F416701
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 187 | 340 | 363 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100141269|Ga0068864_1001412693 |
| Length | 396 |
| Sequence | MILCSRSSRSKGLATVLLPDKNGSAFFELFEYLASMQFLSAEKIFTGEEWLQNHAVVVNNNMIEDILPLSSITSSVKYFDNSFIAPAFIDLQIYGAAGKLLAVYPEKDSLVKLVEYCRYGGAAYCMPTVATHPYETFYECIDAVKEYWNGGGKGVPGLHIEGPWISYEKKGAHIAECIHIPTIGQVRQLLEYGKGVIKIITLAPEVCSKEIIDFILSYDIIISAGHSSATYDEATGAFNSGVTAATHLYNAMSPLQHRNPGMVGAIMDHSHVMASIIPDGYHVDYAAIRIAKQVMKERLFAITDAVTETGTGYYPHHLAGDKYESNGILSGSALTMVKAVKNLVEHCNIEPGEALRMCSLYPARVMGLQNRLGLIKKNYEASLVVMSNDLSTVSIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 4 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 5 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 6 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 7 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 140 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 141 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 142 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 143 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 185 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.31 |
| Nodule | 0 |
| Rhizoplane | 0.87 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10037263 | 3300003215 | Bacteria | 1549 |
| 2 | rootH2_10004327 | 3300003320 | Bacteria | 11689 |
| 3 | rootH2_10011035 | 3300003320 | Bacteria | 21460 |
| 4 | rootH2_10099066 | 3300003320 | Unclassified | 2141 |
| 5 | rootH2_10127001 | 3300003320 | Bacteria | 7405 |
| 6 | rootL2_10016475 | 3300003322 | Unclassified | 2741 |
| 7 | rootH1_10040303 | 3300003316 | Bacteria | 6010 |
| 8 | rootH1_10040303 | 3300003323 | Bacteria | 6854 |
| 9 | Ga0065704_10009511 | 3300005289 | Bacteria | 2453 |
| 10 | Ga0065704_10181694 | 3300005289 | Bacteria | 1234 |
| 11 | Ga0065712_10014389 | 3300005290 | Bacteria | 3282 |
| 12 | Ga0065712_10068536 | 3300005290 | Bacteria | 10007 |
| 13 | Ga0065715_10013863 | 3300005293 | Unclassified | 2012 |
| 14 | Ga0065707_10176142 | 3300005295 | Bacteria | 1450 |
| 15 | Ga0070676_10014348 | 3300005328 | Unclassified | 4354 |
| 16 | Ga0070676_10155433 | 3300005328 | Bacteria | 1468 |
| 17 | Ga0070683_100001974 | 3300005329 | Bacteria | 16065 |
| 18 | Ga0070683_100013925 | 3300005329 | Bacteria | 7026 |
| 19 | Ga0070683_100037362 | 3300005329 | Bacteria | 4446 |
| 20 | Ga0070690_100014672 | 3300005330 | Unclassified | 4651 |
| 21 | Ga0070670_100028700 | 3300005331 | Unclassified | 4789 |
| 22 | Ga0070670_100100486 | 3300005331 | Bacteria | 2490 |
| 23 | Ga0070670_100165581 | 3300005331 | Unclassified | 1917 |
| 24 | Ga0070670_100182522 | 3300005331 | Bacteria | 1822 |
| 25 | Ga0068869_100006296 | 3300005334 | Bacteria | 7514 |
| 26 | Ga0068869_100031729 | 3300005334 | Unclassified | 3718 |
| 27 | Ga0068869_100065472 | 3300005334 | Unclassified | 2675 |
| 28 | Ga0068869_100073798 | 3300005334 | Bacteria | 2531 |
| 29 | Ga0068869_100082307 | 3300005334 | Bacteria | 2405 |
| 30 | Ga0070666_10002266 | 3300005335 | Bacteria | 11627 |
| 31 | Ga0070666_10022858 | 3300005335 | Bacteria | 4065 |
| 32 | Ga0070682_100017499 | 3300005337 | Bacteria | 4180 |
| 33 | Ga0068868_100048054 | 3300005338 | Bacteria | 3347 |
| 34 | Ga0070689_100007383 | 3300005340 | Bacteria | 7678 |
| 35 | Ga0070689_100052469 | 3300005340 | Unclassified | 3154 |
| 36 | Ga0070689_100069173 | 3300005340 | Unclassified | 2754 |
| 37 | Ga0070689_100087605 | 3300005340 | Unclassified | 2450 |
| 38 | Ga0070691_10012007 | 3300005341 | Bacteria | 3965 |
| 39 | Ga0070661_100001789 | 3300005344 | Bacteria | 14905 |
| 40 | Ga0070661_100122809 | 3300005344 | Bacteria | 1946 |
| 41 | Ga0070668_100070052 | 3300005347 | Unclassified | 2729 |
| 42 | Ga0070669_100007886 | 3300005353 | Bacteria | 7610 |
| 43 | Ga0070675_100020154 | 3300005354 | Bacteria | 5321 |
| 44 | Ga0070675_100022794 | 3300005354 | Bacteria | 5003 |
| 45 | Ga0070675_100049701 | 3300005354 | Bacteria | 3442 |
| 46 | Ga0070675_100326660 | 3300005354 | Bacteria | 1356 |
| 47 | Ga0070673_100020795 | 3300005364 | Bacteria | 4741 |
| 48 | Ga0070673_100149026 | 3300005364 | Unclassified | 1980 |
| 49 | Ga0070688_100006727 | 3300005365 | Bacteria | 6161 |
| 50 | Ga0070688_100047310 | 3300005365 | Unclassified | 2668 |
| 51 | Ga0070688_100054092 | 3300005365 | Unclassified | 2513 |
| 52 | Ga0070688_100069540 | 3300005365 | Unclassified | 2248 |
| 53 | Ga0070659_100011103 | 3300005366 | Bacteria | 6654 |
| 54 | Ga0070659_100028829 | 3300005366 | Bacteria | 4288 |
| 55 | Ga0070701_10015464 | 3300005438 | Unclassified | 3526 |
| 56 | Ga0070663_100117146 | 3300005455 | Unclassified | 2008 |
| 57 | Ga0070678_100014132 | 3300005456 | Bacteria | 5027 |
| 58 | Ga0070662_100002099 | 3300005457 | Bacteria | 12224 |
| 59 | Ga0070662_100010756 | 3300005457 | Bacteria | 6023 |
| 60 | Ga0070662_100041794 | 3300005457 | Unclassified | 3273 |
| 61 | Ga0068867_100004729 | 3300005459 | Bacteria | 9582 |
| 62 | Ga0068867_100042895 | 3300005459 | Bacteria | 3311 |
| 63 | Ga0070685_10008428 | 3300005466 | Bacteria | 5295 |
| 64 | Ga0070685_10012326 | 3300005466 | Bacteria | 4491 |
| 65 | Ga0070685_10052076 | 3300005466 | Unclassified | 2368 |
| 66 | Ga0070685_10062308 | 3300005466 | Bacteria | 2187 |
| 67 | Ga0070685_10063248 | 3300005466 | Unclassified | 2172 |
| 68 | Ga0070698_100001934 | 3300005471 | Bacteria | 23015 |
| 69 | Ga0070698_100003667 | 3300005471 | Bacteria | 16868 |
| 70 | Ga0070698_100011036 | 3300005471 | Bacteria | 9603 |
| 71 | Ga0070699_100089446 | 3300005518 | Bacteria | 2690 |
| 72 | Ga0070684_100002013 | 3300005535 | Bacteria | 14950 |
| 73 | Ga0070684_100006052 | 3300005535 | Bacteria | 9321 |
| 74 | Ga0068853_100000773 | 3300005539 | Bacteria | 22203 |
| 75 | Ga0068853_100004150 | 3300005539 | Bacteria | 11165 |
| 76 | Ga0068853_100007393 | 3300005539 | Bacteria | 8787 |
| 77 | Ga0068853_100021303 | 3300005539 | Bacteria | 5403 |
| 78 | Ga0068853_100275784 | 3300005539 | Bacteria | 1549 |
| 79 | Ga0070686_100081836 | 3300005544 | Bacteria | 2140 |
