 3300031240 Bacteria 6661
213 Ga0265325_10017384 3300031241 Bacteria 3997
214 Ga0265329_10023474 3300031242 Bacteria 2054
215 Ga0265340_10008768 3300031247 Bacteria 5453
216 Ga0265340_10036033 3300031247 Bacteria 2454
217 Ga0265340_10055420 3300031247 Bacteria 1909
218 Ga0265339_10092542 3300031249 Bacteria 1583
219 Ga0265327_10001403 3300031251 Bacteria 30705
220 Ga0265316_10002367 3300031344 Bacteria 19628
221 Ga0265316_10011176 3300031344 Bacteria 8120
222 Ga0265316_10013482 3300031344 Bacteria 7255
223 Ga0265313_10018212 3300031595 Bacteria 3952
224 Ga0265314_10003650 3300031711 Bacteria 14801
225 Ga0265314_10022386 3300031711 Bacteria 4840
226 Ga0265314_10092614 3300031711 Bacteria 1964
227 Ga0265314_10101913 3300031711 Bacteria 1843
228 Ga0265342_10041942 3300031712 Bacteria 2767
229 Ga0265342_10155294 3300031712 Bacteria 1268
230 Ga0307412_10163756 3300031911 Bacteria 1656
231 Ga0307416_100035938 3300032002 Bacteria 3792
232 Ga0373923_0024967 3300035111 Bacteria 2364
233 Ga0373954_0001547 3300035118 Bacteria 9376
234 Ga0373957_0082130 3300035120 Bacteria 1273
235 Ga0373943_0035066 3300035170 Bacteria 2396
236 Ga0373955_0003850 3300035172 Bacteria 6615
237 Ga0373924_0001198 3300035410 Bacteria 8322
238 Ga0373927_0038272 3300035695 Bacteria 3114
239 Ga0373933_0007365 3300035724 Bacteria 6003
240 Ga0373933_0038896 3300035724 Bacteria 2797
241 Ga0373947_0002336 3300035725 Bacteria 11471
242 Ga0373947_0186354 3300035725 Bacteria 1353
243 Ga0373937_0000680 3300036401 Bacteria 29596
244 Ga0373925_0059912 3300037068 Bacteria 2857
245 Ga0395905_0000007 3300037471 Bacteria 521849
246 Ga0237816_00013 3300039145 Bacteria 10810
247 Ga0436365_0328255 3300039437 Bacteria 67874
248 Ga0436365_1113304 3300039437 Bacteria 2805
249 Ga0436360_0532743 3300039438 Bacteria 1368
250 Ga0436360_1051604 3300039438 Bacteria 1312
251 Ga0436362_0475942 3300039453 Bacteria 1705
252 Ga0451807_1916943 3300041486 Bacteria 3981
253 Ga0466969_0003226 3300044656 Bacteria 8679
254 Ga0466959_0021593 3300045049 Bacteria 4751
255 Ga0466959_0041400 3300045049 Bacteria 3401
256 Ga0466959_0159868 3300045049 Bacteria 1584
257 Ga0451576_0041198 3300045051 Bacteria 4884
258 Ga0495651_0014871 3300046462 Bacteria 6018
259 Ga0495580_0030514 3300046472 Bacteria 3903
260 Ga0495639_0009541 3300046475 Bacteria 4165
261 Ga0495584_0028013 3300046491 Bacteria 2854
262 Ga0495594_0015939 3300046499 Bacteria 3955
263 Ga0495594_0054092 3300046499 Bacteria 2212
264 Ga0495607_0153479 3300046501 Bacteria 1176
265 Ga0495606_0025386 3300046507 Bacteria 4245
266 Ga0495631_0009804 3300046518 Bacteria 4768
267 Ga0495666_0041202 3300046526 Bacteria 2237
268 Ga0495652_0098937 3300046529 Bacteria 2369
269 Ga0495654_0000251 3300046530 Bacteria 49575
270 Ga0495665_0052847 3300046531 Bacteria 2150
271 Ga0495586_0011685 3300046535 Bacteria 4670
272 Ga0495586_0013363 3300046535 Bacteria 4353
273 Ga0495587_0009995 3300046536 Bacteria 6059
274 Ga0495645_0000347 3300046543 Bacteria 32813
275 Ga0495667_0009819 3300046559 Bacteria 6483
276 Ga0495656_0105919 3300046615 Bacteria 1308
277 Ga0495668_0005477 3300046616 Bacteria 8587
278 Ga0495611_0052001 3300046648 Bacteria 1847
279 Ga0495625_0048001 3300046660 Bacteria 3076
280 Ga0495599_0051135 3300046678 Bacteria 2590
281 Ga0495623_0002335 3300046679 Bacteria 12647
282 Ga0495600_0012343 3300046809 Bacteria 5340
283 Ga0495660_0146282 3300046810 Unclassified 1171
284 Ga0495581_0014126 3300047315 Bacteria 4627
285 Ga0495675_0015795 3300047444 Bacteria 4775
286 Ga0495684_0036994 3300047471 Bacteria 3742
