F416701

General Info

Members Datasets Scaffolds Average Seq Length
346 187 340 363

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100141269|Ga0068864_1001412693
Length 396
Sequence MILCSRSSRSKGLATVLLPDKNGSAFFELFEYLASMQFLSAEKIFTGEEWLQNHAVVVNNNMIEDILPLSSITSSVKYFDNSFIAPAFIDLQIYGAAGKLLAVYPEKDSLVKLVEYCRYGGAAYCMPTVATHPYETFYECIDAVKEYWNGGGKGVPGLHIEGPWISYEKKGAHIAECIHIPTIGQVRQLLEYGKGVIKIITLAPEVCSKEIIDFILSYDIIISAGHSSATYDEATGAFNSGVTAATHLYNAMSPLQHRNPGMVGAIMDHSHVMASIIPDGYHVDYAAIRIAKQVMKERLFAITDAVTETGTGYYPHHLAGDKYESNGILSGSALTMVKAVKNLVEHCNIEPGEALRMCSLYPARVMGLQNRLGLIKKNYEASLVVMSNDLSTVSIL

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
4 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
5 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
6 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
7 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 0.87
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10037263 3300003215 Bacteria 1549
2 rootH2_10004327 3300003320 Bacteria 11689
3 rootH2_10011035 3300003320 Bacteria 21460
4 rootH2_10099066 3300003320 Unclassified 2141
5 rootH2_10127001 3300003320 Bacteria 7405
6 rootL2_10016475 3300003322 Unclassified 2741
7 rootH1_10040303 3300003316 Bacteria 6010
8 rootH1_10040303 3300003323 Bacteria 6854
9 Ga0065704_10009511 3300005289 Bacteria 2453
10 Ga0065704_10181694 3300005289 Bacteria 1234
11 Ga0065712_10014389 3300005290 Bacteria 3282
12 Ga0065712_10068536 3300005290 Bacteria 10007
13 Ga0065715_10013863 3300005293 Unclassified 2012
14 Ga0065707_10176142 3300005295 Bacteria 1450
15 Ga0070676_10014348 3300005328 Unclassified 4354
16 Ga0070676_10155433 3300005328 Bacteria 1468
17 Ga0070683_100001974 3300005329 Bacteria 16065
18 Ga0070683_100013925 3300005329 Bacteria 7026
19 Ga0070683_100037362 3300005329 Bacteria 4446
20 Ga0070690_100014672 3300005330 Unclassified 4651
21 Ga0070670_100028700 3300005331 Unclassified 4789
22 Ga0070670_100100486 3300005331 Bacteria 2490
23 Ga0070670_100165581 3300005331 Unclassified 1917
24 Ga0070670_100182522 3300005331 Bacteria 1822
25 Ga0068869_100006296 3300005334 Bacteria 7514
26 Ga0068869_100031729 3300005334 Unclassified 3718
27 Ga0068869_100065472 3300005334 Unclassified 2675
28 Ga0068869_100073798 3300005334 Bacteria 2531
29 Ga0068869_100082307 3300005334 Bacteria 2405
30 Ga0070666_10002266 3300005335 Bacteria 11627
31 Ga0070666_10022858 3300005335 Bacteria 4065
32 Ga0070682_100017499 3300005337 Bacteria 4180
33 Ga0068868_100048054 3300005338 Bacteria 3347
34 Ga0070689_100007383 3300005340 Bacteria 7678
35 Ga0070689_100052469 3300005340 Unclassified 3154
36 Ga0070689_100069173 3300005340 Unclassified 2754
37 Ga0070689_100087605 3300005340 Unclassified 2450
38 Ga0070691_10012007 3300005341 Bacteria 3965
39 Ga0070661_100001789 3300005344 Bacteria 14905
40 Ga0070661_100122809 3300005344 Bacteria 1946
41 Ga0070668_100070052 3300005347 Unclassified 2729
42 Ga0070669_100007886 3300005353 Bacteria 7610
43 Ga0070675_100020154 3300005354 Bacteria 5321
44 Ga0070675_100022794 3300005354 Bacteria 5003
45 Ga0070675_100049701 3300005354 Bacteria 3442
46 Ga0070675_100326660 3300005354 Bacteria 1356
47 Ga0070673_100020795 3300005364 Bacteria 4741
48 Ga0070673_100149026 3300005364 Unclassified 1980
49 Ga0070688_100006727 3300005365 Bacteria 6161
50 Ga0070688_100047310 3300005365 Unclassified 2668
51 Ga0070688_100054092 3300005365 Unclassified 2513
52 Ga0070688_100069540 3300005365 Unclassified 2248
53 Ga0070659_100011103 3300005366 Bacteria 6654
54 Ga0070659_100028829 3300005366 Bacteria 4288
55 Ga0070701_10015464 3300005438 Unclassified 3526
56 Ga0070663_100117146 3300005455 Unclassified 2008
57 Ga0070678_100014132 3300005456 Bacteria 5027
58 Ga0070662_100002099 3300005457 Bacteria 12224
59 Ga0070662_100010756 3300005457 Bacteria 6023
60 Ga0070662_100041794 3300005457 Unclassified 3273
61 Ga0068867_100004729 3300005459 Bacteria 9582
62 Ga0068867_100042895 3300005459 Bacteria 3311
63 Ga0070685_10008428 3300005466 Bacteria 5295
64 Ga0070685_10012326 3300005466 Bacteria 4491
65 Ga0070685_10052076 3300005466 Unclassified 2368
66 Ga0070685_10062308 3300005466 Bacteria 2187
67 Ga0070685_10063248 3300005466 Unclassified 2172
68 Ga0070698_100001934 3300005471 Bacteria 23015
69 Ga0070698_100003667 3300005471 Bacteria 16868
70 Ga0070698_100011036 3300005471 Bacteria 9603
71 Ga0070699_100089446 3300005518 Bacteria 2690
72 Ga0070684_100002013 3300005535 Bacteria 14950
73 Ga0070684_100006052 3300005535 Bacteria 9321
74 Ga0068853_100000773 3300005539 Bacteria 22203
75 Ga0068853_100004150 3300005539 Bacteria 11165
76 Ga0068853_100007393 3300005539 Bacteria 8787
77 Ga0068853_100021303 3300005539 Bacteria 5403
78 Ga0068853_100275784 3300005539 Bacteria 1549
79 Ga0070686_100081836 3300005544 Bacteria 2140
80 Ga0070693_100150590 3300005547 Bacteria 1473
81 Ga0070665_100189474 3300005548 Bacteria 2058
82 Ga0068855_100000081 3300005563 Bacteria 115707
83 Ga0070664_100001372 3300005564 Bacteria 19398
84 Ga0070664_100171447 3300005564 Bacteria 1925