| 80 | Ga0070693_100150590 | 3300005547 | Bacteria | 1473 |
| 81 | Ga0070665_100189474 | 3300005548 | Bacteria | 2058 |
| 82 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 83 | Ga0070664_100001372 | 3300005564 | Bacteria | 19398 |
| 84 | Ga0070664_100171447 | 3300005564 | Bacteria | 1925 |
| 85 | Ga0068857_100004492 | 3300005577 | Bacteria | 11788 |
| 86 | Ga0068857_100005666 | 3300005577 | Bacteria | 10673 |
| 87 | Ga0068857_100052936 | 3300005577 | Bacteria | 3601 |
| 88 | Ga0068857_100056799 | 3300005577 | Bacteria | 3474 |
| 89 | Ga0068857_100070576 | 3300005577 | Bacteria | 3112 |
| 90 | Ga0068854_100051724 | 3300005578 | Bacteria | 2944 |
| 91 | Ga0068854_100130022 | 3300005578 | Unclassified | 1921 |
| 92 | Ga0068856_100030651 | 3300005614 | Bacteria | 5258 |
| 93 | Ga0068852_100102802 | 3300005616 | Bacteria | 2583 |
| 94 | Ga0068852_100109847 | 3300005616 | Unclassified | 2505 |
| 95 | Ga0068859_100023011 | 3300005617 | Bacteria | 6249 |
| 96 | Ga0068859_100125878 | 3300005617 | Bacteria | 2631 |
| 97 | Ga0068859_100210528 | 3300005617 | Unclassified | 2030 |
| 98 | Ga0068864_100001903 | 3300005618 | Bacteria | 17129 |
| 99 | Ga0068864_100141269 | 3300005618 | Unclassified | 2172 |
| 100 | Ga0068864_100261496 | 3300005618 | Unclassified | 1610 |
| 101 | Ga0068866_10013289 | 3300005718 | Bacteria | 3609 |
| 102 | Ga0068866_10131467 | 3300005718 | Unclassified | 1424 |
| 103 | Ga0068861_100001158 | 3300005719 | Bacteria | 16426 |
| 104 | Ga0068861_100010534 | 3300005719 | Bacteria | 6419 |
| 105 | Ga0068861_100389682 | 3300005719 | Bacteria | 1233 |
| 106 | Ga0068870_10036006 | 3300005840 | Bacteria | 2544 |
| 107 | Ga0068870_10131340 | 3300005840 | Bacteria | 1455 |
| 108 | Ga0068863_100013208 | 3300005841 | Bacteria | 7965 |
| 109 | Ga0068863_100033199 | 3300005841 | Unclassified | 4917 |
| 110 | Ga0068863_100071027 | 3300005841 | Bacteria | 3293 |
| 111 | Ga0068863_100207588 | 3300005841 | Bacteria | 1886 |
| 112 | Ga0068858_100103349 | 3300005842 | Bacteria | 2658 |
| 113 | Ga0068860_100000829 | 3300005843 | Bacteria | 34616 |
| 114 | Ga0068860_100162432 | 3300005843 | Bacteria | 2154 |
| 115 | Ga0068862_100032280 | 3300005844 | Unclassified | 4423 |
| 116 | Ga0068862_100119220 | 3300005844 | Bacteria | 2324 |
| 117 | Ga0097621_100228281 | 3300006237 | Bacteria | 1625 |
| 118 | Ga0068871_100004781 | 3300006358 | Bacteria | 9468 |
| 119 | Ga0068871_100027409 | 3300006358 | Unclassified | 4455 |
| 120 | Ga0068871_100184498 | 3300006358 | Bacteria | 1794 |
| 121 | Ga0075428_100235756 | 3300006844 | Bacteria | 1974 |
| 122 | Ga0075430_100036702 | 3300006846 | Bacteria | 4155 |
| 123 | Ga0097620_100023011 | 3300006931 | Bacteria | 6249 |
| 124 | Ga0097620_100125875 | 3300006931 | Bacteria | 2631 |
| 125 | Ga0097620_100210529 | 3300006931 | Unclassified | 2030 |
| 126 | Ga0105240_10000597 | 3300009093 | Bacteria | 67036 |
| 127 | Ga0105240_10001169 | 3300009093 | Bacteria | 46003 |
| 128 | Ga0105240_10003084 | 3300009093 | Bacteria | 26189 |
| 129 | Ga0105240_10373856 | 3300009093 | Bacteria | 1611 |
| 130 | Ga0105240_10489904 | 3300009093 | Bacteria | 1369 |
| 131 | Ga0111539_10000458 | 3300009094 | Bacteria | 51231 |
| 132 | Ga0111539_10146119 | 3300009094 | Bacteria | 2768 |
| 133 | Ga0111539_10571622 | 3300009094 | Bacteria | 1317 |
| 134 | Ga0114129_10084381 | 3300009147 | Bacteria | 4410 |
| 135 | Ga0114129_10127574 | 3300009147 | Unclassified | 3497 |
| 136 | Ga0105241_10087288 | 3300009174 | Bacteria | 2455 |
| 137 | Ga0105242_10038132 | 3300009176 | Bacteria | 3863 |
| 138 | Ga0105242_10259335 | 3300009176 | Bacteria | 1570 |
| 139 | Ga0105248_10256479 | 3300009177 | Bacteria | 1969 |
| 140 | Ga0105238_10479452 | 3300009551 | Bacteria | 1243 |
| 141 | Ga0105249_10002578 | 3300009553 | Bacteria | 15687 |
| 142 | Ga0105249_10003210 | 3300009553 | Bacteria | 14149 |
| 143 | Ga0105249_10003219 | 3300009553 | Bacteria | 14138 |
| 144 | Ga0105249_10074886 | 3300009553 | Bacteria | 3134 |
| 145 | Ga0105249_10077490 | 3300009553 | Bacteria | 3082 |
| 146 | Ga0105249_10173585 | 3300009553 | Bacteria | 2092 |
| 147 | Ga0105249_10195059 | 3300009553 | Bacteria | 1979 |
| 148 | Ga0105249_10560330 | 3300009553 | Bacteria | 1194 |
| 149 | Ga0105239_10001099 | 3300010375 | Bacteria | 37369 |
| 150 | Ga0105239_10104797 | 3300010375 | Bacteria | 3131 |
| 151 | Ga0157371_10058474 | 3300013102 | Bacteria | 2734 |
| 152 | Ga0157370_10019993 | 3300013104 | Bacteria | 6698 |
| 153 | Ga0157369_10072687 | 3300013105 | Bacteria | 3691 |
| 154 | Ga0157374_10002019 | 3300013296 | Bacteria | 17033 |
| 155 | Ga0157374_10007296 | 3300013296 | Bacteria | 9423 |
| 156 | Ga0157374_10333218 | 3300013296 | Bacteria | 1505 |
| 157 | Ga0157378_10331621 | 3300013297 | Unclassified | 1481 |
| 158 | Ga0163162_10007503 | 3300013306 | Bacteria | 10617 |
| 159 | Ga0163162_10010897 | 3300013306 | Bacteria | 8851 |
| 160 | Ga0163162_10085955 | 3300013306 | Bacteria | 3222 |
| 161 | Ga0163162_10140397 | 3300013306 | Unclassified | 2529 |
| 162 | Ga0163162_10258448 | 3300013306 | Bacteria | 1873 |
| 163 | Ga0157372_10317634 | 3300013307 | Bacteria | 1813 |
| 164 | Ga0157372_10333623 | 3300013307 | Bacteria | 1766 |
| 165 | Ga0157375_10005759 | 3300013308 | Bacteria | 10780 |
| 166 | Ga0157375_10013374 | 3300013308 | Bacteria | 7300 |
| 167 | Ga0157375_10032496 | 3300013308 | Unclassified | 4950 |
| 168 | Ga0163163_10000899 | 3300014325 | Bacteria | 25214 |
| 169 | Ga0163163_10066996 | 3300014325 | Unclassified | 3568 |
| 170 | Ga0163163_10116644 | 3300014325 | Bacteria | 2701 |
| 171 | Ga0163163_10273341 | 3300014325 | Bacteria | 1741 |
| 172 | Ga0157380_10002400 | 3300014326 | Bacteria | 12600 |
| 173 | Ga0157380_10470511 | 3300014326 | Bacteria | 1212 |
| 174 | Ga0157377_10012235 | 3300014745 | Bacteria | 4310 |
| 175 | Ga0157377_10023729 | 3300014745 | Unclassified | 3254 |
| 176 | Ga0157377_10023828 | 3300014745 | Unclassified | 3248 |
| 177 | Ga0157379_10308739 | 3300014968 | Bacteria | 1443 |
| 178 | Ga0157376_10005742 | 3300014969 | Bacteria | 8692 |