287 Ga0495684_0096906 3300047471 Bacteria 2232
288 Ga0496110_0001858 3300048913 Bacteria 15600
289 Ga0496116_0084474 3300048919 Unclassified 1955
290 Ga0496122_0001221 3300048925 Bacteria 43548
291 Ga0496123_0000980 3300048926 Bacteria 44056
292 Ga0496124_0032622 3300048927 Bacteria 4595
293 Ga0496126_0043196 3300048929 Bacteria 4159
294 Ga0496126_0044858 3300048929 Bacteria 4068
295 Ga0496126_0057298 3300048929 Bacteria 3519
296 Ga0501032_0008910 3300049569 Bacteria 7294
297 Ga0501033_0011283 3300049570 Bacteria 6840
298 Ga0501034_0008281 3300049571 Bacteria 11005
299 Ga0501034_0013457 3300049571 Bacteria 8420
300 Ga0501038_0010035 3300049574 Bacteria 8671
301 Ga0501039_0028246 3300049575 Bacteria 4317
302 Ga0501043_0165725 3300049579 Bacteria 1725
303 Ga0501047_0333356 3300049581 Bacteria 1355
304 Ga0501048_0007658 3300049582 Bacteria 8186
305 Ga0501068_0081411 3300049584 Bacteria 1987
306 Ga0501070_0006778 3300049586 Bacteria 9746
307 Ga0501072_0161896 3300049588 Bacteria 1785
308 Ga0501073_0113329 3300049589 Bacteria 1880
309 Ga0501080_0160334 3300049742 Bacteria 2077
310 Ga0501035_0014692 3300049822 Bacteria 7228
311 Ga0501035_0015801 3300049822 Bacteria 6967
312 Ga0501035_0299738 3300049822 Bacteria 1354
313 Ga0501044_0003810 3300049823 Bacteria 16941
314 Ga0501045_0085385 3300049824 Bacteria 2329
315 nmdc:mga0k408_56262_c1 3300050493 Bacteria 2282
316 nmdc:mga06z11_11878_c1 3300050494 Bacteria 3769
317 nmdc:mga09592_214034_c1 3300050508 Bacteria 1670
318 nmdc:mga09592_7233_c1 3300050508 Bacteria 9018
319 nmdc:mga0qj67_17556_c1 3300050509 Bacteria 5443
320 nmdc:mga0qj67_3121_c1 3300050509 Bacteria 11926
321 nmdc:mga0qj67_91931_c1 3300050509 Bacteria 2439
322 nmdc:mga06r32_135606_c1 3300050510 Bacteria 2436
323 nmdc:mga06r32_219578_c1 3300050510 Bacteria 1889
324 nmdc:mga06r32_78632_c1 3300050510 Bacteria 3206
325 nmdc:mga06r32_88882_c1 3300050510 Bacteria 3016
326 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
327 nmdc:mga08y16_395187_c1 3300050511 Bacteria 1416
328 nmdc:mga08x19_43290_c1 3300050514 Bacteria 2872
329 nmdc:mga0a205_19376_c1 3300050515 Bacteria 6412
330 Ga0500610_0012401 3300053079 Bacteria 3926
331 Ga0500651_0020483 3300053093 Bacteria 4116
332 Ga0500557_010852 3300053105 Bacteria 2299
333 Ga0500618_002900 3300053125 Bacteria 6144
334 Ga0500559_0004088 3300053136 Bacteria 6998
335 Ga0500568_0000378 3300053139 Bacteria 34157
336 Ga0500616_0000852 3300053153 Bacteria 33854
337 Ga0500637_0073771 3300053178 Bacteria 1965
338 Ga0500637_0093207 3300053178 Bacteria 1745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0032622 Ga0496124_0032622_3680_4564 280
2 3300026067 Ga0207678_10035093 Ga0207678_100350934 287
3 3300053153 Ga0500616_0000852 Ga0500616_0000852_20212_21141 303
4 3300031242 Ga0265329_10023474 Ga0265329_100234742 317
5 3300031249 Ga0265339_10092542 Ga0265339_100925422 317
6 3300031711 Ga0265314_10003650 Ga0265314_100036508 317
7 3300046507 Ga0495606_0025386 Ga0495606_0025386_312_1322 322
8 3300049571 Ga0501034_0008281 Ga0501034_0008281_7650_8660 322
9 3300049822 Ga0501035_0014692 Ga0501035_0014692_6050_7060 322
10 3300046501 Ga0495607_0153479 Ga0495607_0153479_118_1122 323
11 3300015262 Ga0182007_10023389 Ga0182007_100233891 326
12 3300028794 Ga0307515_10149748 Ga0307515_101497483 326
13 3300044656 Ga0466969_0003226 Ga0466969_0003226_330_1328 326
14 3300045049 Ga0466959_0041400 Ga0466959_0041400_240_1238 326
15 3300050510 nmdc:mga06r32_78632_c1 nmdc:mga06r32_78632_c1_2137_3123 328