85 Ga0068857_100004492 3300005577 Bacteria 11788
86 Ga0068857_100005666 3300005577 Bacteria 10673
87 Ga0068857_100052936 3300005577 Bacteria 3601
88 Ga0068857_100056799 3300005577 Bacteria 3474
89 Ga0068857_100070576 3300005577 Bacteria 3112
90 Ga0068854_100051724 3300005578 Bacteria 2944
91 Ga0068854_100130022 3300005578 Unclassified 1921
92 Ga0068856_100030651 3300005614 Bacteria 5258
93 Ga0068852_100102802 3300005616 Bacteria 2583
94 Ga0068852_100109847 3300005616 Unclassified 2505
95 Ga0068859_100023011 3300005617 Bacteria 6249
96 Ga0068859_100125878 3300005617 Bacteria 2631
97 Ga0068859_100210528 3300005617 Unclassified 2030
98 Ga0068864_100001903 3300005618 Bacteria 17129
99 Ga0068864_100141269 3300005618 Unclassified 2172
100 Ga0068864_100261496 3300005618 Unclassified 1610
101 Ga0068866_10013289 3300005718 Bacteria 3609
102 Ga0068866_10131467 3300005718 Unclassified 1424
103 Ga0068861_100001158 3300005719 Bacteria 16426
104 Ga0068861_100010534 3300005719 Bacteria 6419
105 Ga0068861_100389682 3300005719 Bacteria 1233
106 Ga0068870_10036006 3300005840 Bacteria 2544
107 Ga0068870_10131340 3300005840 Bacteria 1455
108 Ga0068863_100013208 3300005841 Bacteria 7965
109 Ga0068863_100033199 3300005841 Unclassified 4917
110 Ga0068863_100071027 3300005841 Bacteria 3293
111 Ga0068863_100207588 3300005841 Bacteria 1886
112 Ga0068858_100103349 3300005842 Bacteria 2658
113 Ga0068860_100000829 3300005843 Bacteria 34616
114 Ga0068860_100162432 3300005843 Bacteria 2154
115 Ga0068862_100032280 3300005844 Unclassified 4423
116 Ga0068862_100119220 3300005844 Bacteria 2324
117 Ga0097621_100228281 3300006237 Bacteria 1625
118 Ga0068871_100004781 3300006358 Bacteria 9468
119 Ga0068871_100027409 3300006358 Unclassified 4455
120 Ga0068871_100184498 3300006358 Bacteria 1794
121 Ga0075428_100235756 3300006844 Bacteria 1974
122 Ga0075430_100036702 3300006846 Bacteria 4155
123 Ga0097620_100023011 3300006931 Bacteria 6249
124 Ga0097620_100125875 3300006931 Bacteria 2631
125 Ga0097620_100210529 3300006931 Unclassified 2030
126 Ga0105240_10000597 3300009093 Bacteria 67036
127 Ga0105240_10001169 3300009093 Bacteria 46003
128 Ga0105240_10003084 3300009093 Bacteria 26189
129 Ga0105240_10373856 3300009093 Bacteria 1611
130 Ga0105240_10489904 3300009093 Bacteria 1369
131 Ga0111539_10000458 3300009094 Bacteria 51231
132 Ga0111539_10146119 3300009094 Bacteria 2768
133 Ga0111539_10571622 3300009094 Bacteria 1317
134 Ga0114129_10084381 3300009147 Bacteria 4410
135 Ga0114129_10127574 3300009147 Unclassified 3497
136 Ga0105241_10087288 3300009174 Bacteria 2455
137 Ga0105242_10038132 3300009176 Bacteria 3863
138 Ga0105242_10259335 3300009176 Bacteria 1570
139 Ga0105248_10256479 3300009177 Bacteria 1969
140 Ga0105238_10479452 3300009551 Bacteria 1243
141 Ga0105249_10002578 3300009553 Bacteria 15687
142 Ga0105249_10003210 3300009553 Bacteria 14149
143 Ga0105249_10003219 3300009553 Bacteria 14138
144 Ga0105249_10074886 3300009553 Bacteria 3134
145 Ga0105249_10077490 3300009553 Bacteria 3082
146 Ga0105249_10173585 3300009553 Bacteria 2092
147 Ga0105249_10195059 3300009553 Bacteria 1979
148 Ga0105249_10560330 3300009553 Bacteria 1194
149 Ga0105239_10001099 3300010375 Bacteria 37369
150 Ga0105239_10104797 3300010375 Bacteria 3131
151 Ga0157371_10058474 3300013102 Bacteria 2734
152 Ga0157370_10019993 3300013104 Bacteria 6698
153 Ga0157369_10072687 3300013105 Bacteria 3691
154 Ga0157374_10002019 3300013296 Bacteria 17033
155 Ga0157374_10007296 3300013296 Bacteria 9423
156 Ga0157374_10333218 3300013296 Bacteria 1505
157 Ga0157378_10331621 3300013297 Unclassified 1481
158 Ga0163162_10007503 3300013306 Bacteria 10617
159 Ga0163162_10010897 3300013306 Bacteria 8851
160 Ga0163162_10085955 3300013306 Bacteria 3222
161 Ga0163162_10140397 3300013306 Unclassified 2529
162 Ga0163162_10258448 3300013306 Bacteria 1873
163 Ga0157372_10317634 3300013307 Bacteria 1813
164 Ga0157372_10333623 3300013307 Bacteria 1766
165 Ga0157375_10005759 3300013308 Bacteria 10780
166 Ga0157375_10013374 3300013308 Bacteria 7300
167 Ga0157375_10032496 3300013308 Unclassified 4950
168 Ga0163163_10000899 3300014325 Bacteria 25214
169 Ga0163163_10066996 3300014325 Unclassified 3568
170 Ga0163163_10116644 3300014325 Bacteria 2701
171 Ga0163163_10273341 3300014325 Bacteria 1741
172 Ga0157380_10002400 3300014326 Bacteria 12600
173 Ga0157380_10470511 3300014326 Bacteria 1212
174 Ga0157377_10012235 3300014745 Bacteria 4310
175 Ga0157377_10023729 3300014745 Unclassified 3254
176 Ga0157377_10023828 3300014745 Unclassified 3248
177 Ga0157379_10308739 3300014968 Bacteria 1443
178 Ga0157376_10005742 3300014969 Bacteria 8692
179 Ga0157376_10049423 3300014969 Unclassified 3483
180 Ga0163161_10003712 3300017792 Bacteria 10697
181 Ga0163161_10052586 3300017792 Bacteria 2953
182 Ga0209436_100882 3300025208 Bacteria 11960
183 Ga0209130_1000871 3300025284 Bacteria 24706
184 Ga0207426_1000033 3300025302 Bacteria 455976
185 Ga0207697_10011277 3300025315 Unclassified 3785