| 179 | Ga0157376_10049423 | 3300014969 | Unclassified | 3483 |
| 180 | Ga0163161_10003712 | 3300017792 | Bacteria | 10697 |
| 181 | Ga0163161_10052586 | 3300017792 | Bacteria | 2953 |
| 182 | Ga0209436_100882 | 3300025208 | Bacteria | 11960 |
| 183 | Ga0209130_1000871 | 3300025284 | Bacteria | 24706 |
| 184 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 185 | Ga0207697_10011277 | 3300025315 | Unclassified | 3785 |
| 186 | Ga0207682_10009605 | 3300025893 | Bacteria | 3813 |
| 187 | Ga0207680_10016527 | 3300025903 | Bacteria | 3876 |
| 188 | Ga0207680_10173967 | 3300025903 | Bacteria | 1452 |
| 189 | Ga0207647_10027426 | 3300025904 | Bacteria | 3712 |
| 190 | Ga0207647_10140909 | 3300025904 | Bacteria | 1413 |
| 191 | Ga0207645_10002627 | 3300025907 | Bacteria | 14014 |
| 192 | Ga0207645_10025160 | 3300025907 | Bacteria | 3853 |
| 193 | Ga0207643_10001490 | 3300025908 | Bacteria | 13411 |
| 194 | Ga0207643_10008247 | 3300025908 | Bacteria | 5593 |
| 195 | Ga0207643_10069407 | 3300025908 | Unclassified | 2026 |
| 196 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 197 | Ga0207695_10000299 | 3300025913 | Bacteria | 122118 |
| 198 | Ga0207695_10000676 | 3300025913 | Bacteria | 67018 |
| 199 | Ga0207695_10184131 | 3300025913 | Bacteria | 2009 |
| 200 | Ga0207662_10064899 | 3300025918 | Unclassified | 2198 |
| 201 | Ga0207649_10023822 | 3300025920 | Bacteria | 3550 |
| 202 | Ga0207649_10049523 | 3300025920 | Unclassified | 2595 |
| 203 | Ga0207681_10003119 | 3300025923 | Bacteria | 10425 |
| 204 | Ga0207681_10014991 | 3300025923 | Bacteria | 4830 |
| 205 | Ga0207681_10146067 | 3300025923 | Unclassified | 1767 |
| 206 | Ga0207650_10291390 | 3300025925 | Unclassified | 1331 |
| 207 | Ga0207659_10009731 | 3300025926 | Bacteria | 6012 |
| 208 | Ga0207690_10086030 | 3300025932 | Unclassified | 2208 |
| 209 | Ga0207706_10000763 | 3300025933 | Bacteria | 33452 |
| 210 | Ga0207706_10013174 | 3300025933 | Bacteria | 7525 |
| 211 | Ga0207706_10020335 | 3300025933 | Bacteria | 5967 |
| 212 | Ga0207686_10001891 | 3300025934 | Bacteria | 11598 |
| 213 | Ga0207686_10225581 | 3300025934 | Bacteria | 1355 |
| 214 | Ga0207670_10006097 | 3300025936 | Bacteria | 6662 |
| 215 | Ga0207670_10011005 | 3300025936 | Bacteria | 5231 |
| 216 | Ga0207691_10049673 | 3300025940 | Bacteria | 3844 |
| 217 | Ga0207691_10090318 | 3300025940 | Bacteria | 2746 |
| 218 | Ga0207711_10432211 | 3300025941 | Unclassified | 1225 |
| 219 | Ga0207689_10016454 | 3300025942 | Bacteria | 6260 |
| 220 | Ga0207689_10031664 | 3300025942 | Bacteria | 4401 |
| 221 | Ga0207689_10064459 | 3300025942 | Bacteria | 3015 |
| 222 | Ga0207689_10102098 | 3300025942 | Bacteria | 2356 |
| 223 | Ga0207689_10157170 | 3300025942 | Unclassified | 1874 |
| 224 | Ga0207661_10012430 | 3300025944 | Bacteria | 6187 |
| 225 | Ga0207679_10021430 | 3300025945 | Unclassified | 4381 |
| 226 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 227 | Ga0207651_10191148 | 3300025960 | Unclassified | 1633 |
| 228 | Ga0207651_10235450 | 3300025960 | Bacteria | 1489 |
| 229 | Ga0207712_10001267 | 3300025961 | Bacteria | 17398 |
| 230 | Ga0207712_10010189 | 3300025961 | Bacteria | 5961 |
| 231 | Ga0207712_10022789 | 3300025961 | Bacteria | 4127 |
| 232 | Ga0207712_10043795 | 3300025961 | Bacteria | 3089 |
| 233 | Ga0207712_10083880 | 3300025961 | Unclassified | 2327 |
| 234 | Ga0207712_10105871 | 3300025961 | Bacteria | 2100 |
| 235 | Ga0207668_10053404 | 3300025972 | Unclassified | 2800 |
| 236 | Ga0207668_10263475 | 3300025972 | Bacteria | 1406 |
| 237 | Ga0207640_10042737 | 3300025981 | Bacteria | 2892 |
| 238 | Ga0207658_10068679 | 3300025986 | Unclassified | 2675 |
| 239 | Ga0207658_10127661 | 3300025986 | Bacteria | 2038 |
| 240 | Ga0207677_10001293 | 3300026023 | Bacteria | 13421 |
| 241 | Ga0207677_10035171 | 3300026023 | Bacteria | 3250 |
| 242 | Ga0207677_10315479 | 3300026023 | Bacteria | 1297 |
| 243 | Ga0207703_10071185 | 3300026035 | Unclassified | 2872 |
| 244 | Ga0207703_10163035 | 3300026035 | Unclassified | 1954 |
| 245 | Ga0207639_10015240 | 3300026041 | Bacteria | 5418 |
| 246 | Ga0207639_10021273 | 3300026041 | Unclassified | 4657 |
| 247 | Ga0207639_10030877 | 3300026041 | Bacteria | 3933 |
| 248 | Ga0207639_10112255 | 3300026041 | Unclassified | 2224 |
| 249 | Ga0207678_10031768 | 3300026067 | Bacteria | 4603 |
| 250 | Ga0207702_10022016 | 3300026078 | Bacteria | 5279 |
| 251 | Ga0207641_10000088 | 3300026088 | Bacteria | 131959 |
| 252 | Ga0207641_10010252 | 3300026088 | Bacteria | 7706 |
| 253 | Ga0207641_10104446 | 3300026088 | Unclassified | 2501 |
| 254 | Ga0207641_10117197 | 3300026088 | Unclassified | 2371 |
| 255 | Ga0207641_10135800 | 3300026088 | Bacteria | 2214 |
| 256 | Ga0207648_10006276 | 3300026089 | Bacteria | 11830 |
| 257 | Ga0207648_10009884 | 3300026089 | Bacteria | 9094 |
| 258 | Ga0207648_10066609 | 3300026089 | Bacteria | 3141 |
| 259 | Ga0207648_10161635 | 3300026089 | Bacteria | 1978 |
| 260 | Ga0207676_10033885 | 3300026095 | Bacteria | 3863 |
| 261 | Ga0207676_10037432 | 3300026095 | Unclassified | 3697 |
| 262 | Ga0207676_10348115 | 3300026095 | Unclassified | 1369 |
| 263 | Ga0207674_10001740 | 3300026116 | Bacteria | 27826 |
| 264 | Ga0207674_10033280 | 3300026116 | Bacteria | 5397 |
| 265 | Ga0207674_10034254 | 3300026116 | Bacteria | 5312 |
| 266 | Ga0207674_10035401 | 3300026116 | Bacteria | 5210 |
| 267 | Ga0207674_10112289 | 3300026116 | Bacteria | 2699 |
| 268 | Ga0207674_10223673 | 3300026116 | Bacteria | 1830 |
| 269 | Ga0207675_100000332 | 3300026118 | Bacteria | 45114 |
| 270 | Ga0207675_100002977 | 3300026118 | Bacteria | 16664 |
| 271 | Ga0207675_100052797 | 3300026118 | Bacteria | 3792 |
| 272 | Ga0207675_100454667 | 3300026118 | Bacteria | 1269 |
| 273 | Ga0207683_10016150 | 3300026121 | Bacteria | 6354 |
| 274 | Ga0207683_10251395 | 3300026121 | Unclassified | 1613 |
| 275 | Ga0207698_10063178 | 3300026142 | Bacteria | 2896 |
| 276 | Ga0207698_10066682 | 3300026142 | Bacteria | 2834 |
| 277 | Ga0207698_10249860 | 3300026142 | Bacteria | 1622 |