16 3300050515 nmdc:mga0a205_19376_c1 nmdc:mga0a205_19376_c1_3253_4239 328
17 3300005455 Ga0070663_100038822 Ga0070663_1000388222 329
18 3300025910 Ga0207684_10047100 Ga0207684_100471004 329
19 3300028381 Ga0268264_10254565 Ga0268264_102545652 329
20 3300035111 Ga0373923_0024967 Ga0373923_0024967_228_1220 329
21 3300031711 Ga0265314_10022386 Ga0265314_100223864 330
22 3300049588 Ga0501072_0161896 Ga0501072_0161896_30_1028 330
23 iso_pu_bacteria 2510917030 2511193580 330
24 3300026116 Ga0207674_10007398 Ga0207674_100073986 332
25 3300050511 nmdc:mga08y16_395187_c1 nmdc:mga08y16_395187_c1_29_1030 332
26 3300050514 nmdc:mga08x19_43290_c1 nmdc:mga08x19_43290_c1_1013_2014 332
27 3300005328 Ga0070676_10020002 Ga0070676_100200024 333
28 3300005330 Ga0070690_100003124 Ga0070690_1000031246 333
29 3300005335 Ga0070666_10227175 Ga0070666_102271752 333
30 3300005353 Ga0070669_100004783 Ga0070669_1000047835 333
31 3300005364 Ga0070673_100062241 Ga0070673_1000622413 333
32 3300005367 Ga0070667_100026472 Ga0070667_1000264724 333
33 3300005441 Ga0070700_100010451 Ga0070700_1000104512 333
34 3300005456 Ga0070678_100007572 Ga0070678_1000075723 333
35 3300005457 Ga0070662_100025443 Ga0070662_1000254434 333
36 3300005543 Ga0070672_100002501 Ga0070672_1000025017 333
37 3300005618 Ga0068864_100042007 Ga0068864_1000420074 333
38 3300005719 Ga0068861_100015415 Ga0068861_1000154152 333
39 3300005840 Ga0068870_10010604 Ga0068870_100106045 333
40 3300005841 Ga0068863_100020020 Ga0068863_1000200204 333
41 3300005842 Ga0068858_100053732 Ga0068858_1000537322 333
42 3300006177 Ga0075362_10044670 Ga0075362_100446701 333
43 3300006852 Ga0075433_10025943 Ga0075433_100259432 333
44 3300006871 Ga0075434_100125165 Ga0075434_1001251653 333
45 3300017792 Ga0163161_10021615 Ga0163161_100216154 333
46 3300025315 Ga0207697_10003452 Ga0207697_100034525 333
47 3300025893 Ga0207682_10008714 Ga0207682_100087142 333
48 3300025901 Ga0207688_10002015 Ga0207688_100020155 333
49 3300025908 Ga0207643_10001901 Ga0207643_1000190111 333
50 3300025918 Ga0207662_10000636 Ga0207662_100006364 333
51 3300025920 Ga0207649_10024136 Ga0207649_100241363 333
52 3300025931 Ga0207644_10027190 Ga0207644_100271902 333
53 3300025933 Ga0207706_10011313 Ga0207706_100113133 333
54 3300025940 Ga0207691_10018394 Ga0207691_100183944 333
55 3300025942 Ga0207689_10004611 Ga0207689_100046118 333
56 3300025945 Ga0207679_10038890 Ga0207679_100388903 333
57 3300025960 Ga0207651_10170816 Ga0207651_101708162 333
58 3300025961 Ga0207712_10013817 Ga0207712_100138174 333
59 3300025972 Ga0207668_10069424 Ga0207668_100694242 333
60 3300025986 Ga0207658_10299789 Ga0207658_102997891 333
61 3300026035 Ga0207703_10091553 Ga0207703_100915532 333
62 3300026075 Ga0207708_10003601 Ga0207708_100036018 333
63 3300026089 Ga0207648_10028131 Ga0207648_100281312 333
64 3300026118 Ga0207675_100018548 Ga0207675_1000185486 333
65 3300026121 Ga0207683_10009439 Ga0207683_100094393 333
66 3300028381 Ga0268264_10036631 Ga0268264_100366312 333
67 3300050493 nmdc:mga0k408_56262_c1 nmdc:mga0k408_56262_c1_388_1425 333
68 3300050494 nmdc:mga06z11_11878_c1 nmdc:mga06z11_11878_c1_1176_2213 333
69 3300050508 nmdc:mga09592_214034_c1 nmdc:mga09592_214034_c1_23_1024 333
70 3300046518 Ga0495631_0009804 Ga0495631_0009804_2507_3589 334
71 3300046616 Ga0495668_0005477 Ga0495668_0005477_2279_3361 334
72 3300046648 Ga0495611_0052001 Ga0495611_0052001_387_1469 334
73 3300046660 Ga0495625_0048001 Ga0495625_0048001_618_1700 334
74 3300046810 Ga0495660_0146282 Ga0495660_0146282_49_1131 334