186 Ga0207682_10009605 3300025893 Bacteria 3813
187 Ga0207680_10016527 3300025903 Bacteria 3876
188 Ga0207680_10173967 3300025903 Bacteria 1452
189 Ga0207647_10027426 3300025904 Bacteria 3712
190 Ga0207647_10140909 3300025904 Bacteria 1413
191 Ga0207645_10002627 3300025907 Bacteria 14014
192 Ga0207645_10025160 3300025907 Bacteria 3853
193 Ga0207643_10001490 3300025908 Bacteria 13411
194 Ga0207643_10008247 3300025908 Bacteria 5593
195 Ga0207643_10069407 3300025908 Unclassified 2026
196 Ga0207695_10000087 3300025913 Bacteria 276412
197 Ga0207695_10000299 3300025913 Bacteria 122118
198 Ga0207695_10000676 3300025913 Bacteria 67018
199 Ga0207695_10184131 3300025913 Bacteria 2009
200 Ga0207662_10064899 3300025918 Unclassified 2198
201 Ga0207649_10023822 3300025920 Bacteria 3550
202 Ga0207649_10049523 3300025920 Unclassified 2595
203 Ga0207681_10003119 3300025923 Bacteria 10425
204 Ga0207681_10014991 3300025923 Bacteria 4830
205 Ga0207681_10146067 3300025923 Unclassified 1767
206 Ga0207650_10291390 3300025925 Unclassified 1331
207 Ga0207659_10009731 3300025926 Bacteria 6012
208 Ga0207690_10086030 3300025932 Unclassified 2208
209 Ga0207706_10000763 3300025933 Bacteria 33452
210 Ga0207706_10013174 3300025933 Bacteria 7525
211 Ga0207706_10020335 3300025933 Bacteria 5967
212 Ga0207686_10001891 3300025934 Bacteria 11598
213 Ga0207686_10225581 3300025934 Bacteria 1355
214 Ga0207670_10006097 3300025936 Bacteria 6662
215 Ga0207670_10011005 3300025936 Bacteria 5231
216 Ga0207691_10049673 3300025940 Bacteria 3844
217 Ga0207691_10090318 3300025940 Bacteria 2746
218 Ga0207711_10432211 3300025941 Unclassified 1225
219 Ga0207689_10016454 3300025942 Bacteria 6260
220 Ga0207689_10031664 3300025942 Bacteria 4401
221 Ga0207689_10064459 3300025942 Bacteria 3015
222 Ga0207689_10102098 3300025942 Bacteria 2356
223 Ga0207689_10157170 3300025942 Unclassified 1874
224 Ga0207661_10012430 3300025944 Bacteria 6187
225 Ga0207679_10021430 3300025945 Unclassified 4381
226 Ga0207667_10000172 3300025949 Bacteria 95455
227 Ga0207651_10191148 3300025960 Unclassified 1633
228 Ga0207651_10235450 3300025960 Bacteria 1489
229 Ga0207712_10001267 3300025961 Bacteria 17398
230 Ga0207712_10010189 3300025961 Bacteria 5961
231 Ga0207712_10022789 3300025961 Bacteria 4127
232 Ga0207712_10043795 3300025961 Bacteria 3089
233 Ga0207712_10083880 3300025961 Unclassified 2327
234 Ga0207712_10105871 3300025961 Bacteria 2100
235 Ga0207668_10053404 3300025972 Unclassified 2800
236 Ga0207668_10263475 3300025972 Bacteria 1406
237 Ga0207640_10042737 3300025981 Bacteria 2892
238 Ga0207658_10068679 3300025986 Unclassified 2675
239 Ga0207658_10127661 3300025986 Bacteria 2038
240 Ga0207677_10001293 3300026023 Bacteria 13421
241 Ga0207677_10035171 3300026023 Bacteria 3250
242 Ga0207677_10315479 3300026023 Bacteria 1297
243 Ga0207703_10071185 3300026035 Unclassified 2872
244 Ga0207703_10163035 3300026035 Unclassified 1954
245 Ga0207639_10015240 3300026041 Bacteria 5418
246 Ga0207639_10021273 3300026041 Unclassified 4657
247 Ga0207639_10030877 3300026041 Bacteria 3933
248 Ga0207639_10112255 3300026041 Unclassified 2224
249 Ga0207678_10031768 3300026067 Bacteria 4603
250 Ga0207702_10022016 3300026078 Bacteria 5279
251 Ga0207641_10000088 3300026088 Bacteria 131959
252 Ga0207641_10010252 3300026088 Bacteria 7706
253 Ga0207641_10104446 3300026088 Unclassified 2501
254 Ga0207641_10117197 3300026088 Unclassified 2371
255 Ga0207641_10135800 3300026088 Bacteria 2214
256 Ga0207648_10006276 3300026089 Bacteria 11830
257 Ga0207648_10009884 3300026089 Bacteria 9094
258 Ga0207648_10066609 3300026089 Bacteria 3141
259 Ga0207648_10161635 3300026089 Bacteria 1978
260 Ga0207676_10033885 3300026095 Bacteria 3863
261 Ga0207676_10037432 3300026095 Unclassified 3697
262 Ga0207676_10348115 3300026095 Unclassified 1369
263 Ga0207674_10001740 3300026116 Bacteria 27826
264 Ga0207674_10033280 3300026116 Bacteria 5397
265 Ga0207674_10034254 3300026116 Bacteria 5312
266 Ga0207674_10035401 3300026116 Bacteria 5210
267 Ga0207674_10112289 3300026116 Bacteria 2699
268 Ga0207674_10223673 3300026116 Bacteria 1830
269 Ga0207675_100000332 3300026118 Bacteria 45114
270 Ga0207675_100002977 3300026118 Bacteria 16664
271 Ga0207675_100052797 3300026118 Bacteria 3792
272 Ga0207675_100454667 3300026118 Bacteria 1269
273 Ga0207683_10016150 3300026121 Bacteria 6354
274 Ga0207683_10251395 3300026121 Unclassified 1613
275 Ga0207698_10063178 3300026142 Bacteria 2896
276 Ga0207698_10066682 3300026142 Bacteria 2834
277 Ga0207698_10249860 3300026142 Bacteria 1622
278 Ga0207428_10119118 3300027907 Bacteria 2026
279 Ga0268266_10292299 3300028379 Bacteria 1518
280 Ga0268265_10006905 3300028380 Bacteria 7679
281 Ga0268265_10203894 3300028380 Bacteria 1718
282 Ga0268264_10010235 3300028381 Bacteria 7763
283 Ga0268264_10122176 3300028381 Bacteria 2296
284 Ga0265338_10095617 3300028800 Bacteria 2440
285 Ga0307406_10021405 3300031901 Bacteria 3824
286 Ga0373955_0045199 3300035172 Bacteria 2376
287 Ga0373935_0094665 3300035692 Unclassified 1961
288 Ga0439445_0043155 3300042004 Bacteria 1203
289 Ga0450923_006746 3300042125 Bacteria 1916
290 Ga0450898_002452 3300042134 Bacteria 2584
291 Ga0439434_0012964 3300042435 Bacteria 2471
292 Ga0466969_0021061 3300044656 Bacteria 3373
293 Ga0466961_0048369 3300044693 Bacteria 2718
294 Ga0466964_0008038 3300044706 Bacteria 3954
295 Ga0466971_0035320 3300044719 Bacteria 2240
296 Ga0466970_0079518 3300044765 Bacteria 1770
297 Ga0466959_0002115 3300045049 Bacteria 12564
298 Ga0466959_0008505 3300045049 Bacteria 7263
299 Ga0466959_0205507 3300045049 Bacteria 1370
300 Ga0466958_0095788 3300045836 Unclassified 1840
301 Ga0466967_0129334 3300045976 Bacteria 2343
302 Ga0495653_0066443 3300046463 Unclassified 2713
303 Ga0495650_0036861 3300046471 Bacteria 2135
304 Ga0495633_0029925 3300046558 Bacteria 2647
305 Ga0495667_0037524 3300046559 Unclassified 3229
306 Ga0495646_0092093 3300046680 Unclassified 1749
307 Ga0495674_0105473 3300047319 Bacteria 2395
308 Ga0495672_0026788 3300047320 Unclassified 3672
309 Ga0495686_0010160 3300047472 Bacteria 6715
310 Ga0496101_0159981 3300048904 Bacteria 1727
311 Ga0496110_0117212 3300048913 Unclassified 2398
312 Ga0496115_0090337 3300048918 Bacteria 2502
313 Ga0496124_0059093 3300048927 Bacteria 3222
314 Ga0501032_0065670 3300049569 Unclassified 2426
315 Ga0501034_0004888 3300049571 Bacteria 14781
316 Ga0501036_0000934 3300049572 Bacteria 21944
317 Ga0501037_0116648 3300049573 Bacteria 1921
318 Ga0501038_0007548 3300049574 Bacteria 10025
319 Ga0501039_0010296 3300049575 Bacteria 7133
320 Ga0501046_0005974 3300049580 Bacteria 10837
321 Ga0501047_0088735 3300049581 Bacteria 2969
322 Ga0501047_0172254 3300049581 Bacteria 2033
323 Ga0501048_0063639 3300049582 Bacteria 2608
324 Ga0501067_0087335 3300049583 Bacteria 1730
325 Ga0501068_0065989 3300049584 Bacteria 2204
326 Ga0501070_0003667 3300049586 Bacteria 13277
327 Ga0501072_0025187 3300049588 Bacteria 4633
328 Ga0501073_0012410 3300049589 Bacteria 6217
329 Ga0501080_0024066 3300049742 Bacteria 5644
330 Ga0501083_0000193 3300049744 Bacteria 39210
331 Ga0501035_0063734 3300049822 Unclassified 3277
332 Ga0501044_0005186 3300049823 Bacteria 14501
333 nmdc:mga0qj67_9535_c1 3300050509 Bacteria 7233
334 nmdc:mga08y16_18017_c1 3300050511 Bacteria 7439
335 Ga0500644_0011243 3300053088 Unclassified 2443
336 Ga0500616_0024453 3300053153 Unclassified 3356
337 Ga0500616_0025341 3300053153 Unclassified 3290
338 Ga0500611_000003 3300053727 Bacteria 333431
339 Ga0501084_0024958 3300054114 Bacteria 4988
340 Ga0466962_0024213 3300061719 Bacteria 2917

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10146119 Ga0111539_101461191 332
2 3300049569 Ga0501032_0065670 Ga0501032_0065670_1341_2366 341
3 3300005289 Ga0065704_10009511 Ga0065704_100095112 343
4 3300005471 Ga0070698_100011036 Ga0070698_1000110365 343
5 3300006844 Ga0075428_100235756 Ga0075428_1002357562 343
6 3300006846 Ga0075430_100036702 Ga0075430_1000367024 343
7 3300005290 Ga0065712_10014389 Ga0065712_100143893 344
8 3300005290 Ga0065712_10068536 Ga0065712_100685369 344
9 3300005331 Ga0070670_100165581 Ga0070670_1001655812 344
10 3300005334 Ga0068869_100065472 Ga0068869_1000654723 344
11 3300005340 Ga0070689_100069173 Ga0070689_1000691732 344
12 3300005340 Ga0070689_100087605 Ga0070689_1000876052 344
13 3300005354 Ga0070675_100049701 Ga0070675_1000497013 344
14 3300005365 Ga0070688_100054092 Ga0070688_1000540922 344
15 3300005365 Ga0070688_100069540 Ga0070688_1000695402 344
16 3300005466 Ga0070685_10008428 Ga0070685_100084283 344
17 3300005466 Ga0070685_10063248 Ga0070685_100632482 344
18 3300005518 Ga0070699_100089446 Ga0070699_1000894462 344
19 3300005539 Ga0068853_100275784 Ga0068853_1002757842 344
20 3300005617 Ga0068859_100210528 Ga0068859_1002105282 344
21 3300005719 Ga0068861_100001158 Ga0068861_1000011589 344
22 3300006931 Ga0097620_100210529 Ga0097620_1002105292 344
23 3300009094 Ga0111539_10571622 Ga0111539_105716222 344
24 3300009177 Ga0105248_10256479 Ga0105248_102564791 344
25 3300009553 Ga0105249_10002578 Ga0105249_1000257816 344
26 3300009553 Ga0105249_10074886 Ga0105249_100748862 344
27 3300009553 Ga0105249_10560330 Ga0105249_105603302 344
28 3300017792 Ga0163161_10052586 Ga0163161_100525862 344
29 3300025893 Ga0207682_10009605 Ga0207682_100096052 344
30 3300025908 Ga0207643_10001490 Ga0207643_1000149012 344
31 3300025923 Ga0207681_10146067 Ga0207681_101460671 344
32 3300025936 Ga0207670_10006097 Ga0207670_100060972 344
33 3300025940 Ga0207691_10049673 Ga0207691_100496732 344
34 3300025942 Ga0207689_10157170 Ga0207689_101571702 344
35 3300025960 Ga0207651_10191148 Ga0207651_101911482 344
36 3300025961 Ga0207712_10001267 Ga0207712_100012673 344
37 3300025961 Ga0207712_10010189 Ga0207712_100101892 344
38 3300026035 Ga0207703_10163035 Ga0207703_101630352 344
39 3300026088 Ga0207641_10104446 Ga0207641_101044462 344
40 3300026118 Ga0207675_100002977 Ga0207675_1000029779 344
41 3300026121 Ga0207683_10251395 Ga0207683_102513952 344
42 3300047320 Ga0495672_0026788 Ga0495672_0026788_2007_3098 344
43 3300005841 Ga0068863_100013208 Ga0068863_1000132084 345
44 3300009176 Ga0105242_10038132 Ga0105242_100381322 345
45 3300025923 Ga0207681_10014991 Ga0207681_100149913 345
46 3300025934 Ga0207686_10001891 Ga0207686_100018917 345
47 3300025986 Ga0207658_10068679 Ga0207658_100686792 345
48 3300026088 Ga0207641_10000088 Ga0207641_1000008817 345
49 3300026142 Ga0207698_10066682 Ga0207698_100666821 345
50 3300014969 Ga0157376_10049423 Ga0157376_100494233 348
51 3300003320 rootH2_10099066 rootH2_100990663 349
52 3300006237 Ga0097621_100228281 Ga0097621_1002282812 349
53 3300006358 Ga0068871_100004781 Ga0068871_10000478111 349
54 3300013306 Ga0163162_10007503 Ga0163162_100075032 349
55 3300025961 Ga0207712_10083880 Ga0207712_100838802 349
56 3300009147 Ga0114129_10084381 Ga0114129_100843812 352
57 3300005331 Ga0070670_100182522 Ga0070670_1001825221 353
58 3300005618 Ga0068864_100261496 Ga0068864_1002614961 353
59 3300010375 Ga0105239_10104797 Ga0105239_101047972 353
60 3300014968 Ga0157379_10308739 Ga0157379_103087392 353
61 3300025925 Ga0207650_10291390 Ga0207650_102913902 353
62 3300026095 Ga0207676_10033885 Ga0207676_100338853 353
63 3300005843 Ga0068860_100000829 Ga0068860_10000082918 354
64 3300006358 Ga0068871_100184498 Ga0068871_1001844982 354
65 3300013296 Ga0157374_10333218 Ga0157374_103332181 354
66 3300028381 Ga0268264_10010235 Ga0268264_100102354 354
67 iso_pu_bacteria 2902048731 2902049648 354
68 3300028800 Ga0265338_10095617 Ga0265338_100956172 357
69 3300005577 Ga0068857_100070576 Ga0068857_1000705763 361
70 3300005843 Ga0068860_100162432 Ga0068860_1001624321 361
71 3300005844 Ga0068862_100119220 Ga0068862_1001192202 361
72 3300009553 Ga0105249_10003219 Ga0105249_100032192 361
73 3300025961 Ga0207712_10105871 Ga0207712_101058712 361
74 3300026095 Ga0207676_10348115 Ga0207676_103481152 361
75 3300026116 Ga0207674_10034254 Ga0207674_100342545 361
76 3300028380 Ga0268265_10203894 Ga0268265_102038942 361
77 3300028381 Ga0268264_10122176 Ga0268264_101221762 361
78 iso_pu_bacteria 2818991460 2819676600 361
79 iso_pu_bacteria 2929177148 2929178022 361
80 iso_pu_bacteria 2945977869 2945980381 361
81 iso_pu_bacteria 2946013367 2946013755 361
82 3300005539 Ga0068853_100000773 Ga0068853_10000077319 362
83 3300005618 Ga0068864_100141269 Ga0068864_1001412693 362
84 3300009093 Ga0105240_10489904 Ga0105240_104899042 362
85 3300009551 Ga0105238_10479452 Ga0105238_104794521 362
86 3300025904 Ga0207647_10140909 Ga0207647_101409092 362
87 3300025913 Ga0207695_10184131 Ga0207695_101841312 362
88 3300026041 Ga0207639_10030877 Ga0207639_100308774 362
89 3300003322 rootL2_10016475 rootL2_100164752 363
90 3300005719 Ga0068861_100389682 Ga0068861_1003896821 363
91 3300005840 Ga0068870_10131340 Ga0068870_101313402 363
92 3300005841 Ga0068863_100033199 Ga0068863_1000331992 363
93 3300013306 Ga0163162_10258448 Ga0163162_102584481 363
94 3300026088 Ga0207641_10010252 Ga0207641_100102528 363
95 3300026118 Ga0207675_100454667 Ga0207675_1004546671 363
96 iso_pu_bacteria 2818991444 2819585898 363
97 3300005289 Ga0065704_10181694 Ga0065704_101816941 364
98 3300005328 Ga0070676_10155433 Ga0070676_101554332 364
99 3300005329 Ga0070683_100001974 Ga0070683_1000019746 364
100 3300005329 Ga0070683_100037362 Ga0070683_1000373622 364
101 3300005330 Ga0070690_100014672 Ga0070690_1000146722 364
102 3300005331 Ga0070670_100100486 Ga0070670_1001004862 364
103 3300005334 Ga0068869_100006296 Ga0068869_1000062962 364
104 3300005334 Ga0068869_100031729 Ga0068869_1000317293 364
105 3300005334 Ga0068869_100073798 Ga0068869_1000737983 364
106 3300005334 Ga0068869_100082307 Ga0068869_1000823072 364
107 3300005335 Ga0070666_10002266 Ga0070666_100022667 364
108 3300005335 Ga0070666_10022858 Ga0070666_100228581 364
109 3300005337 Ga0070682_100017499 Ga0070682_1000174992 364
110 3300005338 Ga0068868_100048054 Ga0068868_1000480543 364
111 3300005340 Ga0070689_100007383 Ga0070689_1000073833 364
112 3300005340 Ga0070689_100052469 Ga0070689_1000524693 364
113 3300005344 Ga0070661_100001789 Ga0070661_1000017899 364
114 3300005344 Ga0070661_100122809 Ga0070661_1001228092 364
115 3300005354 Ga0070675_100022794 Ga0070675_1000227943 364
116 3300005354 Ga0070675_100326660 Ga0070675_1003266601 364
117 3300005364 Ga0070673_100149026 Ga0070673_1001490262 364
118 3300005365 Ga0070688_100047310 Ga0070688_1000473102 364
119 3300005366 Ga0070659_100011103 Ga0070659_1000111035 364
120 3300005366 Ga0070659_100028829 Ga0070659_1000288292 364
121 3300005455 Ga0070663_100117146 Ga0070663_1001171462 364
122 3300005456 Ga0070678_100014132 Ga0070678_1000141325 364
123 3300005457 Ga0070662_100002099 Ga0070662_1000020993 364
124 3300005457 Ga0070662_100010756 Ga0070662_1000107564 364
125 3300005459 Ga0068867_100004729 Ga0068867_1000047295 364
126 3300005459 Ga0068867_100042895 Ga0068867_1000428953 364
127 3300005466 Ga0070685_10012326 Ga0070685_100123263 364
128 3300005466 Ga0070685_10062308 Ga0070685_100623083 364
129 3300005471 Ga0070698_100001934 Ga0070698_1000019345 364
130 3300005471 Ga0070698_100003667 Ga0070698_1000036675 364
131 3300005535 Ga0070684_100002013 Ga0070684_1000020139 364
132 3300005535 Ga0070684_100006052 Ga0070684_1000060525 364
133 3300005539 Ga0068853_100004150 Ga0068853_1000041504 364
134 3300005544 Ga0070686_100081836 Ga0070686_1000818361 364
135 3300005548 Ga0070665_100189474 Ga0070665_1001894742 364
136 3300005564 Ga0070664_100001372 Ga0070664_1000013729 364
137 3300005577 Ga0068857_100005666 Ga0068857_1000056666 364
138 3300005577 Ga0068857_100052936 Ga0068857_1000529362 364
139 3300005578 Ga0068854_100051724 Ga0068854_1000517243 364
140 3300005616 Ga0068852_100102802 Ga0068852_1001028023 364
141 3300005617 Ga0068859_100023011 Ga0068859_1000230116 364
142 3300005618 Ga0068864_100001903 Ga0068864_1000019034 364
143 3300005718 Ga0068866_10013289 Ga0068866_100132893 364
144 3300005718 Ga0068866_10131467 Ga0068866_101314671 364
145 3300005841 Ga0068863_100071027 Ga0068863_1000710273 364
146 3300005841 Ga0068863_100207588 Ga0068863_1002075881 364
147 3300005842 Ga0068858_100103349 Ga0068858_1001033493 364
148 3300006358 Ga0068871_100027409 Ga0068871_1000274092 364
149 3300006931 Ga0097620_100023011 Ga0097620_1000230116 364
150 3300009093 Ga0105240_10373856 Ga0105240_103738561 364
151 3300009174 Ga0105241_10087288 Ga0105241_100872882 364
152 3300009176 Ga0105242_10259335 Ga0105242_102593352 364
153 3300009553 Ga0105249_10077490 Ga0105249_100774902 364
154 3300009553 Ga0105249_10173585 Ga0105249_101735852 364
155 3300009553 Ga0105249_10195059 Ga0105249_101950592 364
156 3300013102 Ga0157371_10058474 Ga0157371_100584743 364
157 3300013296 Ga0157374_10002019 Ga0157374_100020192 364
158 3300013296 Ga0157374_10007296 Ga0157374_100072963 364
159 3300013297 Ga0157378_10331621 Ga0157378_103316212 364
160 3300013306 Ga0163162_10010897 Ga0163162_100108972 364
161 3300013306 Ga0163162_10085955 Ga0163162_100859552 364
162 3300013306 Ga0163162_10140397 Ga0163162_101403972 364
163 3300013308 Ga0157375_10005759 Ga0157375_100057593 364
164 3300013308 Ga0157375_10013374 Ga0157375_100133742 364
165 3300014325 Ga0163163_10000899 Ga0163163_100008993 364
166 3300014325 Ga0163163_10066996 Ga0163163_100669962 364
167 3300014325 Ga0163163_10116644 Ga0163163_101166442 364
168 3300014325 Ga0163163_10273341 Ga0163163_102733412 364
169 3300014326 Ga0157380_10470511 Ga0157380_104705112 364
170 3300014745 Ga0157377_10012235 Ga0157377_100122352 364
171 3300014745 Ga0157377_10023828 Ga0157377_100238281 364
172 3300017792 Ga0163161_10003712 Ga0163161_100037122 364
173 3300025903 Ga0207680_10016527 Ga0207680_100165273 364
174 3300025903 Ga0207680_10173967 Ga0207680_101739672 364
175 3300025904 Ga0207647_10027426 Ga0207647_100274262 364
176 3300025907 Ga0207645_10002627 Ga0207645_100026275 364
177 3300025908 Ga0207643_10069407 Ga0207643_100694072 364
178 3300025920 Ga0207649_10023822 Ga0207649_100238222 364
179 3300025920 Ga0207649_10049523 Ga0207649_100495232 364
180 3300025932 Ga0207690_10086030 Ga0207690_100860302 364
181 3300025933 Ga0207706_10000763 Ga0207706_1000076324 364
182 3300025933 Ga0207706_10013174 Ga0207706_100131743 364
183 3300025934 Ga0207686_10225581 Ga0207686_102255812 364
184 3300025936 Ga0207670_10011005 Ga0207670_100110053 364
185 3300025940 Ga0207691_10090318 Ga0207691_100903182 364
186 3300025941 Ga0207711_10432211 Ga0207711_104322111 364
187 3300025942 Ga0207689_10016454 Ga0207689_100164544 364
188 3300025942 Ga0207689_10031664 Ga0207689_100316643 364
189 3300025942 Ga0207689_10064459 Ga0207689_100644592 364
190 3300025942 Ga0207689_10102098 Ga0207689_101020981 364
191 3300025944 Ga0207661_10012430 Ga0207661_100124303 364
192 3300025945 Ga0207679_10021430 Ga0207679_100214302 364
193 3300025960 Ga0207651_10235450 Ga0207651_102354502 364
194 3300025961 Ga0207712_10043795 Ga0207712_100437953 364
195 3300025972 Ga0207668_10263475 Ga0207668_102634751 364
196 3300025981 Ga0207640_10042737 Ga0207640_100427373 364
197 3300025986 Ga0207658_10127661 Ga0207658_101276613 364
198 3300026023 Ga0207677_10001293 Ga0207677_100012934 364
199 3300026023 Ga0207677_10035171 Ga0207677_100351712 364
200 3300026023 Ga0207677_10315479 Ga0207677_103154791 364
201 3300026035 Ga0207703_10071185 Ga0207703_100711852 364
202 3300026041 Ga0207639_10021273 Ga0207639_100212731 364
203 3300026067 Ga0207678_10031768 Ga0207678_100317684 364
204 3300026088 Ga0207641_10117197 Ga0207641_101171972 364
205 3300026088 Ga0207641_10135800 Ga0207641_101358002 364
206 3300026089 Ga0207648_10006276 Ga0207648_100062766 364
207 3300026089 Ga0207648_10009884 Ga0207648_100098845 364
208 3300026089 Ga0207648_10066609 Ga0207648_100666091 364
209 3300026089 Ga0207648_10161635 Ga0207648_101616352 364
210 3300026095 Ga0207676_10037432 Ga0207676_100374322 364
211 3300026116 Ga0207674_10001740 Ga0207674_1000174011 364
212 3300026116 Ga0207674_10033280 Ga0207674_100332803 364
213 3300026116 Ga0207674_10035401 Ga0207674_100354013 364
214 3300026118 Ga0207675_100052797 Ga0207675_1000527973 364
215 3300026121 Ga0207683_10016150 Ga0207683_100161503 364
216 3300026142 Ga0207698_10249860 Ga0207698_102498602 364
217 3300028379 Ga0268266_10292299 Ga0268266_102922992 364
218 3300035172 Ga0373955_0045199 Ga0373955_0045199_405_1505 364
219 3300035692 Ga0373935_0094665 Ga0373935_0094665_210_1310 364
220 3300042125 Ga0450923_006746 Ga0450923_006746_549_1643 364
221 3300046463 Ga0495653_0066443 Ga0495653_0066443_154_1254 364
222 3300046471 Ga0495650_0036861 Ga0495650_0036861_980_2080 364
223 3300046559 Ga0495667_0037524 Ga0495667_0037524_1523_2623 364
224 3300046680 Ga0495646_0092093 Ga0495646_0092093_465_1565 364
225 3300047319 Ga0495674_0105473 Ga0495674_0105473_993_2093 364
226 3300048904 Ga0496101_0159981 Ga0496101_0159981_318_1418 364
227 3300048913 Ga0496110_0117212 Ga0496110_0117212_487_1587 364
228 3300049571 Ga0501034_0004888 Ga0501034_0004888_5270_6370 364
229 3300049572 Ga0501036_0000934 Ga0501036_0000934_19541_20641 364
230 3300049573 Ga0501037_0116648 Ga0501037_0116648_782_1882 364
231 3300049574 Ga0501038_0007548 Ga0501038_0007548_3911_5011 364
232 3300049575 Ga0501039_0010296 Ga0501039_0010296_382_1482 364
233 3300049580 Ga0501046_0005974 Ga0501046_0005974_2869_3969 364
234 3300049582 Ga0501048_0063639 Ga0501048_0063639_1344_2444 364
235 3300049583 Ga0501067_0087335 Ga0501067_0087335_442_1542 364
236 3300049584 Ga0501068_0065989 Ga0501068_0065989_56_1156 364
237 3300049586 Ga0501070_0003667 Ga0501070_0003667_8441_9541 364
238 3300049588 Ga0501072_0025187 Ga0501072_0025187_2037_3131 364
239 3300049589 Ga0501073_0012410 Ga0501073_0012410_2997_4097 364
240 3300049742 Ga0501080_0024066 Ga0501080_0024066_3966_5066 364
241 3300049744 Ga0501083_0000193 Ga0501083_0000193_28676_29776 364
242 3300049822 Ga0501035_0063734 Ga0501035_0063734_1453_2553 364
243 3300049823 Ga0501044_0005186 Ga0501044_0005186_5116_6216 364
244 3300054114 Ga0501084_0024958 Ga0501084_0024958_1237_2337 364
245 3300003320 rootH2_10004327 rootH2_100043277 365
246 3300003320 rootH2_10011035 rootH2_1001103517 365
247 3300003323 rootH1_10040303 rootH1_100403033 365
248 3300005293 Ga0065715_10013863 Ga0065715_100138632 365
249 3300005295 Ga0065707_10176142 Ga0065707_101761422 365
250 3300005328 Ga0070676_10014348 Ga0070676_100143482 365
251 3300005331 Ga0070670_100028700 Ga0070670_1000287003 365
252 3300005347 Ga0070668_100070052 Ga0070668_1000700522 365
253 3300005353 Ga0070669_100007886 Ga0070669_1000078866 365
254 3300005354 Ga0070675_100020154 Ga0070675_1000201543 365
255 3300005364 Ga0070673_100020795 Ga0070673_1000207954 365
256 3300005365 Ga0070688_100006727 Ga0070688_1000067274 365
257 3300005438 Ga0070701_10015464 Ga0070701_100154643 365
258 3300005457 Ga0070662_100041794 Ga0070662_1000417944 365
259 3300005466 Ga0070685_10052076 Ga0070685_100520763 365
260 3300005564 Ga0070664_100171447 Ga0070664_1001714472 365
261 3300005577 Ga0068857_100004492 Ga0068857_10000449211 365
262 3300005577 Ga0068857_100056799 Ga0068857_1000567993 365
263 3300005617 Ga0068859_100125878 Ga0068859_1001258784 365
264 3300005719 Ga0068861_100010534 Ga0068861_1000105344 365
265 3300005840 Ga0068870_10036006 Ga0068870_100360064 365
266 3300005844 Ga0068862_100032280 Ga0068862_1000322804 365
267 3300006931 Ga0097620_100125875 Ga0097620_1001258754 365
268 3300009094 Ga0111539_10000458 Ga0111539_1000045838 365
269 3300009147 Ga0114129_10127574 Ga0114129_101275743 365
270 3300009553 Ga0105249_10003210 Ga0105249_100032104 365
271 3300013308 Ga0157375_10032496 Ga0157375_100324964 365
272 3300014326 Ga0157380_10002400 Ga0157380_100024004 365
273 3300014745 Ga0157377_10023729 Ga0157377_100237294 365
274 3300014969 Ga0157376_10005742 Ga0157376_100057427 365
275 3300025208 Ga0209436_100882 Ga0209436_1008822 365
276 3300025284 Ga0209130_1000871 Ga0209130_10008715 365
277 3300025302 Ga0207426_1000033 Ga0207426_1000033263 365
278 3300025315 Ga0207697_10011277 Ga0207697_100112774 365
279 3300025907 Ga0207645_10025160 Ga0207645_100251604 365
280 3300025908 Ga0207643_10008247 Ga0207643_100082474 365
281 3300025918 Ga0207662_10064899 Ga0207662_100648992 365
282 3300025923 Ga0207681_10003119 Ga0207681_100031192 365
283 3300025926 Ga0207659_10009731 Ga0207659_100097316 365
284 3300025933 Ga0207706_10020335 Ga0207706_100203354 365
285 3300025972 Ga0207668_10053404 Ga0207668_100534043 365
286 3300026116 Ga0207674_10112289 Ga0207674_101122892 365
287 3300026116 Ga0207674_10223673 Ga0207674_102236732 365
288 3300026118 Ga0207675_100000332 Ga0207675_10000033234 365
289 3300027907 Ga0207428_10119118 Ga0207428_101191183 365
290 3300028380 Ga0268265_10006905 Ga0268265_100069056 365
291 3300031901 Ga0307406_10021405 Ga0307406_100214054 365
292 3300042004 Ga0439445_0043155 Ga0439445_0043155_55_1164 365
293 3300042134 Ga0450898_002452 Ga0450898_002452_57_1166 365
294 3300042435 Ga0439434_0012964 Ga0439434_0012964_1124_2233 365
295 3300045049 Ga0466959_0002115 Ga0466959_0002115_8634_9731 365
296 3300048918 Ga0496115_0090337 Ga0496115_0090337_1294_2421 365
297 3300048927 Ga0496124_0059093 Ga0496124_0059093_1777_2880 365
298 3300049581 Ga0501047_0088735 Ga0501047_0088735_1009_2106 365
299 3300049581 Ga0501047_0172254 Ga0501047_0172254_675_1772 365
300 3300050509 nmdc:mga0qj67_9535_c1 nmdc:mga0qj67_9535_c1_2173_3270 365
301 3300050511 nmdc:mga08y16_18017_c1 nmdc:mga08y16_18017_c1_3711_4814 365
302 3300053727 Ga0500611_000003 Ga0500611_000003_185730_186827 365
303 3300005539 Ga0068853_100021303 Ga0068853_1000213033 366
304 3300005547 Ga0070693_100150590 Ga0070693_1001505902 366
305 3300013307 Ga0157372_10333623 Ga0157372_103336231 366
306 3300025961 Ga0207712_10022789 Ga0207712_100227893 366
307 3300026041 Ga0207639_10015240 Ga0207639_100152403 366
308 3300045976 Ga0466967_0129334 Ga0466967_0129334_324_1430 366
309 3300046558 Ga0495633_0029925 Ga0495633_0029925_686_1789 366
310 3300047472 Ga0495686_0010160 Ga0495686_0010160_2325_3431 366
311 3300053153 Ga0500616_0025341 Ga0500616_0025341_1439_2539 366
312 3300005539 Ga0068853_100007393 Ga0068853_1000073933 367
313 3300026041 Ga0207639_10112255 Ga0207639_101122553 367
314 iso_pu_bacteria 2929154850 2929159343 368
315 3300009093 Ga0105240_10000597 Ga0105240_1000059735 369
316 3300009093 Ga0105240_10001169 Ga0105240_1000116937 369
317 3300010375 Ga0105239_10001099 Ga0105239_1000109931 369
318 3300025913 Ga0207695_10000299 Ga0207695_1000029967 369
319 3300025913 Ga0207695_10000676 Ga0207695_1000067625 369
320 3300044706 Ga0466964_0008038 Ga0466964_0008038_1994_3148 369
321 3300053088 Ga0500644_0011243 Ga0500644_0011243_906_2039 369
322 3300053153 Ga0500616_0024453 Ga0500616_0024453_534_1691 369
323 3300003215 JGI25153J46596_10037263 JGI25153J46596_100372631 370
324 3300003320 rootH2_10127001 rootH2_101270014 370
325 3300005329 Ga0070683_100013925 Ga0070683_1000139256 370
326 3300005341 Ga0070691_10012007 Ga0070691_100120073 370
327 3300005563 Ga0068855_100000081 Ga0068855_10000008115 370
328 3300005578 Ga0068854_100130022 Ga0068854_1001300222 370
329 3300005614 Ga0068856_100030651 Ga0068856_1000306513 370
330 3300005616 Ga0068852_100109847 Ga0068852_1001098472 370
331 3300009093 Ga0105240_10003084 Ga0105240_1000308411 370
332 3300013104 Ga0157370_10019993 Ga0157370_100199932 370
333 3300013105 Ga0157369_10072687 Ga0157369_100726872 370
334 3300013307 Ga0157372_10317634 Ga0157372_103176342 370
335 3300025913 Ga0207695_10000087 Ga0207695_10000087237 370
336 3300025949 Ga0207667_10000172 Ga0207667_1000017265 370
337 3300026078 Ga0207702_10022016 Ga0207702_100220163 370
338 3300026142 Ga0207698_10063178 Ga0207698_100631783 370
339 3300044656 Ga0466969_0021061 Ga0466969_0021061_135_1250 370
340 3300044693 Ga0466961_0048369 Ga0466961_0048369_531_1646 370
341 3300044719 Ga0466971_0035320 Ga0466971_0035320_451_1566 370
342 3300044765 Ga0466970_0079518 Ga0466970_0079518_176_1291 370
343 3300045049 Ga0466959_0008505 Ga0466959_0008505_5293_6408 370
344 3300045049 Ga0466959_0205507 Ga0466959_0205507_192_1307 370
345 3300045836 Ga0466958_0095788 Ga0466958_0095788_168_1283 370
346 3300061719 Ga0466962_0024213 Ga0466962_0024213_490_1605 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

83

394

0.93

PF22643

NagA_N

NagA composite domain

36

80

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p53-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate 0.9707 3 368
6jku-assembly1.cif.gz_C crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida 0.9665 2 369
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.9638 3 368
2p50-assembly2.cif.gz_D crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9619 3 368
3iv8-assembly2.cif.gz_D n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate 0.9614 1 369
ID Description Score Start End Superfamily
3iv8D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9516 1 54 2.30.40.10
1yrrB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9494 4 54 2.30.40.10
2vhlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9442 56 342 3.20.20.140
af_P42906_1_128_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9415 215 333 3.20.20.140
af_O53382_52_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9408 56 336 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1I5CSS3-F1-model_v4 N-acetylglucosamine 6-phosphate deacetylase 0.996 1 366 GO:0006046
GO:0008448
GO:0046872
AF-A0A2S5A4R6-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9919 3 369 GO:0006046
GO:0008448
GO:0046872
AF-A0A7G6YIM0-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) 0.9891 1 369 GO:0006046
GO:0008448
GO:0046872
AF-A0A1I5CSS3-F1-model_v4 N-acetylglucosamine 6-phosphate deacetylase 0.9879 1 366 GO:0006046
GO:0008448
GO:0046872
AF-A0A5B7ZZW1-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) 0.9876 1 366 GO:0006046
GO:0008448
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.52 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map