| 278 | Ga0207428_10119118 | 3300027907 | Bacteria | 2026 |
| 279 | Ga0268266_10292299 | 3300028379 | Bacteria | 1518 |
| 280 | Ga0268265_10006905 | 3300028380 | Bacteria | 7679 |
| 281 | Ga0268265_10203894 | 3300028380 | Bacteria | 1718 |
| 282 | Ga0268264_10010235 | 3300028381 | Bacteria | 7763 |
| 283 | Ga0268264_10122176 | 3300028381 | Bacteria | 2296 |
| 284 | Ga0265338_10095617 | 3300028800 | Bacteria | 2440 |
| 285 | Ga0307406_10021405 | 3300031901 | Bacteria | 3824 |
| 286 | Ga0373955_0045199 | 3300035172 | Bacteria | 2376 |
| 287 | Ga0373935_0094665 | 3300035692 | Unclassified | 1961 |
| 288 | Ga0439445_0043155 | 3300042004 | Bacteria | 1203 |
| 289 | Ga0450923_006746 | 3300042125 | Bacteria | 1916 |
| 290 | Ga0450898_002452 | 3300042134 | Bacteria | 2584 |
| 291 | Ga0439434_0012964 | 3300042435 | Bacteria | 2471 |
| 292 | Ga0466969_0021061 | 3300044656 | Bacteria | 3373 |
| 293 | Ga0466961_0048369 | 3300044693 | Bacteria | 2718 |
| 294 | Ga0466964_0008038 | 3300044706 | Bacteria | 3954 |
| 295 | Ga0466971_0035320 | 3300044719 | Bacteria | 2240 |
| 296 | Ga0466970_0079518 | 3300044765 | Bacteria | 1770 |
| 297 | Ga0466959_0002115 | 3300045049 | Bacteria | 12564 |
| 298 | Ga0466959_0008505 | 3300045049 | Bacteria | 7263 |
| 299 | Ga0466959_0205507 | 3300045049 | Bacteria | 1370 |
| 300 | Ga0466958_0095788 | 3300045836 | Unclassified | 1840 |
| 301 | Ga0466967_0129334 | 3300045976 | Bacteria | 2343 |
| 302 | Ga0495653_0066443 | 3300046463 | Unclassified | 2713 |
| 303 | Ga0495650_0036861 | 3300046471 | Bacteria | 2135 |
| 304 | Ga0495633_0029925 | 3300046558 | Bacteria | 2647 |
| 305 | Ga0495667_0037524 | 3300046559 | Unclassified | 3229 |
| 306 | Ga0495646_0092093 | 3300046680 | Unclassified | 1749 |
| 307 | Ga0495674_0105473 | 3300047319 | Bacteria | 2395 |
| 308 | Ga0495672_0026788 | 3300047320 | Unclassified | 3672 |
| 309 | Ga0495686_0010160 | 3300047472 | Bacteria | 6715 |
| 310 | Ga0496101_0159981 | 3300048904 | Bacteria | 1727 |
| 311 | Ga0496110_0117212 | 3300048913 | Unclassified | 2398 |
| 312 | Ga0496115_0090337 | 3300048918 | Bacteria | 2502 |
| 313 | Ga0496124_0059093 | 3300048927 | Bacteria | 3222 |
| 314 | Ga0501032_0065670 | 3300049569 | Unclassified | 2426 |
| 315 | Ga0501034_0004888 | 3300049571 | Bacteria | 14781 |
| 316 | Ga0501036_0000934 | 3300049572 | Bacteria | 21944 |
| 317 | Ga0501037_0116648 | 3300049573 | Bacteria | 1921 |
| 318 | Ga0501038_0007548 | 3300049574 | Bacteria | 10025 |
| 319 | Ga0501039_0010296 | 3300049575 | Bacteria | 7133 |
| 320 | Ga0501046_0005974 | 3300049580 | Bacteria | 10837 |
| 321 | Ga0501047_0088735 | 3300049581 | Bacteria | 2969 |
| 322 | Ga0501047_0172254 | 3300049581 | Bacteria | 2033 |
| 323 | Ga0501048_0063639 | 3300049582 | Bacteria | 2608 |
| 324 | Ga0501067_0087335 | 3300049583 | Bacteria | 1730 |
| 325 | Ga0501068_0065989 | 3300049584 | Bacteria | 2204 |
| 326 | Ga0501070_0003667 | 3300049586 | Bacteria | 13277 |
| 327 | Ga0501072_0025187 | 3300049588 | Bacteria | 4633 |
| 328 | Ga0501073_0012410 | 3300049589 | Bacteria | 6217 |
| 329 | Ga0501080_0024066 | 3300049742 | Bacteria | 5644 |
| 330 | Ga0501083_0000193 | 3300049744 | Bacteria | 39210 |
| 331 | Ga0501035_0063734 | 3300049822 | Unclassified | 3277 |
| 332 | Ga0501044_0005186 | 3300049823 | Bacteria | 14501 |
| 333 | nmdc:mga0qj67_9535_c1 | 3300050509 | Bacteria | 7233 |
| 334 | nmdc:mga08y16_18017_c1 | 3300050511 | Bacteria | 7439 |
| 335 | Ga0500644_0011243 | 3300053088 | Unclassified | 2443 |
| 336 | Ga0500616_0024453 | 3300053153 | Unclassified | 3356 |
| 337 | Ga0500616_0025341 | 3300053153 | Unclassified | 3290 |
| 338 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 339 | Ga0501084_0024958 | 3300054114 | Bacteria | 4988 |
| 340 | Ga0466962_0024213 | 3300061719 | Bacteria | 2917 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10146119 | Ga0111539_101461191 | 332 |
| 2 | 3300049569 | Ga0501032_0065670 | Ga0501032_0065670_1341_2366 | 341 |
| 3 | 3300005289 | Ga0065704_10009511 | Ga0065704_100095112 | 343 |
| 4 | 3300005471 | Ga0070698_100011036 | Ga0070698_1000110365 | 343 |
| 5 | 3300006844 | Ga0075428_100235756 | Ga0075428_1002357562 | 343 |
| 6 | 3300006846 | Ga0075430_100036702 | Ga0075430_1000367024 | 343 |
| 7 | 3300005290 | Ga0065712_10014389 | Ga0065712_100143893 | 344 |
| 8 | 3300005290 | Ga0065712_10068536 | Ga0065712_100685369 | 344 |
| 9 | 3300005331 | Ga0070670_100165581 | Ga0070670_1001655812 | 344 |
| 10 | 3300005334 | Ga0068869_100065472 | Ga0068869_1000654723 | 344 |
| 11 | 3300005340 | Ga0070689_100069173 | Ga0070689_1000691732 | 344 |
| 12 | 3300005340 | Ga0070689_100087605 | Ga0070689_1000876052 | 344 |
| 13 | 3300005354 | Ga0070675_100049701 | Ga0070675_1000497013 | 344 |
| 14 | 3300005365 | Ga0070688_100054092 | Ga0070688_1000540922 | 344 |
| 15 | 3300005365 | Ga0070688_100069540 | Ga0070688_1000695402 | 344 |
| 16 | 3300005466 | Ga0070685_10008428 | Ga0070685_100084283 | 344 |
| 17 | 3300005466 | Ga0070685_10063248 | Ga0070685_100632482 | 344 |
| 18 | 3300005518 | Ga0070699_100089446 | Ga0070699_1000894462 | 344 |
| 19 | 3300005539 | Ga0068853_100275784 | Ga0068853_1002757842 | 344 |
| 20 | 3300005617 | Ga0068859_100210528 | Ga0068859_1002105282 | 344 |
| 21 | 3300005719 | Ga0068861_100001158 | Ga0068861_1000011589 | 344 |
| 22 | 3300006931 | Ga0097620_100210529 | Ga0097620_1002105292 | 344 |
| 23 | 3300009094 | Ga0111539_10571622 | Ga0111539_105716222 | 344 |
| 24 | 3300009177 | Ga0105248_10256479 | Ga0105248_102564791 | 344 |
| 25 | 3300009553 | Ga0105249_10002578 | Ga0105249_1000257816 | 344 |
| 26 | 3300009553 | Ga0105249_10074886 | Ga0105249_100748862 | 344 |
| 27 | 3300009553 | Ga0105249_10560330 | Ga0105249_105603302 | 344 |
| 28 | 3300017792 | Ga0163161_10052586 | Ga0163161_100525862 | 344 |
| 29 | 3300025893 | Ga0207682_10009605 | Ga0207682_100096052 | 344 |
| 30 | 3300025908 | Ga0207643_10001490 | Ga0207643_1000149012 | 344 |
| 31 | 3300025923 | Ga0207681_10146067 | Ga0207681_101460671 | 344 |
| 32 | 3300025936 | Ga0207670_10006097 | Ga0207670_100060972 | 344 |