75 3300053079 Ga0500610_0012401 Ga0500610_0012401_933_2015 334
76 3300053105 Ga0500557_010852 Ga0500557_010852_822_1904 334
77 3300015261 Ga0182006_1012961 Ga0182006_10129614 335
78 3300039438 Ga0436360_0532743 Ga0436360_0532743_302_1309 335
79 iso_pu_bacteria 2599185236 2599717734 335
80 iso_pu_bacteria 2818991461 2819683289 335
81 iso_pu_bacteria 2838074704 2838077925 335
82 iso_pu_bacteria 2920760137 2920764103 335
83 iso_pu_bacteria 2989349275 2989353642 335
84 iso_pu_bacteria 8005246636 8005250510 335
85 iso_pu_bacteria 8045864390 8045864875 335
86 3300031240 Ga0265320_10007700 Ga0265320_100077006 337
87 3300031247 Ga0265340_10008768 Ga0265340_100087683 337
88 3300031344 Ga0265316_10002367 Ga0265316_1000236714 337
89 3300031344 Ga0265316_10013482 Ga0265316_100134825 337
90 3300005329 Ga0070683_100019693 Ga0070683_1000196932 338
91 3300005336 Ga0070680_100005778 Ga0070680_1000057785 338
92 3300005458 Ga0070681_10007446 Ga0070681_100074462 338
93 3300006237 Ga0097621_100089408 Ga0097621_1000894082 338
94 3300006358 Ga0068871_100040610 Ga0068871_1000406103 338
95 3300009093 Ga0105240_10075665 Ga0105240_100756652 338
96 3300025912 Ga0207707_10065309 Ga0207707_100653093 338
97 3300045049 Ga0466959_0159868 Ga0466959_0159868_202_1236 338
98 3300048929 Ga0496126_0044858 Ga0496126_0044858_137_1177 338
99 3300053178 Ga0500637_0073771 Ga0500637_0073771_419_1459 338
100 3300053178 Ga0500637_0093207 Ga0500637_0093207_492_1529 338
101 3300003187 JGI25151J46595_10001549 JGI25151J46595_100015499 339
102 3300005563 Ga0068855_100000604 Ga0068855_10000060432 339
103 3300009093 Ga0105240_10000587 Ga0105240_1000058711 339
104 3300009545 Ga0105237_10015243 Ga0105237_100152433 339
105 3300009551 Ga0105238_10098541 Ga0105238_100985412 339
106 3300013100 Ga0157373_10002840 Ga0157373_100028405 339
107 3300013307 Ga0157372_10318513 Ga0157372_103185132 339
108 3300021384 Ga0213876_10000717 Ga0213876_1000071714 339
109 3300025294 Ga0209025_1001085 Ga0209025_100108529 339
110 3300025304 Ga0209257_1009307 Ga0209257_10093076 339
111 3300025913 Ga0207695_10016507 Ga0207695_100165075 339
112 3300025914 Ga0207671_10053313 Ga0207671_100533133 339
113 3300025949 Ga0207667_10018674 Ga0207667_100186742 339
114 3300039437 Ga0436365_0328255 Ga0436365_0328255_36173_37210 339
115 3300039437 Ga0436365_1113304 Ga0436365_1113304_712_1767 339
116 3300039453 Ga0436362_0475942 Ga0436362_0475942_360_1415 339
117 3300046530 Ga0495654_0000251 Ga0495654_0000251_8473_9534 339
118 3300048925 Ga0496122_0001221 Ga0496122_0001221_19827_20888 339
119 3300048926 Ga0496123_0000980 Ga0496123_0000980_23169_24230 339
120 3300048929 Ga0496126_0043196 Ga0496126_0043196_1852_2913 339
121 3300048929 Ga0496126_0057298 Ga0496126_0057298_182_1243 339
122 3300053125 Ga0500618_002900 Ga0500618_002900_1622_2695 339
123 3300053139 Ga0500568_0000378 Ga0500568_0000378_13963_15024 339
124 3300005329 Ga0070683_100061912 Ga0070683_1000619123 340
125 3300005336 Ga0070680_100036300 Ga0070680_1000363003 340
126 3300005336 Ga0070680_100112807 Ga0070680_1001128072 340
127 3300005337 Ga0070682_100063294 Ga0070682_1000632942 340
128 3300005343 Ga0070687_100074287 Ga0070687_1000742872 340
129 3300005344 Ga0070661_100196711 Ga0070661_1001967112 340
130 3300005356 Ga0070674_100090108 Ga0070674_1000901082 340
131 3300005434 Ga0070709_10000842 Ga0070709_1000084215 340
132 3300005436 Ga0070713_100055089 Ga0070713_1000550894 340
133 3300005445 Ga0070708_100000022 Ga0070708_10000002279 340
134 3300005456 Ga0070678_100166527 Ga0070678_1001665271 340