| 33 | 3300025940 | Ga0207691_10049673 | Ga0207691_100496732 | 344 |
| 34 | 3300025942 | Ga0207689_10157170 | Ga0207689_101571702 | 344 |
| 35 | 3300025960 | Ga0207651_10191148 | Ga0207651_101911482 | 344 |
| 36 | 3300025961 | Ga0207712_10001267 | Ga0207712_100012673 | 344 |
| 37 | 3300025961 | Ga0207712_10010189 | Ga0207712_100101892 | 344 |
| 38 | 3300026035 | Ga0207703_10163035 | Ga0207703_101630352 | 344 |
| 39 | 3300026088 | Ga0207641_10104446 | Ga0207641_101044462 | 344 |
| 40 | 3300026118 | Ga0207675_100002977 | Ga0207675_1000029779 | 344 |
| 41 | 3300026121 | Ga0207683_10251395 | Ga0207683_102513952 | 344 |
| 42 | 3300047320 | Ga0495672_0026788 | Ga0495672_0026788_2007_3098 | 344 |
| 43 | 3300005841 | Ga0068863_100013208 | Ga0068863_1000132084 | 345 |
| 44 | 3300009176 | Ga0105242_10038132 | Ga0105242_100381322 | 345 |
| 45 | 3300025923 | Ga0207681_10014991 | Ga0207681_100149913 | 345 |
| 46 | 3300025934 | Ga0207686_10001891 | Ga0207686_100018917 | 345 |
| 47 | 3300025986 | Ga0207658_10068679 | Ga0207658_100686792 | 345 |
| 48 | 3300026088 | Ga0207641_10000088 | Ga0207641_1000008817 | 345 |
| 49 | 3300026142 | Ga0207698_10066682 | Ga0207698_100666821 | 345 |
| 50 | 3300014969 | Ga0157376_10049423 | Ga0157376_100494233 | 348 |
| 51 | 3300003320 | rootH2_10099066 | rootH2_100990663 | 349 |
| 52 | 3300006237 | Ga0097621_100228281 | Ga0097621_1002282812 | 349 |
| 53 | 3300006358 | Ga0068871_100004781 | Ga0068871_10000478111 | 349 |
| 54 | 3300013306 | Ga0163162_10007503 | Ga0163162_100075032 | 349 |
| 55 | 3300025961 | Ga0207712_10083880 | Ga0207712_100838802 | 349 |
| 56 | 3300009147 | Ga0114129_10084381 | Ga0114129_100843812 | 352 |
| 57 | 3300005331 | Ga0070670_100182522 | Ga0070670_1001825221 | 353 |
| 58 | 3300005618 | Ga0068864_100261496 | Ga0068864_1002614961 | 353 |
| 59 | 3300010375 | Ga0105239_10104797 | Ga0105239_101047972 | 353 |
| 60 | 3300014968 | Ga0157379_10308739 | Ga0157379_103087392 | 353 |
| 61 | 3300025925 | Ga0207650_10291390 | Ga0207650_102913902 | 353 |
| 62 | 3300026095 | Ga0207676_10033885 | Ga0207676_100338853 | 353 |
| 63 | 3300005843 | Ga0068860_100000829 | Ga0068860_10000082918 | 354 |
| 64 | 3300006358 | Ga0068871_100184498 | Ga0068871_1001844982 | 354 |
| 65 | 3300013296 | Ga0157374_10333218 | Ga0157374_103332181 | 354 |
| 66 | 3300028381 | Ga0268264_10010235 | Ga0268264_100102354 | 354 |
| 67 | iso_pu_bacteria | 2902048731 | 2902049648 | 354 |
| 68 | 3300028800 | Ga0265338_10095617 | Ga0265338_100956172 | 357 |
| 69 | 3300005577 | Ga0068857_100070576 | Ga0068857_1000705763 | 361 |
| 70 | 3300005843 | Ga0068860_100162432 | Ga0068860_1001624321 | 361 |
| 71 | 3300005844 | Ga0068862_100119220 | Ga0068862_1001192202 | 361 |
| 72 | 3300009553 | Ga0105249_10003219 | Ga0105249_100032192 | 361 |
| 73 | 3300025961 | Ga0207712_10105871 | Ga0207712_101058712 | 361 |
| 74 | 3300026095 | Ga0207676_10348115 | Ga0207676_103481152 | 361 |
| 75 | 3300026116 | Ga0207674_10034254 | Ga0207674_100342545 | 361 |
| 76 | 3300028380 | Ga0268265_10203894 | Ga0268265_102038942 | 361 |
| 77 | 3300028381 | Ga0268264_10122176 | Ga0268264_101221762 | 361 |
| 78 | iso_pu_bacteria | 2818991460 | 2819676600 | 361 |
| 79 | iso_pu_bacteria | 2929177148 | 2929178022 | 361 |
| 80 | iso_pu_bacteria | 2945977869 | 2945980381 | 361 |
| 81 | iso_pu_bacteria | 2946013367 | 2946013755 | 361 |
| 82 | 3300005539 | Ga0068853_100000773 | Ga0068853_10000077319 | 362 |
| 83 | 3300005618 | Ga0068864_100141269 | Ga0068864_1001412693 | 362 |
| 84 | 3300009093 | Ga0105240_10489904 | Ga0105240_104899042 | 362 |
| 85 | 3300009551 | Ga0105238_10479452 | Ga0105238_104794521 | 362 |
| 86 | 3300025904 | Ga0207647_10140909 | Ga0207647_101409092 | 362 |
| 87 | 3300025913 | Ga0207695_10184131 | Ga0207695_101841312 | 362 |
| 88 | 3300026041 | Ga0207639_10030877 | Ga0207639_100308774 | 362 |
| 89 | 3300003322 | rootL2_10016475 | rootL2_100164752 | 363 |
| 90 | 3300005719 | Ga0068861_100389682 | Ga0068861_1003896821 | 363 |
| 91 | 3300005840 | Ga0068870_10131340 | Ga0068870_101313402 | 363 |
| 92 | 3300005841 | Ga0068863_100033199 | Ga0068863_1000331992 | 363 |
| 93 | 3300013306 | Ga0163162_10258448 | Ga0163162_102584481 | 363 |
| 94 | 3300026088 | Ga0207641_10010252 | Ga0207641_100102528 | 363 |
| 95 | 3300026118 | Ga0207675_100454667 | Ga0207675_1004546671 | 363 |
| 96 | iso_pu_bacteria | 2818991444 | 2819585898 | 363 |
| 97 | 3300005289 | Ga0065704_10181694 | Ga0065704_101816941 | 364 |
| 98 | 3300005328 | Ga0070676_10155433 | Ga0070676_101554332 | 364 |
| 99 | 3300005329 | Ga0070683_100001974 | Ga0070683_1000019746 | 364 |
| 100 | 3300005329 | Ga0070683_100037362 | Ga0070683_1000373622 | 364 |
| 101 | 3300005330 | Ga0070690_100014672 | Ga0070690_1000146722 | 364 |
| 102 | 3300005331 | Ga0070670_100100486 | Ga0070670_1001004862 | 364 |
| 103 | 3300005334 | Ga0068869_100006296 | Ga0068869_1000062962 | 364 |
| 104 | 3300005334 | Ga0068869_100031729 | Ga0068869_1000317293 | 364 |
| 105 | 3300005334 | Ga0068869_100073798 | Ga0068869_1000737983 | 364 |
| 106 | 3300005334 | Ga0068869_100082307 | Ga0068869_1000823072 | 364 |
| 107 | 3300005335 | Ga0070666_10002266 | Ga0070666_100022667 | 364 |
| 108 | 3300005335 | Ga0070666_10022858 | Ga0070666_100228581 | 364 |
| 109 | 3300005337 | Ga0070682_100017499 | Ga0070682_1000174992 | 364 |
| 110 | 3300005338 | Ga0068868_100048054 | Ga0068868_1000480543 | 364 |
| 111 | 3300005340 | Ga0070689_100007383 | Ga0070689_1000073833 | 364 |
| 112 | 3300005340 | Ga0070689_100052469 | Ga0070689_1000524693 | 364 |
| 113 | 3300005344 | Ga0070661_100001789 | Ga0070661_1000017899 | 364 |
| 114 | 3300005344 | Ga0070661_100122809 | Ga0070661_1001228092 | 364 |
| 115 | 3300005354 | Ga0070675_100022794 | Ga0070675_1000227943 | 364 |
| 116 | 3300005354 | Ga0070675_100326660 | Ga0070675_1003266601 | 364 |
| 117 | 3300005364 | Ga0070673_100149026 | Ga0070673_1001490262 | 364 |
| 118 | 3300005365 | Ga0070688_100047310 | Ga0070688_1000473102 | 364 |
| 119 | 3300005366 | Ga0070659_100011103 | Ga0070659_1000111035 | 364 |