135 3300005458 Ga0070681_10005472 Ga0070681_100054723 340
136 3300005458 Ga0070681_10007156 Ga0070681_100071566 340
137 3300005458 Ga0070681_10017654 Ga0070681_100176544 340
138 3300005458 Ga0070681_10046842 Ga0070681_100468423 340
139 3300005458 Ga0070681_10264296 Ga0070681_102642961 340
140 3300005459 Ga0068867_100085265 Ga0068867_1000852653 340
141 3300005466 Ga0070685_10029976 Ga0070685_100299762 340
142 3300005530 Ga0070679_100004500 Ga0070679_1000045008 340
143 3300005530 Ga0070679_100013945 Ga0070679_1000139455 340
144 3300005530 Ga0070679_100029984 Ga0070679_1000299843 340
145 3300005530 Ga0070679_100153269 Ga0070679_1001532693 340
146 3300005530 Ga0070679_100247693 Ga0070679_1002476932 340
147 3300005535 Ga0070684_100054613 Ga0070684_1000546133 340
148 3300005535 Ga0070684_100066909 Ga0070684_1000669092 340
149 3300005543 Ga0070672_100053959 Ga0070672_1000539593 340
150 3300005543 Ga0070672_100212339 Ga0070672_1002123392 340
151 3300005563 Ga0068855_100004878 Ga0068855_10000487816 340
152 3300005563 Ga0068855_100048250 Ga0068855_1000482501 340
153 3300005563 Ga0068855_100086670 Ga0068855_1000866702 340
154 3300005564 Ga0070664_100041730 Ga0070664_1000417302 340
155 3300005564 Ga0070664_100067268 Ga0070664_1000672682 340
156 3300005614 Ga0068856_100011511 Ga0068856_1000115119 340
157 3300005718 Ga0068866_10038724 Ga0068866_100387243 340
158 3300005937 Ga0081455_10002045 Ga0081455_100020455 340
159 3300006173 Ga0070716_100018808 Ga0070716_1000188083 340
160 3300006844 Ga0075428_100132189 Ga0075428_1001321893 340
161 3300006846 Ga0075430_100008611 Ga0075430_1000086113 340
162 3300006846 Ga0075430_100050253 Ga0075430_1000502533 340
163 3300006846 Ga0075430_100070581 Ga0075430_1000705813 340
164 3300006846 Ga0075430_100121377 Ga0075430_1001213772 340
165 3300006847 Ga0075431_100117407 Ga0075431_1001174072 340
166 3300006847 Ga0075431_100279130 Ga0075431_1002791301 340
167 3300006852 Ga0075433_10019673 Ga0075433_100196732 340
168 3300006871 Ga0075434_100026200 Ga0075434_1000262001 340
169 3300006880 Ga0075429_100214451 Ga0075429_1002144512 340
170 3300009093 Ga0105240_10023997 Ga0105240_100239975 340
171 3300009093 Ga0105240_10028285 Ga0105240_100282852 340
172 3300009093 Ga0105240_10522020 Ga0105240_105220201 340
173 3300009098 Ga0105245_10067930 Ga0105245_100679302 340
174 3300009147 Ga0114129_10074713 Ga0114129_100747133 340
175 3300009174 Ga0105241_10050861 Ga0105241_100508612 340
176 3300009176 Ga0105242_10031242 Ga0105242_100312423 340
177 3300009176 Ga0105242_10136005 Ga0105242_101360052 340
178 3300009177 Ga0105248_10124474 Ga0105248_101244742 340
179 3300009545 Ga0105237_10000094 Ga0105237_1000009419 340
180 3300009551 Ga0105238_10002763 Ga0105238_1000276318 340
181 3300009551 Ga0105238_10046267 Ga0105238_100462672 340
182 3300009551 Ga0105238_10070315 Ga0105238_100703152 340
183 3300013104 Ga0157370_10015457 Ga0157370_100154577 340
184 3300013105 Ga0157369_10005908 Ga0157369_1000590814 340
185 3300013105 Ga0157369_10044898 Ga0157369_100448982 340
186 3300013105 Ga0157369_10471788 Ga0157369_104717881 340
187 3300013308 Ga0157375_10368444 Ga0157375_103684442 340
188 3300020081 Ga0206354_10456157 Ga0206354_104561572 340
189 3300025906 Ga0207699_10005231 Ga0207699_100052316 340
190 3300025911 Ga0207654_10223913 Ga0207654_102239131 340
191 3300025912 Ga0207707_10002551 Ga0207707_100025515 340
192 3300025912 Ga0207707_10011923 Ga0207707_100119236 340
193 3300025912 Ga0207707_10027851 Ga0207707_100278513 340
194 3300025913 Ga0207695_10002340 Ga0207695_1000234015 340
195 3300025913 Ga0207695_10191117 Ga0207695_101911171 340
196 3300025914 Ga0207671_10000006 Ga0207671_10000006404 340
197 3300025917 Ga0207660_10008038 Ga0207660_100080386 340
198 3300025917 Ga0207660_10184156 Ga0207660_101841562 340
199 3300025918 Ga0207662_10008944 Ga0207662_100089445 340
200 3300025921 Ga0207652_10002296 Ga0207652_100022965 340
201 3300025921 Ga0207652_10137918 Ga0207652_101379182 340
202 3300025921 Ga0207652_10419921 Ga0207652_104199211 340
203 3300025922 Ga0207646_10320655 Ga0207646_103206552 340
204 3300025928 Ga0207700_10036636 Ga0207700_100366364 340
205 3300025934 Ga0207686_10072148 Ga0207686_100721481 340
206 3300025937 Ga0207669_10172152 Ga0207669_101721521 340
207 3300025939 Ga0207665_10063260 Ga0207665_100632603 340
208 3300025940 Ga0207691_10193922 Ga0207691_101939223 340
209 3300025940 Ga0207691_10224240 Ga0207691_102242402 340
210 3300025944 Ga0207661_10010997 Ga0207661_100109972 340
211 3300025949 Ga0207667_10017935 Ga0207667_100179355 340
212 3300025949 Ga0207667_10027082 Ga0207667_100270822 340
213 3300025949 Ga0207667_10069417 Ga0207667_100694174 340
214 3300025961 Ga0207712_10295374 Ga0207712_102953741 340
215 3300025981 Ga0207640_10111675 Ga0207640_101116751 340
216 3300025986 Ga0207658_10186488 Ga0207658_101864882 340
217 3300026078 Ga0207702_10142746 Ga0207702_101427462 340
218 3300026078 Ga0207702_10204180 Ga0207702_102041802 340
219 3300026089 Ga0207648_10095886 Ga0207648_100958863 340
220 3300028380 Ga0268265_10146940 Ga0268265_101469402 340
221 3300031241 Ga0265325_10017384 Ga0265325_100173843 340
222 3300031247 Ga0265340_10036033 Ga0265340_100360332 340
223 3300031247 Ga0265340_10055420 Ga0265340_100554203 340
224 3300031344 Ga0265316_10011176 Ga0265316_100111762 340
225 3300031595 Ga0265313_10018212 Ga0265313_100182121 340
226 3300031711 Ga0265314_10101913 Ga0265314_101019132 340
227 3300031712 Ga0265342_10041942 Ga0265342_100419422 340
228 3300031712 Ga0265342_10155294 Ga0265342_101552941 340
229 3300035120 Ga0373957_0082130 Ga0373957_0082130_141_1178 340
230 3300035170 Ga0373943_0035066 Ga0373943_0035066_1004_2038 340
231 3300035172 Ga0373955_0003850 Ga0373955_0003850_5543_6580 340
232 3300035724 Ga0373933_0007365 Ga0373933_0007365_2018_3055 340
233 3300035725 Ga0373947_0186354 Ga0373947_0186354_25_1059 340
234 3300036401 Ga0373937_0000680 Ga0373937_0000680_18679_19716 340
235 3300037068 Ga0373925_0059912 Ga0373925_0059912_1348_2385 340
236 3300037471 Ga0395905_0000007 Ga0395905_0000007_112669_113700 340
237 3300045049 Ga0466959_0021593 Ga0466959_0021593_254_1294 340
238 3300046462 Ga0495651_0014871 Ga0495651_0014871_1827_2864 340
239 3300046472 Ga0495580_0030514 Ga0495580_0030514_31_1056 340
240 3300046475 Ga0495639_0009541 Ga0495639_0009541_160_1194 340
241 3300046499 Ga0495594_0015939 Ga0495594_0015939_1704_2729 340
242 3300046499 Ga0495594_0054092 Ga0495594_0054092_989_2014 340
243 3300046526 Ga0495666_0041202 Ga0495666_0041202_471_1505 340
244 3300046529 Ga0495652_0098937 Ga0495652_0098937_540_1577 340
245 3300046531 Ga0495665_0052847 Ga0495665_0052847_732_1766 340
246 3300046535 Ga0495586_0011685 Ga0495586_0011685_3375_4409 340
247 3300046535 Ga0495586_0013363 Ga0495586_0013363_2557_3621 340
248 3300046536 Ga0495587_0009995 Ga0495587_0009995_2167_3204 340
249 3300046543 Ga0495645_0000347 Ga0495645_0000347_13865_14902 340
250 3300046559 Ga0495667_0009819 Ga0495667_0009819_3018_4055 340
251 3300046679 Ga0495623_0002335 Ga0495623_0002335_174_1211 340
252 3300046809 Ga0495600_0012343 Ga0495600_0012343_4138_5175 340
253 3300047315 Ga0495581_0014126 Ga0495581_0014126_1899_2933 340
254 3300047444 Ga0495675_0015795 Ga0495675_0015795_1383_2420 340
255 3300047471 Ga0495684_0036994 Ga0495684_0036994_1038_2072 340
256 3300047471 Ga0495684_0096906 Ga0495684_0096906_369_1406 340
257 3300048913 Ga0496110_0001858 Ga0496110_0001858_1646_2668 340
258 3300050508 nmdc:mga09592_7233_c1 nmdc:mga09592_7233_c1_6754_7788 340
259 3300050509 nmdc:mga0qj67_17556_c1 nmdc:mga0qj67_17556_c1_2374_3408 340
260 3300050509 nmdc:mga0qj67_3121_c1 nmdc:mga0qj67_3121_c1_7672_8703 340
261 3300050509 nmdc:mga0qj67_91931_c1 nmdc:mga0qj67_91931_c1_1251_2276 340
262 3300050510 nmdc:mga06r32_135606_c1 nmdc:mga06r32_135606_c1_155_1189 340
263 3300050510 nmdc:mga06r32_88882_c1 nmdc:mga06r32_88882_c1_1152_2246 340
264 3300053093 Ga0500651_0020483 Ga0500651_0020483_2380_3411 340
265 3300005355 Ga0070671_100019511 Ga0070671_1000195112 341
266 3300005719 Ga0068861_100092440 Ga0068861_1000924403 341
267 3300006028 Ga0070717_10003941 Ga0070717_100039415 341
268 3300006237 Ga0097621_100093415 Ga0097621_1000934152 341
269 3300006844 Ga0075428_100000042 Ga0075428_10000004223 341
270 3300006847 Ga0075431_100169204 Ga0075431_1001692042 341
271 3300009094 Ga0111539_10000002 Ga0111539_1000000222 341
272 3300027907 Ga0207428_10000004 Ga0207428_10000004634 341
273 3300032002 Ga0307416_100035938 Ga0307416_1000359383 341
274 3300035410 Ga0373924_0001198 Ga0373924_0001198_164_1192 341
275 3300035725 Ga0373947_0002336 Ga0373947_0002336_3306_4334 341
276 3300039438 Ga0436360_1051604 Ga0436360_1051604_169_1200 341
277 3300048919 Ga0496116_0084474 Ga0496116_0084474_238_1266 341
278 3300049569 Ga0501032_0008910 Ga0501032_0008910_665_1696 341
279 3300049570 Ga0501033_0011283 Ga0501033_0011283_33_1064 341
280 3300049571 Ga0501034_0013457 Ga0501034_0013457_1390_2421 341
281 3300049574 Ga0501038_0010035 Ga0501038_0010035_7480_8511 341
282 3300049575 Ga0501039_0028246 Ga0501039_0028246_2908_3939 341
283 3300049579 Ga0501043_0165725 Ga0501043_0165725_509_1540 341
284 3300049581 Ga0501047_0333356 Ga0501047_0333356_161_1192 341
285 3300049582 Ga0501048_0007658 Ga0501048_0007658_5081_6112 341
286 3300049584 Ga0501068_0081411 Ga0501068_0081411_406_1437 341
287 3300049586 Ga0501070_0006778 Ga0501070_0006778_6128_7159 341
288 3300049589 Ga0501073_0113329 Ga0501073_0113329_612_1643 341
289 3300049742 Ga0501080_0160334 Ga0501080_0160334_665_1696 341
290 3300049822 Ga0501035_0299738 Ga0501035_0299738_163_1194 341
291 3300049824 Ga0501045_0085385 Ga0501045_0085385_1046_2077 341
292 3300050510 nmdc:mga06r32_219578_c1 nmdc:mga06r32_219578_c1_175_1203 341
293 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_950081_951109 341
294 3300053136 Ga0500559_0004088 Ga0500559_0004088_4396_5499 341
295 3300014326 Ga0157380_10034474 Ga0157380_100344743 342
296 3300049822 Ga0501035_0015801 Ga0501035_0015801_1989_3020 342
297 3300049823 Ga0501044_0003810 Ga0501044_0003810_6738_7769 342
298 3300005295 Ga0065707_10211055 Ga0065707_102110551 343
299 3300005337 Ga0070682_100197966 Ga0070682_1001979661 343
300 3300005340 Ga0070689_100024558 Ga0070689_1000245582 343
301 3300005344 Ga0070661_100094944 Ga0070661_1000949442 343
302 3300005366 Ga0070659_100021302 Ga0070659_1000213025 343
303 3300005539 Ga0068853_100030578 Ga0068853_1000305783 343
304 3300005543 Ga0070672_100236643 Ga0070672_1002366432 343
305 3300005577 Ga0068857_100004735 Ga0068857_1000047353 343
306 3300005614 Ga0068856_100004784 Ga0068856_1000047848 343
307 3300005614 Ga0068856_100116617 Ga0068856_1001166173 343
308 3300005842 Ga0068858_100102978 Ga0068858_1001029781 343
309 3300006028 Ga0070717_10002690 Ga0070717_100026909 343
310 3300006237 Ga0097621_100127665 Ga0097621_1001276651 343
311 3300009101 Ga0105247_10021334 Ga0105247_100213343 343
312 3300009148 Ga0105243_10031366 Ga0105243_100313663 343
313 3300009176 Ga0105242_10241221 Ga0105242_102412212 343
314 3300013105 Ga0157369_10003665 Ga0157369_100036653 343
315 3300013105 Ga0157369_10512346 Ga0157369_105123462 343
316 3300013105 Ga0157369_10521434 Ga0157369_105214341 343
317 3300013296 Ga0157374_10004560 Ga0157374_100045608 343
318 3300013296 Ga0157374_10043594 Ga0157374_100435942 343
319 3300013307 Ga0157372_10130422 Ga0157372_101304222 343
320 3300014325 Ga0163163_10054254 Ga0163163_100542543 343
321 3300014968 Ga0157379_10031528 Ga0157379_100315282 343
322 3300014969 Ga0157376_10022701 Ga0157376_100227013 343
323 3300025298 Ga0209050_1000490 Ga0209050_10004905 343
324 3300025919 Ga0207657_10108720 Ga0207657_101087202 343
325 3300025920 Ga0207649_10070676 Ga0207649_100706762 343
326 3300025933 Ga0207706_10154942 Ga0207706_101549423 343
327 3300025949 Ga0207667_10192955 Ga0207667_101929552 343
328 3300026035 Ga0207703_10230963 Ga0207703_102309632 343
329 3300026078 Ga0207702_10006467 Ga0207702_100064674 343
330 3300028794 Ga0307515_10000001 Ga0307515_100000013064 343
331 3300031251 Ga0265327_10001403 Ga0265327_100014039 343
332 3300031711 Ga0265314_10092614 Ga0265314_100926143 343
333 3300031911 Ga0307412_10163756 Ga0307412_101637562 343
334 3300035118 Ga0373954_0001547 Ga0373954_0001547_8037_9071 343
335 3300035695 Ga0373927_0038272 Ga0373927_0038272_1125_2162 343
336 3300035724 Ga0373933_0038896 Ga0373933_0038896_390_1421 343
337 3300039145 Ga0237816_00013 Ga0237816_00013_8689_9873 343
338 3300041486 Ga0451807_1916943 Ga0451807_1916943_1999_3033 343
339 3300045051 Ga0451576_0041198 Ga0451576_0041198_119_1150 343
340 3300046491 Ga0495584_0028013 Ga0495584_0028013_603_1637 343
341 3300046615 Ga0495656_0105919 Ga0495656_0105919_199_1269 343
342 3300046678 Ga0495599_0051135 Ga0495599_0051135_29_1060 343
343 3300001977 JGI24746J21847_1003021 JGI24746J21847_10030212 344
344 3300005290 Ga0065712_10007828 Ga0065712_100078281 344
345 3300014745 Ga0157377_10025471 Ga0157377_100254713 344
346 3300025942 Ga0207689_10084006 Ga0207689_100840061 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

63

367

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9725 1 344
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9681 1 344
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9663 1 344
4xk2-assembly1.cif.gz_A crystal structure of aldo-keto reductase from polaromonas sp. js666 0.966 1 344
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.962 1 344
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.966 1 344 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.96 1 344 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9175 1 322 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9173 1 329 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9146 1 329 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9948 113 213 GO:0005829
GO:0016491
AF-A0A846SX31-F1-model_v4 Aldo/keto reductase 0.9945 1 306 GO:0005829
GO:0016491
AF-A0A250IZH7-F1-model_v4 Oxidoreductase 0.9928 1 344 GO:0005829
GO:0016491
AF-A0A7W9ND94-F1-model_v4 deleted 0.9914 112 344
AF-A0A531LSG7-F1-model_v4 Aldo/keto reductase 0.9912 109 225 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map