| 120 | 3300005366 | Ga0070659_100028829 | Ga0070659_1000288292 | 364 |
| 121 | 3300005455 | Ga0070663_100117146 | Ga0070663_1001171462 | 364 |
| 122 | 3300005456 | Ga0070678_100014132 | Ga0070678_1000141325 | 364 |
| 123 | 3300005457 | Ga0070662_100002099 | Ga0070662_1000020993 | 364 |
| 124 | 3300005457 | Ga0070662_100010756 | Ga0070662_1000107564 | 364 |
| 125 | 3300005459 | Ga0068867_100004729 | Ga0068867_1000047295 | 364 |
| 126 | 3300005459 | Ga0068867_100042895 | Ga0068867_1000428953 | 364 |
| 127 | 3300005466 | Ga0070685_10012326 | Ga0070685_100123263 | 364 |
| 128 | 3300005466 | Ga0070685_10062308 | Ga0070685_100623083 | 364 |
| 129 | 3300005471 | Ga0070698_100001934 | Ga0070698_1000019345 | 364 |
| 130 | 3300005471 | Ga0070698_100003667 | Ga0070698_1000036675 | 364 |
| 131 | 3300005535 | Ga0070684_100002013 | Ga0070684_1000020139 | 364 |
| 132 | 3300005535 | Ga0070684_100006052 | Ga0070684_1000060525 | 364 |
| 133 | 3300005539 | Ga0068853_100004150 | Ga0068853_1000041504 | 364 |
| 134 | 3300005544 | Ga0070686_100081836 | Ga0070686_1000818361 | 364 |
| 135 | 3300005548 | Ga0070665_100189474 | Ga0070665_1001894742 | 364 |
| 136 | 3300005564 | Ga0070664_100001372 | Ga0070664_1000013729 | 364 |
| 137 | 3300005577 | Ga0068857_100005666 | Ga0068857_1000056666 | 364 |
| 138 | 3300005577 | Ga0068857_100052936 | Ga0068857_1000529362 | 364 |
| 139 | 3300005578 | Ga0068854_100051724 | Ga0068854_1000517243 | 364 |
| 140 | 3300005616 | Ga0068852_100102802 | Ga0068852_1001028023 | 364 |
| 141 | 3300005617 | Ga0068859_100023011 | Ga0068859_1000230116 | 364 |
| 142 | 3300005618 | Ga0068864_100001903 | Ga0068864_1000019034 | 364 |
| 143 | 3300005718 | Ga0068866_10013289 | Ga0068866_100132893 | 364 |
| 144 | 3300005718 | Ga0068866_10131467 | Ga0068866_101314671 | 364 |
| 145 | 3300005841 | Ga0068863_100071027 | Ga0068863_1000710273 | 364 |
| 146 | 3300005841 | Ga0068863_100207588 | Ga0068863_1002075881 | 364 |
| 147 | 3300005842 | Ga0068858_100103349 | Ga0068858_1001033493 | 364 |
| 148 | 3300006358 | Ga0068871_100027409 | Ga0068871_1000274092 | 364 |
| 149 | 3300006931 | Ga0097620_100023011 | Ga0097620_1000230116 | 364 |
| 150 | 3300009093 | Ga0105240_10373856 | Ga0105240_103738561 | 364 |
| 151 | 3300009174 | Ga0105241_10087288 | Ga0105241_100872882 | 364 |
| 152 | 3300009176 | Ga0105242_10259335 | Ga0105242_102593352 | 364 |
| 153 | 3300009553 | Ga0105249_10077490 | Ga0105249_100774902 | 364 |
| 154 | 3300009553 | Ga0105249_10173585 | Ga0105249_101735852 | 364 |
| 155 | 3300009553 | Ga0105249_10195059 | Ga0105249_101950592 | 364 |
| 156 | 3300013102 | Ga0157371_10058474 | Ga0157371_100584743 | 364 |
| 157 | 3300013296 | Ga0157374_10002019 | Ga0157374_100020192 | 364 |
| 158 | 3300013296 | Ga0157374_10007296 | Ga0157374_100072963 | 364 |
| 159 | 3300013297 | Ga0157378_10331621 | Ga0157378_103316212 | 364 |
| 160 | 3300013306 | Ga0163162_10010897 | Ga0163162_100108972 | 364 |
| 161 | 3300013306 | Ga0163162_10085955 | Ga0163162_100859552 | 364 |
| 162 | 3300013306 | Ga0163162_10140397 | Ga0163162_101403972 | 364 |
| 163 | 3300013308 | Ga0157375_10005759 | Ga0157375_100057593 | 364 |
| 164 | 3300013308 | Ga0157375_10013374 | Ga0157375_100133742 | 364 |
| 165 | 3300014325 | Ga0163163_10000899 | Ga0163163_100008993 | 364 |
| 166 | 3300014325 | Ga0163163_10066996 | Ga0163163_100669962 | 364 |
| 167 | 3300014325 | Ga0163163_10116644 | Ga0163163_101166442 | 364 |
| 168 | 3300014325 | Ga0163163_10273341 | Ga0163163_102733412 | 364 |
| 169 | 3300014326 | Ga0157380_10470511 | Ga0157380_104705112 | 364 |
| 170 | 3300014745 | Ga0157377_10012235 | Ga0157377_100122352 | 364 |
| 171 | 3300014745 | Ga0157377_10023828 | Ga0157377_100238281 | 364 |
| 172 | 3300017792 | Ga0163161_10003712 | Ga0163161_100037122 | 364 |
| 173 | 3300025903 | Ga0207680_10016527 | Ga0207680_100165273 | 364 |
| 174 | 3300025903 | Ga0207680_10173967 | Ga0207680_101739672 | 364 |
| 175 | 3300025904 | Ga0207647_10027426 | Ga0207647_100274262 | 364 |
| 176 | 3300025907 | Ga0207645_10002627 | Ga0207645_100026275 | 364 |
| 177 | 3300025908 | Ga0207643_10069407 | Ga0207643_100694072 | 364 |
| 178 | 3300025920 | Ga0207649_10023822 | Ga0207649_100238222 | 364 |
| 179 | 3300025920 | Ga0207649_10049523 | Ga0207649_100495232 | 364 |
| 180 | 3300025932 | Ga0207690_10086030 | Ga0207690_100860302 | 364 |
| 181 | 3300025933 | Ga0207706_10000763 | Ga0207706_1000076324 | 364 |
| 182 | 3300025933 | Ga0207706_10013174 | Ga0207706_100131743 | 364 |
| 183 | 3300025934 | Ga0207686_10225581 | Ga0207686_102255812 | 364 |
| 184 | 3300025936 | Ga0207670_10011005 | Ga0207670_100110053 | 364 |
| 185 | 3300025940 | Ga0207691_10090318 | Ga0207691_100903182 | 364 |
| 186 | 3300025941 | Ga0207711_10432211 | Ga0207711_104322111 | 364 |
| 187 | 3300025942 | Ga0207689_10016454 | Ga0207689_100164544 | 364 |
| 188 | 3300025942 | Ga0207689_10031664 | Ga0207689_100316643 | 364 |
| 189 | 3300025942 | Ga0207689_10064459 | Ga0207689_100644592 | 364 |
| 190 | 3300025942 | Ga0207689_10102098 | Ga0207689_101020981 | 364 |
| 191 | 3300025944 | Ga0207661_10012430 | Ga0207661_100124303 | 364 |
| 192 | 3300025945 | Ga0207679_10021430 | Ga0207679_100214302 | 364 |
| 193 | 3300025960 | Ga0207651_10235450 | Ga0207651_102354502 | 364 |
| 194 | 3300025961 | Ga0207712_10043795 | Ga0207712_100437953 | 364 |
| 195 | 3300025972 | Ga0207668_10263475 | Ga0207668_102634751 | 364 |
| 196 | 3300025981 | Ga0207640_10042737 | Ga0207640_100427373 | 364 |
| 197 | 3300025986 | Ga0207658_10127661 | Ga0207658_101276613 | 364 |
| 198 | 3300026023 | Ga0207677_10001293 | Ga0207677_100012934 | 364 |
| 199 | 3300026023 | Ga0207677_10035171 | Ga0207677_100351712 | 364 |
| 200 | 3300026023 | Ga0207677_10315479 | Ga0207677_103154791 | 364 |
| 201 | 3300026035 | Ga0207703_10071185 | Ga0207703_100711852 | 364 |
| 202 | 3300026041 | Ga0207639_10021273 | Ga0207639_100212731 | 364 |
| 203 | 3300026067 | Ga0207678_10031768 | Ga0207678_100317684 | 364 |
| 204 | 3300026088 | Ga0207641_10117197 | Ga0207641_101171972 | 364 |
| 205 | 3300026088 | Ga0207641_10135800 | Ga0207641_101358002 | 364 |
| 206 | 3300026089 | Ga0207648_10006276 | Ga0207648_100062766 | 364 |
| 207 | 3300026089 | Ga0207648_10009884 | Ga0207648_100098845 | 364 |
| 208 | 3300026089 | Ga0207648_10066609 | Ga0207648_100666091 | 364 |
| 209 | 3300026089 | Ga0207648_10161635 | Ga0207648_101616352 | 364 |
| 210 | 3300026095 | Ga0207676_10037432 | Ga0207676_100374322 | 364 |
| 211 | 3300026116 | Ga0207674_10001740 | Ga0207674_1000174011 | 364 |
| 212 | 3300026116 | Ga0207674_10033280 | Ga0207674_100332803 | 364 |
| 213 | 3300026116 | Ga0207674_10035401 | Ga0207674_100354013 | 364 |
| 214 | 3300026118 | Ga0207675_100052797 | Ga0207675_1000527973 | 364 |
| 215 | 3300026121 | Ga0207683_10016150 | Ga0207683_100161503 | 364 |
| 216 | 3300026142 | Ga0207698_10249860 | Ga0207698_102498602 | 364 |
| 217 | 3300028379 | Ga0268266_10292299 | Ga0268266_102922992 | 364 |
| 218 | 3300035172 | Ga0373955_0045199 | Ga0373955_0045199_405_1505 | 364 |
| 219 | 3300035692 | Ga0373935_0094665 | Ga0373935_0094665_210_1310 | 364 |
| 220 | 3300042125 | Ga0450923_006746 | Ga0450923_006746_549_1643 | 364 |
| 221 | 3300046463 | Ga0495653_0066443 | Ga0495653_0066443_154_1254 | 364 |
| 222 | 3300046471 | Ga0495650_0036861 | Ga0495650_0036861_980_2080 | 364 |
| 223 | 3300046559 | Ga0495667_0037524 | Ga0495667_0037524_1523_2623 | 364 |
| 224 | 3300046680 | Ga0495646_0092093 | Ga0495646_0092093_465_1565 | 364 |
| 225 | 3300047319 | Ga0495674_0105473 | Ga0495674_0105473_993_2093 | 364 |
| 226 | 3300048904 | Ga0496101_0159981 | Ga0496101_0159981_318_1418 | 364 |
| 227 | 3300048913 | Ga0496110_0117212 | Ga0496110_0117212_487_1587 | 364 |
| 228 | 3300049571 | Ga0501034_0004888 | Ga0501034_0004888_5270_6370 | 364 |
| 229 | 3300049572 | Ga0501036_0000934 | Ga0501036_0000934_19541_20641 | 364 |
| 230 | 3300049573 | Ga0501037_0116648 | Ga0501037_0116648_782_1882 | 364 |
| 231 | 3300049574 | Ga0501038_0007548 | Ga0501038_0007548_3911_5011 | 364 |
| 232 | 3300049575 | Ga0501039_0010296 | Ga0501039_0010296_382_1482 | 364 |
| 233 | 3300049580 | Ga0501046_0005974 | Ga0501046_0005974_2869_3969 | 364 |
| 234 | 3300049582 | Ga0501048_0063639 | Ga0501048_0063639_1344_2444 | 364 |
| 235 | 3300049583 | Ga0501067_0087335 | Ga0501067_0087335_442_1542 | 364 |
| 236 | 3300049584 | Ga0501068_0065989 | Ga0501068_0065989_56_1156 | 364 |
| 237 | 3300049586 | Ga0501070_0003667 | Ga0501070_0003667_8441_9541 | 364 |
| 238 | 3300049588 | Ga0501072_0025187 | Ga0501072_0025187_2037_3131 | 364 |
| 239 | 3300049589 | Ga0501073_0012410 | Ga0501073_0012410_2997_4097 | 364 |
| 240 | 3300049742 | Ga0501080_0024066 | Ga0501080_0024066_3966_5066 | 364 |
| 241 | 3300049744 | Ga0501083_0000193 | Ga0501083_0000193_28676_29776 | 364 |
| 242 | 3300049822 | Ga0501035_0063734 | Ga0501035_0063734_1453_2553 | 364 |
| 243 | 3300049823 | Ga0501044_0005186 | Ga0501044_0005186_5116_6216 | 364 |
| 244 | 3300054114 | Ga0501084_0024958 | Ga0501084_0024958_1237_2337 | 364 |
| 245 | 3300003320 | rootH2_10004327 | rootH2_100043277 | 365 |
| 246 | 3300003320 | rootH2_10011035 | rootH2_1001103517 | 365 |
| 247 | 3300003323 | rootH1_10040303 | rootH1_100403033 | 365 |
| 248 | 3300005293 | Ga0065715_10013863 | Ga0065715_100138632 | 365 |
| 249 | 3300005295 | Ga0065707_10176142 | Ga0065707_101761422 | 365 |
| 250 | 3300005328 | Ga0070676_10014348 | Ga0070676_100143482 | 365 |
| 251 | 3300005331 | Ga0070670_100028700 | Ga0070670_1000287003 | 365 |
| 252 | 3300005347 | Ga0070668_100070052 | Ga0070668_1000700522 | 365 |
| 253 | 3300005353 | Ga0070669_100007886 | Ga0070669_1000078866 | 365 |
| 254 | 3300005354 | Ga0070675_100020154 | Ga0070675_1000201543 | 365 |
| 255 | 3300005364 | Ga0070673_100020795 | Ga0070673_1000207954 | 365 |
| 256 | 3300005365 | Ga0070688_100006727 | Ga0070688_1000067274 | 365 |
| 257 | 3300005438 | Ga0070701_10015464 | Ga0070701_100154643 | 365 |
| 258 | 3300005457 | Ga0070662_100041794 | Ga0070662_1000417944 | 365 |
| 259 | 3300005466 | Ga0070685_10052076 | Ga0070685_100520763 | 365 |
| 260 | 3300005564 | Ga0070664_100171447 | Ga0070664_1001714472 | 365 |
| 261 | 3300005577 | Ga0068857_100004492 | Ga0068857_10000449211 | 365 |
| 262 | 3300005577 | Ga0068857_100056799 | Ga0068857_1000567993 | 365 |
| 263 | 3300005617 | Ga0068859_100125878 | Ga0068859_1001258784 | 365 |
| 264 | 3300005719 | Ga0068861_100010534 | Ga0068861_1000105344 | 365 |
| 265 | 3300005840 | Ga0068870_10036006 | Ga0068870_100360064 | 365 |
| 266 | 3300005844 | Ga0068862_100032280 | Ga0068862_1000322804 | 365 |
| 267 | 3300006931 | Ga0097620_100125875 | Ga0097620_1001258754 | 365 |
| 268 | 3300009094 | Ga0111539_10000458 | Ga0111539_1000045838 | 365 |
| 269 | 3300009147 | Ga0114129_10127574 | Ga0114129_101275743 | 365 |
| 270 | 3300009553 | Ga0105249_10003210 | Ga0105249_100032104 | 365 |
| 271 | 3300013308 | Ga0157375_10032496 | Ga0157375_100324964 | 365 |
| 272 | 3300014326 | Ga0157380_10002400 | Ga0157380_100024004 | 365 |
| 273 | 3300014745 | Ga0157377_10023729 | Ga0157377_100237294 | 365 |
| 274 | 3300014969 | Ga0157376_10005742 | Ga0157376_100057427 | 365 |
| 275 | 3300025208 | Ga0209436_100882 | Ga0209436_1008822 | 365 |
| 276 | 3300025284 | Ga0209130_1000871 | Ga0209130_10008715 | 365 |
| 277 | 3300025302 | Ga0207426_1000033 | Ga0207426_1000033263 | 365 |
| 278 | 3300025315 | Ga0207697_10011277 | Ga0207697_100112774 | 365 |
| 279 | 3300025907 | Ga0207645_10025160 | Ga0207645_100251604 | 365 |
| 280 | 3300025908 | Ga0207643_10008247 | Ga0207643_100082474 | 365 |
| 281 | 3300025918 | Ga0207662_10064899 | Ga0207662_100648992 | 365 |
| 282 | 3300025923 | Ga0207681_10003119 | Ga0207681_100031192 | 365 |
| 283 | 3300025926 | Ga0207659_10009731 | Ga0207659_100097316 | 365 |
| 284 | 3300025933 | Ga0207706_10020335 | Ga0207706_100203354 | 365 |
| 285 | 3300025972 | Ga0207668_10053404 | Ga0207668_100534043 | 365 |
| 286 | 3300026116 | Ga0207674_10112289 | Ga0207674_101122892 | 365 |
| 287 | 3300026116 | Ga0207674_10223673 | Ga0207674_102236732 | 365 |
| 288 | 3300026118 | Ga0207675_100000332 | Ga0207675_10000033234 | 365 |
| 289 | 3300027907 | Ga0207428_10119118 | Ga0207428_101191183 | 365 |
| 290 | 3300028380 | Ga0268265_10006905 | Ga0268265_100069056 | 365 |
| 291 | 3300031901 | Ga0307406_10021405 | Ga0307406_100214054 | 365 |
| 292 | 3300042004 | Ga0439445_0043155 | Ga0439445_0043155_55_1164 | 365 |
| 293 | 3300042134 | Ga0450898_002452 | Ga0450898_002452_57_1166 | 365 |
| 294 | 3300042435 | Ga0439434_0012964 | Ga0439434_0012964_1124_2233 | 365 |
| 295 | 3300045049 | Ga0466959_0002115 | Ga0466959_0002115_8634_9731 | 365 |
| 296 | 3300048918 | Ga0496115_0090337 | Ga0496115_0090337_1294_2421 | 365 |
| 297 | 3300048927 | Ga0496124_0059093 | Ga0496124_0059093_1777_2880 | 365 |
| 298 | 3300049581 | Ga0501047_0088735 | Ga0501047_0088735_1009_2106 | 365 |
| 299 | 3300049581 | Ga0501047_0172254 | Ga0501047_0172254_675_1772 | 365 |
| 300 | 3300050509 | nmdc:mga0qj67_9535_c1 | nmdc:mga0qj67_9535_c1_2173_3270 | 365 |
| 301 | 3300050511 | nmdc:mga08y16_18017_c1 | nmdc:mga08y16_18017_c1_3711_4814 | 365 |
| 302 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_185730_186827 | 365 |
| 303 | 3300005539 | Ga0068853_100021303 | Ga0068853_1000213033 | 366 |
| 304 | 3300005547 | Ga0070693_100150590 | Ga0070693_1001505902 | 366 |
| 305 | 3300013307 | Ga0157372_10333623 | Ga0157372_103336231 | 366 |
| 306 | 3300025961 | Ga0207712_10022789 | Ga0207712_100227893 | 366 |
| 307 | 3300026041 | Ga0207639_10015240 | Ga0207639_100152403 | 366 |
| 308 | 3300045976 | Ga0466967_0129334 | Ga0466967_0129334_324_1430 | 366 |
| 309 | 3300046558 | Ga0495633_0029925 | Ga0495633_0029925_686_1789 | 366 |
| 310 | 3300047472 | Ga0495686_0010160 | Ga0495686_0010160_2325_3431 | 366 |
| 311 | 3300053153 | Ga0500616_0025341 | Ga0500616_0025341_1439_2539 | 366 |
| 312 | 3300005539 | Ga0068853_100007393 | Ga0068853_1000073933 | 367 |
| 313 | 3300026041 | Ga0207639_10112255 | Ga0207639_101122553 | 367 |
| 314 | iso_pu_bacteria | 2929154850 | 2929159343 | 368 |
| 315 | 3300009093 | Ga0105240_10000597 | Ga0105240_1000059735 | 369 |
| 316 | 3300009093 | Ga0105240_10001169 | Ga0105240_1000116937 | 369 |
| 317 | 3300010375 | Ga0105239_10001099 | Ga0105239_1000109931 | 369 |
| 318 | 3300025913 | Ga0207695_10000299 | Ga0207695_1000029967 | 369 |
| 319 | 3300025913 | Ga0207695_10000676 | Ga0207695_1000067625 | 369 |
| 320 | 3300044706 | Ga0466964_0008038 | Ga0466964_0008038_1994_3148 | 369 |
| 321 | 3300053088 | Ga0500644_0011243 | Ga0500644_0011243_906_2039 | 369 |
| 322 | 3300053153 | Ga0500616_0024453 | Ga0500616_0024453_534_1691 | 369 |
| 323 | 3300003215 | JGI25153J46596_10037263 | JGI25153J46596_100372631 | 370 |
| 324 | 3300003320 | rootH2_10127001 | rootH2_101270014 | 370 |
| 325 | 3300005329 | Ga0070683_100013925 | Ga0070683_1000139256 | 370 |
| 326 | 3300005341 | Ga0070691_10012007 | Ga0070691_100120073 | 370 |
| 327 | 3300005563 | Ga0068855_100000081 | Ga0068855_10000008115 | 370 |
| 328 | 3300005578 | Ga0068854_100130022 | Ga0068854_1001300222 | 370 |
| 329 | 3300005614 | Ga0068856_100030651 | Ga0068856_1000306513 | 370 |
| 330 | 3300005616 | Ga0068852_100109847 | Ga0068852_1001098472 | 370 |
| 331 | 3300009093 | Ga0105240_10003084 | Ga0105240_1000308411 | 370 |
| 332 | 3300013104 | Ga0157370_10019993 | Ga0157370_100199932 | 370 |
| 333 | 3300013105 | Ga0157369_10072687 | Ga0157369_100726872 | 370 |
| 334 | 3300013307 | Ga0157372_10317634 | Ga0157372_103176342 | 370 |
| 335 | 3300025913 | Ga0207695_10000087 | Ga0207695_10000087237 | 370 |
| 336 | 3300025949 | Ga0207667_10000172 | Ga0207667_1000017265 | 370 |
| 337 | 3300026078 | Ga0207702_10022016 | Ga0207702_100220163 | 370 |
| 338 | 3300026142 | Ga0207698_10063178 | Ga0207698_100631783 | 370 |
| 339 | 3300044656 | Ga0466969_0021061 | Ga0466969_0021061_135_1250 | 370 |
| 340 | 3300044693 | Ga0466961_0048369 | Ga0466961_0048369_531_1646 | 370 |
| 341 | 3300044719 | Ga0466971_0035320 | Ga0466971_0035320_451_1566 | 370 |
| 342 | 3300044765 | Ga0466970_0079518 | Ga0466970_0079518_176_1291 | 370 |
| 343 | 3300045049 | Ga0466959_0008505 | Ga0466959_0008505_5293_6408 | 370 |
| 344 | 3300045049 | Ga0466959_0205507 | Ga0466959_0205507_192_1307 | 370 |
| 345 | 3300045836 | Ga0466958_0095788 | Ga0466958_0095788_168_1283 | 370 |
| 346 | 3300061719 | Ga0466962_0024213 | Ga0466962_0024213_490_1605 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p53-assembly1.cif.gz_B | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate | 0.9707 | 3 | 368 |
| 6jku-assembly1.cif.gz_C | crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida | 0.9665 | 2 | 369 |
| 1ymy-assembly1.cif.gz_B | crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 | 0.9638 | 3 | 368 |
| 2p50-assembly2.cif.gz_D | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.9619 | 3 | 368 |
| 3iv8-assembly2.cif.gz_D | n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate | 0.9614 | 1 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iv8D01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9516 | 1 | 54 | 2.30.40.10 |
| 1yrrB01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9494 | 4 | 54 | 2.30.40.10 |
| 2vhlA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9442 | 56 | 342 | 3.20.20.140 |
| af_P42906_1_128_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9415 | 215 | 333 | 3.20.20.140 |
| af_O53382_52_348_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9408 | 56 | 336 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5CSS3-F1-model_v4 | N-acetylglucosamine 6-phosphate deacetylase | 0.996 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A2S5A4R6-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9919 | 3 | 369 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A7G6YIM0-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) | 0.9891 | 1 | 369 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A1I5CSS3-F1-model_v4 | N-acetylglucosamine 6-phosphate deacetylase | 0.9879 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A5B7ZZW1-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) | 0.9876 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar