F416696

General Info

Members Datasets Scaffolds Average Seq Length
346 150 346 332

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100043832|Ga0068854_1000438323
Length 371
Sequence MAALATVFRVASLYIPTPMDMISGWGGRFRGLFTDTKGPWGHGSDDGGEAPPDDGAGNRRGRRSGIGGANVSALDELLRRSRARFGGGGGLPGRPDGSLILWGLAGLVVLWLIFTSFHSIAPGQRGVVTRFGRYSSTLGPGVSMTLPAPIDRVKKLDVEAIRTVDLGSSSSDDLMLTGDQNLIDLAYNVRWNIRTPELYLFQLAQPDETIQEVAESAMRAVISQVTLNDAMGDRRAEIEQQVAQNMQRILDAYRSGIQVQGIAIKQADPPSQVNDAFKEVTAAQQDAQTSINNANAYALQLRQKAQGEATAFDKVYAQYKLAPEVTRRRMYYETMEDVLSKIDKTVVEVPGVTPYLPLPEVKKKQPQGAPQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
123 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 3.76
Rhizosphere 92.77
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001017 3300001979 Bacteria 12544
2 JGI24740J21852_10001233 3300001979 Bacteria 11575
3 JGI24740J21852_10026241 3300001979 Bacteria 1954
4 JGI24737J22298_10011655 3300001990 Bacteria 2877
5 JGI24735J21928_10007606 3300002067 Bacteria 3530
6 JGI24744J21845_10000080 3300002077 Bacteria 12237
7 JGI25165J46597_1000127 3300003214 Bacteria 130786
8 Ga0055542_1002573 3300003762 Bacteria 5774
9 Ga0070658_10000405 3300005327 Bacteria 37355
10 Ga0070658_10002097 3300005327 Bacteria 16720
11 Ga0070658_10033134 3300005327 Bacteria 4155
12 Ga0070658_10103225 3300005327 Bacteria 2358
13 Ga0070676_10016633 3300005328 Bacteria 4067
14 Ga0070683_100002474 3300005329 Bacteria 14703
15 Ga0070683_100172093 3300005329 Bacteria 2056
16 Ga0070670_100003009 3300005331 Bacteria 13952
17 Ga0070670_100026687 3300005331 Bacteria 4969
18 Ga0070670_100333785 3300005331 Bacteria 1330
19 Ga0070666_10234848 3300005335 Bacteria 1295
20 Ga0070680_100001983 3300005336 Bacteria 15063
21 Ga0070680_100003473 3300005336 Bacteria 11764
22 Ga0070680_100117621 3300005336 Bacteria 2216
23 Ga0070680_100124980 3300005336 Bacteria 2149
24 Ga0070682_100015332 3300005337 Bacteria 4439
25 Ga0070660_100000194 3300005339 Bacteria 40512
26 Ga0070660_100000667 3300005339 Bacteria 22709
27 Ga0070660_100000972 3300005339 Bacteria 19155
28 Ga0070660_100073001 3300005339 Bacteria 2682
29 Ga0070660_100112430 3300005339 Bacteria 2168
30 Ga0070660_100136021 3300005339 Bacteria 1969
31 Ga0070660_100215180 3300005339 Bacteria 1561
32 Ga0070660_100346196 3300005339 Bacteria 1223
33 Ga0070691_10003475 3300005341 Bacteria 7092
34 Ga0070661_100010542 3300005344 Bacteria 6426
35 Ga0070661_100031145 3300005344 Bacteria 3856
36 Ga0070661_100034536 3300005344 Bacteria 3667
37 Ga0070661_100035957 3300005344 Bacteria 3600
38 Ga0070668_100106501 3300005347 Bacteria 2228
39 Ga0070675_100004619 3300005354 Bacteria 10516
40 Ga0070675_100044077 3300005354 Bacteria 3648
41 Ga0070671_100002763 3300005355 Bacteria 13629
42 Ga0070671_100009099 3300005355 Bacteria 7973
43 Ga0070671_100027641 3300005355 Bacteria 4671
44 Ga0070674_100030541 3300005356 Bacteria 3562
45 Ga0070674_100041991 3300005356 Bacteria 3104
46 Ga0070674_100174149 3300005356 Bacteria 1643
47 Ga0070673_100381447 3300005364 Bacteria 1257
48 Ga0070659_100002896 3300005366 Bacteria 12219
49 Ga0070659_100012707 3300005366 Bacteria 6247
50 Ga0070659_100019051 3300005366 Bacteria 5189
51 Ga0070659_100032506 3300005366 Bacteria 4047
52 Ga0070659_100043116 3300005366 Bacteria 3528
53 Ga0070659_100054232 3300005366 Bacteria 3157
54 Ga0070659_100056080 3300005366 Bacteria 3106
55 Ga0070659_100060520 3300005366 Bacteria 2991
56 Ga0070659_100091284 3300005366 Bacteria 2441
57 Ga0070659_100148757 3300005366 Bacteria 1909
58 Ga0070714_100107075 3300005435 Bacteria 2470
59 Ga0070713_100229967 3300005436 Unclassified 1685
60 Ga0070694_100070959 3300005444 Bacteria 2400
61 Ga0070663_100001332 3300005455 Bacteria 13499
62 Ga0070663_100004950 3300005455 Bacteria 7866
63 Ga0070663_100017027 3300005455 Bacteria 4733
64 Ga0070678_100009430 3300005456 Bacteria 5915
65 Ga0070681_10002999 3300005458 Bacteria 15667
66 Ga0070681_10068138 3300005458 Bacteria 3526
67 Ga0070681_10134063 3300005458 Bacteria 2407
68 Ga0070681_10147940 3300005458 Bacteria 2277
69 Ga0070681_10190264 3300005458 Bacteria 1972
70 Ga0070679_100001108 3300005530 Bacteria 23557
71 Ga0070684_100002773 3300005535 Bacteria 12975
72 Ga0070684_100063059 3300005535 Bacteria 3248
73 Ga0068853_100025957 3300005539 Bacteria 4917
74 Ga0068853_100029912 3300005539 Bacteria 4595
75 Ga0068853_100222111 3300005539 Bacteria 1726
76 Ga0068853_100251454 3300005539 Bacteria 1622
77 Ga0070672_100008130 3300005543 Bacteria 7171
78 Ga0070672_100054255 3300005543 Bacteria 3137
79 Ga0070695_100024406 3300005545 Bacteria 3723
80 Ga0070696_100001223 3300005546 Bacteria 16677
81 Ga0070665_100021092 3300005548 Bacteria 6549
82 Ga0070665_100055502 3300005548 Bacteria 3973
83 Ga0070704_100137398 3300005549 Bacteria 1903
84 Ga0068855_100000123 3300005563 Bacteria 97174
85 Ga0068855_100001534 3300005563 Bacteria 29001
86 Ga0068855_100009355 3300005563 Bacteria 11831
87 Ga0068855_100100929 3300005563 Bacteria 3322
88 Ga0068855_100114506 3300005563 Bacteria 3092
89 Ga0068855_100177480 3300005563 Bacteria 2409
90 Ga0070664_100004931 3300005564 Bacteria 10689
91 Ga0070664_100028495 3300005564 Bacteria 4646
92 Ga0070664_100089997 3300005564 Bacteria 2655
93 Ga0070664_100096670 3300005564 Bacteria 2563
94 Ga0070664_100184371 3300005564 Bacteria 1857
95 Ga0068857_100005015 3300005577 Bacteria 11256
96 Ga0068854_100002108 3300005578 Bacteria 12190
97 Ga0068854_100006275 3300005578 Bacteria 7556
98 Ga0068854_100007615 3300005578 Bacteria 6925
99 Ga0068854_100043832 3300005578 Bacteria 3173
100 Ga0068854_100060243 3300005578 Bacteria 2745
101 Ga0068854_100071991 3300005578 Bacteria 2530
102 Ga0068854_100085692 3300005578 Bacteria 2334
103 Ga0068854_100132361 3300005578 Bacteria 1905
104 Ga0068856_100059289 3300005614 Bacteria 3781
105 Ga0068856_100065439 3300005614 Bacteria 3593
106 Ga0068856_100184680 3300005614 Bacteria 2099
107 Ga0068852_100040707 3300005616 Bacteria 3922
108 Ga0068852_100068555 3300005616 Bacteria 3105
109 Ga0068859_100330443 3300005617 Bacteria 1618
110 Ga0068859_100452611 3300005617 Bacteria 1380
111 Ga0068864_100029100 3300005618 Bacteria 4674
112 Ga0068864_100038352 3300005618 Bacteria 4092
113 Ga0068851_10017213 3300005834 Bacteria 3468
114 Ga0068851_10021214 3300005834 Bacteria 3154
115 Ga0068863_100012738 3300005841 Bacteria 8109
116 Ga0068860_100023527 3300005843 Bacteria 5954
117 Ga0068862_100008153 3300005844 Bacteria 8660
118 Ga0068862_100187503 3300005844 Bacteria 1859
119 Ga0081539_10012933 3300005985 Bacteria 6349
120 Ga0081539_10016021 3300005985 Bacteria 5393
121 Ga0068871_100141889 3300006358 Bacteria 2043
122 Ga0097620_100330429 3300006931 Bacteria 1618
123 Ga0097620_100452645 3300006931 Bacteria 1380
124 Ga0105240_10041442 3300009093 Bacteria 5877
125 Ga0105240_10087202 3300009093 Bacteria 3822
126 Ga0111539_10023710 3300009094 Bacteria 7539
127 Ga0105241_10056329 3300009174 Bacteria 3014
128 Ga0105241_10076090 3300009174 Bacteria 2617
129 Ga0105241_10259003 3300009174 Bacteria 1478
130 Ga0105248_10003106 3300009177 Bacteria 18389
131 Ga0105248_10093111 3300009177 Bacteria 3393
132 Ga0105237_10027881 3300009545 Bacteria 5755
133 Ga0105238_10003788 3300009551 Bacteria 15030
134 Ga0105238_10197373 3300009551 Bacteria 1988
135 Ga0157373_10027432 3300013100 Bacteria 4108
136 Ga0157373_10061757 3300013100 Bacteria 2654
137 Ga0157373_10237810 3300013100 Bacteria 1287
138 Ga0157371_10000915 3300013102 Bacteria 33246
139 Ga0157371_10089143 3300013102 Bacteria 2184
140 Ga0157370_10000176 3300013104 Bacteria 79656
141 Ga0157370_10003914 3300013104 Bacteria 17343
142 Ga0157370_10005659 3300013104 Bacteria 13970
143 Ga0157370_10039439 3300013104 Bacteria 4564
144 Ga0157370_10105035 3300013104 Bacteria 2644
145 Ga0157370_10137829 3300013104 Bacteria 2274
146 Ga0157369_10005408 3300013105 Bacteria 14865
147 Ga0157374_10010960 3300013296 Bacteria 7828
148 Ga0163162_10081079 3300013306 Bacteria 3315
149 Ga0157372_10012937 3300013307 Bacteria 8897
150 Ga0157372_10100529 3300013307 Bacteria 3300
151 Ga0157372_10156506 3300013307 Bacteria 2632
152 Ga0157372_10198275 3300013307 Bacteria 2325
153 Ga0157372_10582142 3300013307 Bacteria 1305
154 Ga0157375_10063401 3300013308 Bacteria 3677
155 Ga0157379_10040676 3300014968 Bacteria 4150
156 Ga0207427_101817 3300025231 Bacteria 6826
157 Ga0209026_1001387 3300025250 Bacteria 10790
158 Ga0209148_1000114 3300025254 Bacteria 192073
159 Ga0209233_1000120 3300025261 Bacteria 233311
160 Ga0209455_1017265 3300025272 Bacteria 1521
161 Ga0207697_10008190 3300025315 Bacteria 4598
162 Ga0207647_10002240 3300025904 Bacteria 14734
163 Ga0207647_10002659 3300025904 Bacteria 13489
164 Ga0207645_10006658 3300025907 Bacteria 8251
165 Ga0207705_10000066 3300025909 Bacteria 136520
166 Ga0207705_10000276 3300025909 Bacteria 49160
167 Ga0207705_10000333 3300025909 Bacteria 42908
168 Ga0207705_10013569 3300025909 Bacteria 5882
169 Ga0207705_10018723 3300025909 Bacteria 4954
170 Ga0207705_10118649 3300025909 Bacteria 1961
171 Ga0207654_10136092 3300025911 Bacteria 1561
172 Ga0207707_10008798 3300025912 Bacteria 8761
173 Ga0207695_10018238 3300025913 Bacteria 8122
174 Ga0207695_10066590 3300025913 Bacteria 3699
175 Ga0207660_10001841 3300025917 Bacteria 14140
176 Ga0207660_10023203 3300025917 Bacteria 4189
177 Ga0207660_10076832 3300025917 Bacteria 2442
178 Ga0207657_10000218 3300025919 Bacteria 59661
179 Ga0207657_10001002 3300025919 Bacteria 30045
180 Ga0207657_10002257 3300025919 Bacteria 20882
181 Ga0207657_10005932 3300025919 Bacteria 12715
182 Ga0207657_10010268 3300025919 Bacteria 9347
183 Ga0207657_10010519 3300025919 Bacteria 9227
184 Ga0207657_10012476 3300025919 Bacteria 8388
185 Ga0207657_10014023 3300025919 Bacteria 7841
186 Ga0207657_10014724 3300025919 Bacteria 7616
187 Ga0207657_10022785 3300025919 Bacteria 5849
188 Ga0207657_10023620 3300025919 Bacteria 5720
189 Ga0207657_10156421 3300025919 Bacteria 1854
190 Ga0207649_10003573 3300025920 Bacteria 8496
191 Ga0207649_10044821 3300025920 Bacteria 2709
192 Ga0207649_10086592 3300025920 Bacteria 2042
193 Ga0207649_10116203 3300025920 Bacteria 1796
194 Ga0207652_10000597 3300025921 Bacteria 36153
195 Ga0207652_10024070 3300025921 Bacteria 5050
196 Ga0207652_10128218 3300025921 Bacteria 2261
197 Ga0207652_10240690 3300025921 Bacteria 1631
198 Ga0207652_10411146 3300025921 Bacteria 1220
199 Ga0207681_10277048 3300025923 Bacteria 1319
200 Ga0207694_10010800 3300025924 Bacteria 6896
201 Ga0207650_10004781 3300025925 Bacteria 9254
202 Ga0207650_10016054 3300025925 Bacteria 5226
203 Ga0207700_10177804 3300025928 Bacteria 1780
204 Ga0207664_10022937 3300025929 Bacteria 4669
205 Ga0207644_10000227 3300025931 Bacteria 38835
206 Ga0207644_10095980 3300025931 Bacteria 2218
207 Ga0207690_10005020 3300025932 Bacteria 7818
208 Ga0207690_10009060 3300025932 Bacteria 5908
209 Ga0207690_10012140 3300025932 Bacteria 5154
210 Ga0207690_10018215 3300025932 Bacteria 4305
211 Ga0207690_10021836 3300025932 Bacteria 3975
212 Ga0207706_10015961 3300025933 Bacteria 6786
213 Ga0207706_10020614 3300025933 Bacteria 5924
214 Ga0207706_10075408 3300025933 Bacteria 2966
215 Ga0207691_10085439 3300025940 Bacteria 2832
216 Ga0207691_10101281 3300025940 Bacteria 2570
217 Ga0207711_10006676 3300025941 Bacteria 9716
218 Ga0207711_10018615 3300025941 Bacteria 5774
219 Ga0207661_10018837 3300025944 Bacteria 5136
220 Ga0207679_10006758 3300025945 Bacteria 7269
221 Ga0207679_10010296 3300025945 Bacteria 6017
222 Ga0207679_10015121 3300025945 Bacteria 5091
223 Ga0207679_10020775 3300025945 Bacteria 4438
224 Ga0207679_10030210 3300025945 Bacteria 3781
225 Ga0207679_10046658 3300025945 Bacteria 3142
226 Ga0207679_10116533 3300025945 Bacteria 2118
227 Ga0207667_10000122 3300025949 Bacteria 121588
228 Ga0207667_10000167 3300025949 Bacteria 97188
229 Ga0207667_10005133 3300025949 Bacteria 15991
230 Ga0207667_10018604 3300025949 Bacteria 7785
231 Ga0207667_10040278 3300025949 Bacteria 4975
232 Ga0207667_10040320 3300025949 Bacteria 4972
233 Ga0207667_10065782 3300025949 Bacteria 3780
234 Ga0207667_10100544 3300025949 Bacteria 2983
235 Ga0207667_10229810 3300025949 Bacteria 1900
236 Ga0207667_10289686 3300025949 Bacteria 1673
237 Ga0207668_10046425 3300025972 Bacteria 2968
238 Ga0207640_10000261 3300025981 Bacteria 35598
239 Ga0207640_10006954 3300025981 Bacteria 6226
240 Ga0207640_10053531 3300025981 Bacteria 2635
241 Ga0207658_10009752 3300025986 Bacteria 6521
242 Ga0207639_10004480 3300026041 Bacteria 9429
243 Ga0207639_10110196 3300026041 Bacteria 2242
244 Ga0207639_10110639 3300026041 Bacteria 2238
245 Ga0207639_10121302 3300026041 Bacteria 2148
246 Ga0207639_10140014 3300026041 Bacteria 2014
247 Ga0207678_10001504 3300026067 Bacteria 21347
248 Ga0207678_10003033 3300026067 Bacteria 15198
249 Ga0207678_10004788 3300026067 Bacteria 12151
250 Ga0207678_10011670 3300026067 Bacteria 7714
251 Ga0207678_10013626 3300026067 Bacteria 7140
252 Ga0207678_10018090 3300026067 Bacteria 6190
253 Ga0207678_10071160 3300026067 Bacteria 2982
254 Ga0207702_10001769 3300026078 Bacteria 21261
255 Ga0207702_10006113 3300026078 Bacteria 10432
256 Ga0207702_10007514 3300026078 Bacteria 9292
257 Ga0207702_10036757 3300026078 Bacteria 4097
258 Ga0207641_10008285 3300026088 Bacteria 8590
259 Ga0207676_10011305 3300026095 Bacteria 6380
260 Ga0207674_10002506 3300026116 Bacteria 23153
261 Ga0207674_10116077 3300026116 Bacteria 2648
262 Ga0207683_10053294 3300026121 Bacteria 3546
263 Ga0207683_10081688 3300026121 Bacteria 2869
264 Ga0207698_10008550 3300026142 Bacteria 6484
265 Ga0207698_10040197 3300026142 Bacteria 3472
266 Ga0268265_10155664 3300028380 Bacteria 1933
267 Ga0268264_10017507 3300028381 Bacteria 5869
268 Ga0307413_10207012 3300031824 Bacteria 1421
269 Ga0307410_10019820 3300031852 Bacteria 4100
270 Ga0307412_10139102 3300031911 Bacteria 1775
271 Ga0307409_100005156 3300031995 Bacteria 7468
272 Ga0307416_100007191 3300032002 Bacteria 7048
273 Ga0307411_10003682 3300032005 Bacteria 7177
274 Ga0307411_10064825 3300032005 Bacteria 2447
275 Ga0307415_100005541 3300032126 Bacteria 6716
276 Ga0307415_100015728 3300032126 Bacteria 4490
277 Ga0307415_100052892 3300032126 Bacteria 2764
278 Ga0307415_100229268 3300032126 Bacteria 1495
279 Ga0395899_0002686 3300037312 Bacteria 14343
280 Ga0395899_0004002 3300037312 Bacteria 11613
281 Ga0395899_0032447 3300037312 Bacteria 3922
282 Ga0395899_0047027 3300037312 Bacteria 3213
283 Ga0395899_0058890 3300037312 Bacteria 2832
284 Ga0395899_0117716 3300037312 Bacteria 1905
285 Ga0395900_0035960 3300037418 Bacteria 5103
286 Ga0395900_0067319 3300037418 Bacteria 3679
287 Ga0395900_0075932 3300037418 Bacteria 3454
288 Ga0395900_0080272 3300037418 Bacteria 3352
289 Ga0395900_0109708 3300037418 Bacteria 2835
290 Ga0395900_0123843 3300037418 Bacteria 2651
291 Ga0395900_0193267 3300037418 Bacteria 2063
292 Ga0395900_0318842 3300037418 Bacteria 1535
293 Ga0395900_0331613 3300037418 Bacteria 1499
294 Ga0395898_0005157 3300037466 Bacteria 14138
295 Ga0395898_0065806 3300037466 Bacteria 3513
296 Ga0395898_0083534 3300037466 Bacteria 3078
297 Ga0395905_0004914 3300037471 Bacteria 13766
298 Ga0395905_0010843 3300037471 Bacteria 8828
299 Ga0395905_0020890 3300037471 Bacteria 6199
300 Ga0395905_0147142 3300037471 Bacteria 2216
301 Ga0395901_0020056 3300038443 Bacteria 6840
302 Ga0395901_0053705 3300038443 Bacteria 4187
303 Ga0395901_0134776 3300038443 Bacteria 2595
304 Ga0395901_0143840 3300038443 Bacteria 2506
305 Ga0395901_0168103 3300038443 Bacteria 2301
306 Ga0395901_0428452 3300038443 Bacteria 1355
307 Ga0436365_0731157 3300039437 Bacteria 3816
308 Ga0439438_020664 3300041405 Bacteria 1846
309 Ga0451806_256298 3300041462 Bacteria 6321
310 Ga0451807_0218438 3300041486 Bacteria 2169
311 Ga0439448_0004407 3300042005 Bacteria 3971
312 Ga0439455_0034575 3300042012 Bacteria 1272
313 Ga0450889_000193 3300042144 Bacteria 6640
314 Ga0439458_0001189 3300042157 Bacteria 6621
315 Ga0466966_0081205 3300044684 Bacteria 2019
316 Ga0466963_0002345 3300044694 Bacteria 10566
317 Ga0466963_0034674 3300044694 Bacteria 3285
318 Ga0466963_0119691 3300044694 Bacteria 1811
319 Ga0466963_0149837 3300044694 Bacteria 1619
320 Ga0466967_0075095 3300045976 Bacteria 3037
321 Ga0466967_0114563 3300045976 Bacteria 2482
322 Ga0466967_0221996 3300045976 Bacteria 1796
323 Ga0495663_0020800 3300046525 Bacteria 1885
324 Ga0495647_0050109 3300046681 Bacteria 1620
325 Ga0495669_0008463 3300046684 Bacteria 4328
326 Ga0495669_0011083 3300046684 Bacteria 3819
327 Ga0495670_0039331 3300046691 Bacteria 2359
328 Ga0495677_0004952 3300047445 Bacteria 5080
329 Ga0496102_0301484 3300048905 Bacteria 1510
330 Ga0496106_0373904 3300048909 Bacteria 1145
331 Ga0496107_0034100 3300048910 Bacteria 3644
332 Ga0496107_0090849 3300048910 Bacteria 2231
333 Ga0496109_0024385 3300048912 Bacteria 5377
334 Ga0496111_0019968 3300048914 Bacteria 4661
335 Ga0496111_0311574 3300048914 Bacteria 1166
336 Ga0496112_0028855 3300048915 Bacteria 5360
337 Ga0496112_0035621 3300048915 Bacteria 4850
338 Ga0496112_0042408 3300048915 Bacteria 4452
339 Ga0496113_0042787 3300048916 Bacteria 3348
340 Ga0496117_0013556 3300048920 Bacteria 7105
341 Ga0496122_0039132 3300048925 Bacteria 3785
342 Ga0496123_0001812 3300048926 Bacteria 28119
343 Ga0496124_0033231 3300048927 Bacteria 4539
344 Ga0501070_0085426 3300049586 Bacteria 2613
345 nmdc:mga08y16_17261_c1 3300050511 Bacteria 7598
346 Ga0466962_0109777 3300061719 Bacteria 1328

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100005156 Ga0307409_1000051564 289
2 3300005336 Ga0070680_100117621 Ga0070680_1001176212 290
3 3300005339 Ga0070660_100215180 Ga0070660_1002151802 291
4 3300025917 Ga0207660_10023203 Ga0207660_100232035 293
5 3300025919 Ga0207657_10023620 Ga0207657_100236206 293
6 3300025921 Ga0207652_10128218 Ga0207652_101282182 293
7 3300045976 Ga0466967_0221996 Ga0466967_0221996_140_1048 294
8 3300048909 Ga0496106_0373904 Ga0496106_0373904_165_1070 294
9 3300013104 Ga0157370_10003914 Ga0157370_100039148 296
10 3300048925 Ga0496122_0039132 Ga0496122_0039132_2265_3305 296
11 3300048926 Ga0496123_0001812 Ga0496123_0001812_11755_12795 296
12 3300005563 Ga0068855_100114506 Ga0068855_1001145063 297
13 3300013104 Ga0157370_10000176 Ga0157370_1000017617 297
14 3300025949 Ga0207667_10100544 Ga0207667_101005442 297
15 3300026078 Ga0207702_10036757 Ga0207702_100367574 297
16 3300048914 Ga0496111_0311574 Ga0496111_0311574_84_1124 297
17 3300048927 Ga0496124_0033231 Ga0496124_0033231_2186_3226 297
18 3300003214 JGI25165J46597_1000127 JGI25165J46597_100012734 298
19 3300013105 Ga0157369_10005408 Ga0157369_100054085 298
20 3300025231 Ga0207427_101817 Ga0207427_1018173 298
21 3300025250 Ga0209026_1001387 Ga0209026_10013875 298
22 3300025261 Ga0209233_1000120 Ga0209233_100012033 298
23 3300025272 Ga0209455_1017265 Ga0209455_10172652 298
24 3300037418 Ga0395900_0109708 Ga0395900_0109708_668_1708 298
25 3300005336 Ga0070680_100124980 Ga0070680_1001249802 299
26 3300005339 Ga0070660_100112430 Ga0070660_1001124302 299
27 3300005444 Ga0070694_100070959 Ga0070694_1000709592 299
28 3300005458 Ga0070681_10190264 Ga0070681_101902642 299
29 3300005539 Ga0068853_100222111 Ga0068853_1002221112 299
30 3300005539 Ga0068853_100251454 Ga0068853_1002514542 299
31 3300005545 Ga0070695_100024406 Ga0070695_1000244061 299
32 3300005546 Ga0070696_100001223 Ga0070696_10000122312 299
33 3300005549 Ga0070704_100137398 Ga0070704_1001373982 299
34 3300005563 Ga0068855_100100929 Ga0068855_1001009292 299
35 3300005614 Ga0068856_100065439 Ga0068856_1000654392 299
36 3300005844 Ga0068862_100008153 Ga0068862_1000081532 299
37 3300009094 Ga0111539_10023710 Ga0111539_100237103 299
38 3300025904 Ga0207647_10002659 Ga0207647_100026595 299
39 3300025909 Ga0207705_10000333 Ga0207705_1000033312 299
40 3300025917 Ga0207660_10001841 Ga0207660_100018413 299
41 3300025917 Ga0207660_10076832 Ga0207660_100768322 299
42 3300025919 Ga0207657_10001002 Ga0207657_1000100216 299
43 3300025921 Ga0207652_10000597 Ga0207652_1000059738 299
44 3300025921 Ga0207652_10411146 Ga0207652_104111462 299
45 3300025923 Ga0207681_10277048 Ga0207681_102770481 299
46 3300025932 Ga0207690_10018215 Ga0207690_100182153 299
47 3300025933 Ga0207706_10075408 Ga0207706_100754082 299
48 3300025949 Ga0207667_10005133 Ga0207667_100051337 299
49 3300025972 Ga0207668_10046425 Ga0207668_100464252 299
50 3300025981 Ga0207640_10053531 Ga0207640_100535312 299
51 3300026041 Ga0207639_10110196 Ga0207639_101101962 299
52 3300026067 Ga0207678_10001504 Ga0207678_100015046 299
53 3300026067 Ga0207678_10071160 Ga0207678_100711603 299
54 3300026078 Ga0207702_10007514 Ga0207702_100075144 299
55 3300041405 Ga0439438_020664 Ga0439438_020664_397_1470 299
56 3300042144 Ga0450889_000193 Ga0450889_000193_1502_2575 299
57 3300050511 nmdc:mga08y16_17261_c1 nmdc:mga08y16_17261_c1_2037_3110 299
58 3300005347 Ga0070668_100106501 Ga0070668_1001065012 301
59 3300005366 Ga0070659_100056080 Ga0070659_1000560802 301
60 3300005844 Ga0068862_100187503 Ga0068862_1001875032 301
61 3300028380 Ga0268265_10155664 Ga0268265_101556642 301
62 3300032126 Ga0307415_100052892 Ga0307415_1000528924 302
63 3300032126 Ga0307415_100229268 Ga0307415_1002292682 302
64 3300001979 JGI24740J21852_10001233 JGI24740J21852_1000123312 303
65 3300005329 Ga0070683_100002474 Ga0070683_1000024744 303
66 3300005336 Ga0070680_100001983 Ga0070680_1000019835 303
67 3300005339 Ga0070660_100000972 Ga0070660_1000009727 303
68 3300005455 Ga0070663_100001332 Ga0070663_1000013328 303
69 3300005458 Ga0070681_10134063 Ga0070681_101340633 303
70 3300005530 Ga0070679_100001108 Ga0070679_10000110812 303
71 3300005535 Ga0070684_100063059 Ga0070684_1000630593 303
72 3300013104 Ga0157370_10005659 Ga0157370_1000565912 303
73 3300013307 Ga0157372_10100529 Ga0157372_101005294 303
74 3300031824 Ga0307413_10207012 Ga0307413_102070121 303
75 3300037312 Ga0395899_0002686 Ga0395899_0002686_12369_13484 303
76 3300037466 Ga0395898_0005157 Ga0395898_0005157_863_1972 303
77 3300005331 Ga0070670_100003009 Ga0070670_1000030097 305
78 3300005356 Ga0070674_100030541 Ga0070674_1000305412 305
79 3300005543 Ga0070672_100008130 Ga0070672_1000081303 305
80 3300005564 Ga0070664_100096670 Ga0070664_1000966702 305
81 3300005618 Ga0068864_100038352 Ga0068864_1000383523 305
82 3300025925 Ga0207650_10016054 Ga0207650_100160544 305
83 3300025940 Ga0207691_10085439 Ga0207691_100854392 305
84 3300025945 Ga0207679_10030210 Ga0207679_100302102 305
85 3300026121 Ga0207683_10081688 Ga0207683_100816883 305
86 3300037312 Ga0395899_0047027 Ga0395899_0047027_1517_2605 308
87 3300037418 Ga0395900_0075932 Ga0395900_0075932_162_1250 308
88 3300005366 Ga0070659_100148757 Ga0070659_1001487572 309
89 3300037418 Ga0395900_0193267 Ga0395900_0193267_664_1758 309
90 3300038443 Ga0395901_0143840 Ga0395901_0143840_641_1735 309
91 3300038443 Ga0395901_0020056 Ga0395901_0020056_4395_5474 310
92 3300005435 Ga0070714_100107075 Ga0070714_1001070752 312
93 3300005354 Ga0070675_100044077 Ga0070675_1000440773 313
94 3300005366 Ga0070659_100043116 Ga0070659_1000431162 313
95 3300005366 Ga0070659_100054232 Ga0070659_1000542324 313
96 3300005539 Ga0068853_100029912 Ga0068853_1000299123 313
97 3300005616 Ga0068852_100040707 Ga0068852_1000407074 313
98 3300005834 Ga0068851_10017213 Ga0068851_100172134 313
99 3300025909 Ga0207705_10013569 Ga0207705_100135692 313
100 3300025919 Ga0207657_10014724 Ga0207657_100147243 313
101 3300025920 Ga0207649_10116203 Ga0207649_101162032 313
102 3300025932 Ga0207690_10009060 Ga0207690_100090605 313
103 3300025945 Ga0207679_10116533 Ga0207679_101165332 313
104 3300026041 Ga0207639_10140014 Ga0207639_101400142 313
105 3300026067 Ga0207678_10003033 Ga0207678_100030339 313
106 3300005356 Ga0070674_100174149 Ga0070674_1001741492 314
107 3300005578 Ga0068854_100060243 Ga0068854_1000602432 314
108 3300005985 Ga0081539_10012933 Ga0081539_100129337 314
109 3300025933 Ga0207706_10020614 Ga0207706_100206145 314
110 3300005355 Ga0070671_100002763 Ga0070671_1000027637 318
111 3300013308 Ga0157375_10063401 Ga0157375_100634012 319
112 3300044684 Ga0466966_0081205 Ga0466966_0081205_519_1631 319
113 3300044694 Ga0466963_0149837 Ga0466963_0149837_490_1590 319
114 3300046691 Ga0495670_0039331 Ga0495670_0039331_1058_2167 319
115 3300061719 Ga0466962_0109777 Ga0466962_0109777_119_1231 319
116 3300005455 Ga0070663_100017027 Ga0070663_1000170274 321
117 3300005578 Ga0068854_100002108 Ga0068854_1000021085 321
118 3300006358 Ga0068871_100141889 Ga0068871_1001418892 321
119 3300009551 Ga0105238_10197373 Ga0105238_101973732 321
120 3300013296 Ga0157374_10010960 Ga0157374_100109606 321
121 3300013307 Ga0157372_10198275 Ga0157372_101982751 321
122 3300025981 Ga0207640_10000261 Ga0207640_1000026138 321
123 3300005331 Ga0070670_100026687 Ga0070670_1000266873 322
124 3300048920 Ga0496117_0013556 Ga0496117_0013556_4549_5589 322
125 3300005331 Ga0070670_100333785 Ga0070670_1003337851 323
126 3300005563 Ga0068855_100000123 Ga0068855_10000012316 323
127 3300025315 Ga0207697_10008190 Ga0207697_100081903 323
128 3300025925 Ga0207650_10004781 Ga0207650_100047817 323
129 3300025940 Ga0207691_10101281 Ga0207691_101012812 323
130 3300025945 Ga0207679_10015121 Ga0207679_100151215 323
131 3300025949 Ga0207667_10000167 Ga0207667_1000016716 323
132 3300026041 Ga0207639_10121302 Ga0207639_101213022 323
133 3300026067 Ga0207678_10011670 Ga0207678_100116703 323
134 3300042005 Ga0439448_0004407 Ga0439448_0004407_1479_2513 323
135 3300042012 Ga0439455_0034575 Ga0439455_0034575_147_1181 323
136 3300048915 Ga0496112_0042408 Ga0496112_0042408_2748_3833 323
137 3300005339 Ga0070660_100000667 Ga0070660_10000066716 324
138 3300005436 Ga0070713_100229967 Ga0070713_1002299672 324
139 3300025919 Ga0207657_10002257 Ga0207657_1000225716 324
140 3300025928 Ga0207700_10177804 Ga0207700_101778042 324
141 3300025949 Ga0207667_10229810 Ga0207667_102298101 324
142 3300005614 Ga0068856_100059289 Ga0068856_1000592893 326
143 3300025949 Ga0207667_10289686 Ga0207667_102896862 327
144 3300041462 Ga0451806_256298 Ga0451806_256298_878_1918 327
145 3300041486 Ga0451807_0218438 Ga0451807_0218438_528_1568 327
146 3300005617 Ga0068859_100452611 Ga0068859_1004526111 328
147 3300006931 Ga0097620_100452645 Ga0097620_1004526452 328
148 3300042157 Ga0439458_0001189 Ga0439458_0001189_3787_4884 328
149 3300005327 Ga0070658_10002097 Ga0070658_1000209715 329
150 3300005543 Ga0070672_100054255 Ga0070672_1000542553 329
151 3300005548 Ga0070665_100055502 Ga0070665_1000555023 329
152 3300005843 Ga0068860_100023527 Ga0068860_1000235272 329
153 3300009177 Ga0105248_10093111 Ga0105248_100931113 329
154 3300013306 Ga0163162_10081079 Ga0163162_100810792 329
155 3300014968 Ga0157379_10040676 Ga0157379_100406762 329
156 3300025909 Ga0207705_10000066 Ga0207705_1000006691 329
157 3300025941 Ga0207711_10018615 Ga0207711_100186155 329
158 3300025986 Ga0207658_10009752 Ga0207658_100097523 329
159 3300028381 Ga0268264_10017507 Ga0268264_100175075 329
160 3300001990 JGI24737J22298_10011655 JGI24737J22298_100116553 330
161 3300002077 JGI24744J21845_10000080 JGI24744J21845_100000805 330
162 3300003762 Ga0055542_1002573 Ga0055542_10025735 330
163 3300005354 Ga0070675_100004619 Ga0070675_1000046191 330
164 3300005355 Ga0070671_100027641 Ga0070671_1000276414 330
165 3300005356 Ga0070674_100041991 Ga0070674_1000419912 330
166 3300005366 Ga0070659_100019051 Ga0070659_1000190513 330
167 3300005456 Ga0070678_100009430 Ga0070678_1000094304 330
168 3300025254 Ga0209148_1000114 Ga0209148_100011417 330
169 3300025919 Ga0207657_10010519 Ga0207657_100105193 330
170 3300026041 Ga0207639_10110639 Ga0207639_101106392 330
171 3300026121 Ga0207683_10053294 Ga0207683_100532944 330
172 3300031852 Ga0307410_10019820 Ga0307410_100198203 330
173 3300031911 Ga0307412_10139102 Ga0307412_101391022 330
174 3300032002 Ga0307416_100007191 Ga0307416_1000071917 330
175 3300032005 Ga0307411_10003682 Ga0307411_100036828 330
176 3300032126 Ga0307415_100005541 Ga0307415_1000055412 330
177 3300037418 Ga0395900_0318842 Ga0395900_0318842_41_1132 330
178 3300038443 Ga0395901_0053705 Ga0395901_0053705_1942_3033 330
179 3300048910 Ga0496107_0034100 Ga0496107_0034100_843_1910 330
180 3300005344 Ga0070661_100031145 Ga0070661_1000311452 331
181 3300005366 Ga0070659_100032506 Ga0070659_1000325064 331
182 3300005458 Ga0070681_10068138 Ga0070681_100681381 331
183 3300005563 Ga0068855_100009355 Ga0068855_1000093553 331
184 3300005578 Ga0068854_100085692 Ga0068854_1000856922 331
185 3300025932 Ga0207690_10012140 Ga0207690_100121405 331
186 3300025945 Ga0207679_10046658 Ga0207679_100466582 331
187 3300025949 Ga0207667_10065782 Ga0207667_100657823 331
188 3300026078 Ga0207702_10001769 Ga0207702_100017693 331
189 3300048905 Ga0496102_0301484 Ga0496102_0301484_224_1324 331
190 3300048910 Ga0496107_0090849 Ga0496107_0090849_274_1374 331
191 3300048914 Ga0496111_0019968 Ga0496111_0019968_1923_3023 331
192 3300048915 Ga0496112_0035621 Ga0496112_0035621_2343_3443 331
193 3300048916 Ga0496113_0042787 Ga0496113_0042787_779_1879 331
194 3300005339 Ga0070660_100346196 Ga0070660_1003461961 332
195 3300005366 Ga0070659_100002896 Ga0070659_1000028967 332
196 3300005458 Ga0070681_10002999 Ga0070681_1000299911 332
197 3300005539 Ga0068853_100025957 Ga0068853_1000259572 332
198 3300009174 Ga0105241_10259003 Ga0105241_102590031 332
199 3300025912 Ga0207707_10008798 Ga0207707_100087984 332
200 3300025919 Ga0207657_10010268 Ga0207657_100102682 332
201 3300025921 Ga0207652_10024070 Ga0207652_100240702 332
202 3300037312 Ga0395899_0058890 Ga0395899_0058890_1662_2774 332
203 3300037466 Ga0395898_0083534 Ga0395898_0083534_1555_2667 332
204 3300037471 Ga0395905_0004914 Ga0395905_0004914_5823_6935 332
205 3300044694 Ga0466963_0002345 Ga0466963_0002345_5199_6389 332
206 3300046525 Ga0495663_0020800 Ga0495663_0020800_12_1124 332
207 3300046684 Ga0495669_0011083 Ga0495669_0011083_1946_3058 332
208 3300047445 Ga0495677_0004952 Ga0495677_0004952_3454_4566 332
209 3300001979 JGI24740J21852_10026241 JGI24740J21852_100262412 333
210 3300005328 Ga0070676_10016633 Ga0070676_100166333 333
211 3300005335 Ga0070666_10234848 Ga0070666_102348481 333
212 3300005458 Ga0070681_10147940 Ga0070681_101479402 333
213 3300005548 Ga0070665_100021092 Ga0070665_1000210923 333
214 3300005563 Ga0068855_100177480 Ga0068855_1001774802 333
215 3300005564 Ga0070664_100089997 Ga0070664_1000899972 333
216 3300005578 Ga0068854_100132361 Ga0068854_1001323612 333
217 3300005614 Ga0068856_100184680 Ga0068856_1001846802 333
218 3300005617 Ga0068859_100330443 Ga0068859_1003304432 333
219 3300005834 Ga0068851_10021214 Ga0068851_100212142 333
220 3300006931 Ga0097620_100330429 Ga0097620_1003304292 333
221 3300025907 Ga0207645_10006658 Ga0207645_100066583 333
222 3300025919 Ga0207657_10014023 Ga0207657_100140233 333
223 3300025920 Ga0207649_10044821 Ga0207649_100448212 333
224 3300025921 Ga0207652_10240690 Ga0207652_102406902 333
225 3300025931 Ga0207644_10095980 Ga0207644_100959802 333
226 3300025933 Ga0207706_10015961 Ga0207706_100159611 333
227 3300026067 Ga0207678_10004788 Ga0207678_100047887 333
228 3300026116 Ga0207674_10116077 Ga0207674_101160773 333
229 3300046684 Ga0495669_0008463 Ga0495669_0008463_2510_3595 333
230 3300005355 Ga0070671_100009099 Ga0070671_1000090997 334
231 3300005366 Ga0070659_100060520 Ga0070659_1000605202 334
232 3300005578 Ga0068854_100007615 Ga0068854_1000076155 334
233 3300005618 Ga0068864_100029100 Ga0068864_1000291004 334
234 3300005841 Ga0068863_100012738 Ga0068863_1000127386 334
235 3300009177 Ga0105248_10003106 Ga0105248_1000310616 334
236 3300025919 Ga0207657_10156421 Ga0207657_101564212 334
237 3300025931 Ga0207644_10000227 Ga0207644_100002274 334
238 3300025941 Ga0207711_10006676 Ga0207711_100066763 334
239 3300026088 Ga0207641_10008285 Ga0207641_100082856 334
240 3300026095 Ga0207676_10011305 Ga0207676_100113055 334
241 3300037471 Ga0395905_0147142 Ga0395905_0147142_308_1405 334
242 3300045976 Ga0466967_0114563 Ga0466967_0114563_452_1558 334
243 3300048912 Ga0496109_0024385 Ga0496109_0024385_3943_5034 334
244 3300048915 Ga0496112_0028855 Ga0496112_0028855_3069_4160 334
245 3300005327 Ga0070658_10000405 Ga0070658_1000040524 335
246 3300005339 Ga0070660_100000194 Ga0070660_10000019426 335
247 3300005344 Ga0070661_100034536 Ga0070661_1000345363 335
248 3300005563 Ga0068855_100001534 Ga0068855_10000153418 335
249 3300005578 Ga0068854_100071991 Ga0068854_1000719912 335
250 3300009174 Ga0105241_10076090 Ga0105241_100760903 335
251 3300013100 Ga0157373_10061757 Ga0157373_100617572 335
252 3300013102 Ga0157371_10000915 Ga0157371_1000091520 335
253 3300013102 Ga0157371_10089143 Ga0157371_100891432 335
254 3300013104 Ga0157370_10105035 Ga0157370_101050352 335
255 3300013307 Ga0157372_10156506 Ga0157372_101565062 335
256 3300025909 Ga0207705_10000276 Ga0207705_1000027624 335
257 3300025919 Ga0207657_10000218 Ga0207657_1000021847 335
258 3300025919 Ga0207657_10012476 Ga0207657_100124763 335
259 3300025949 Ga0207667_10000122 Ga0207667_1000012262 335
260 3300025949 Ga0207667_10040320 Ga0207667_100403204 335
261 3300026067 Ga0207678_10013626 Ga0207678_100136262 335
262 3300026142 Ga0207698_10040197 Ga0207698_100401972 335
263 3300032126 Ga0307415_100015728 Ga0307415_1000157282 335
264 3300046681 Ga0495647_0050109 Ga0495647_0050109_418_1506 335
265 3300005339 Ga0070660_100136021 Ga0070660_1001360212 336
266 3300005455 Ga0070663_100004950 Ga0070663_1000049508 336
267 3300025920 Ga0207649_10086592 Ga0207649_100865922 336
268 3300026067 Ga0207678_10018090 Ga0207678_100180903 336
269 3300032005 Ga0307411_10064825 Ga0307411_100648252 336
270 3300037466 Ga0395898_0065806 Ga0395898_0065806_552_1655 336
271 3300044694 Ga0466963_0034674 Ga0466963_0034674_1236_2348 336
272 3300045976 Ga0466967_0075095 Ga0466967_0075095_1852_2946 336
273 3300049586 Ga0501070_0085426 Ga0501070_0085426_543_1646 336
274 3300037312 Ga0395899_0004002 Ga0395899_0004002_1852_2937 337
275 3300037418 Ga0395900_0035960 Ga0395900_0035960_480_1565 337
276 3300037471 Ga0395905_0010843 Ga0395905_0010843_897_1982 337
277 3300038443 Ga0395901_0168103 Ga0395901_0168103_1168_2253 337
278 3300044694 Ga0466963_0119691 Ga0466963_0119691_384_1481 337
279 3300005985 Ga0081539_10016021 Ga0081539_100160214 338
280 3300039437 Ga0436365_0731157 Ga0436365_0731157_951_2060 338
281 3300005344 Ga0070661_100035957 Ga0070661_1000359573 339
282 3300005364 Ga0070673_100381447 Ga0070673_1003814471 339
283 3300005366 Ga0070659_100012707 Ga0070659_1000127072 339
284 3300005564 Ga0070664_100184371 Ga0070664_1001843711 339
285 3300025919 Ga0207657_10022785 Ga0207657_100227854 339
286 3300025932 Ga0207690_10021836 Ga0207690_100218362 339
287 3300025945 Ga0207679_10020775 Ga0207679_100207752 339
288 3300037418 Ga0395900_0080272 Ga0395900_0080272_742_1833 339
289 3300005327 Ga0070658_10103225 Ga0070658_101032252 341
290 3300005329 Ga0070683_100172093 Ga0070683_1001720932 341
291 3300005564 Ga0070664_100004931 Ga0070664_1000049315 341
292 3300005578 Ga0068854_100043832 Ga0068854_1000438323 341
293 3300005616 Ga0068852_100068555 Ga0068852_1000685554 341
294 3300009093 Ga0105240_10087202 Ga0105240_100872023 341
295 3300013100 Ga0157373_10027432 Ga0157373_100274323 341
296 3300013100 Ga0157373_10237810 Ga0157373_102378102 341
297 3300013104 Ga0157370_10137829 Ga0157370_101378292 341
298 3300013307 Ga0157372_10582142 Ga0157372_105821422 341
299 3300025909 Ga0207705_10118649 Ga0207705_101186492 341
300 3300025913 Ga0207695_10066590 Ga0207695_100665903 341
301 3300025929 Ga0207664_10022937 Ga0207664_100229372 341
302 3300025945 Ga0207679_10006758 Ga0207679_100067582 341
303 3300025949 Ga0207667_10040278 Ga0207667_100402784 341
304 3300037312 Ga0395899_0117716 Ga0395899_0117716_392_1486 341
305 3300037418 Ga0395900_0067319 Ga0395900_0067319_876_1970 341
306 3300037418 Ga0395900_0331613 Ga0395900_0331613_334_1428 341
307 3300037471 Ga0395905_0020890 Ga0395905_0020890_2455_3549 341
308 3300038443 Ga0395901_0134776 Ga0395901_0134776_1396_2532 341
309 3300001979 JGI24740J21852_10001017 JGI24740J21852_100010179 343
310 3300002067 JGI24735J21928_10007606 JGI24735J21928_100076063 343
311 3300005327 Ga0070658_10033134 Ga0070658_100331342 343
312 3300005336 Ga0070680_100003473 Ga0070680_1000034739 343
313 3300005337 Ga0070682_100015332 Ga0070682_1000153324 343
314 3300005339 Ga0070660_100073001 Ga0070660_1000730013 343
315 3300005341 Ga0070691_10003475 Ga0070691_100034753 343
316 3300005344 Ga0070661_100010542 Ga0070661_1000105424 343
317 3300005366 Ga0070659_100091284 Ga0070659_1000912842 343
318 3300005535 Ga0070684_100002773 Ga0070684_1000027733 343
319 3300005564 Ga0070664_100028495 Ga0070664_1000284953 343
320 3300005577 Ga0068857_100005015 Ga0068857_10000501511 343
321 3300005578 Ga0068854_100006275 Ga0068854_1000062754 343
322 3300009093 Ga0105240_10041442 Ga0105240_100414423 343
323 3300009174 Ga0105241_10056329 Ga0105241_100563293 343
324 3300009545 Ga0105237_10027881 Ga0105237_100278814 343
325 3300009551 Ga0105238_10003788 Ga0105238_100037883 343
326 3300013104 Ga0157370_10039439 Ga0157370_100394394 343
327 3300013307 Ga0157372_10012937 Ga0157372_100129376 343
328 3300025904 Ga0207647_10002240 Ga0207647_1000224013 343
329 3300025909 Ga0207705_10018723 Ga0207705_100187233 343
330 3300025911 Ga0207654_10136092 Ga0207654_101360922 343
331 3300025913 Ga0207695_10018238 Ga0207695_100182384 343
332 3300025919 Ga0207657_10005932 Ga0207657_100059326 343
333 3300025920 Ga0207649_10003573 Ga0207649_100035736 343
334 3300025924 Ga0207694_10010800 Ga0207694_100108003 343
335 3300025932 Ga0207690_10005020 Ga0207690_100050205 343
336 3300025944 Ga0207661_10018837 Ga0207661_100188374 343
337 3300025945 Ga0207679_10010296 Ga0207679_100102963 343
338 3300025949 Ga0207667_10018604 Ga0207667_100186044 343
339 3300025981 Ga0207640_10006954 Ga0207640_100069543 343
340 3300026041 Ga0207639_10004480 Ga0207639_100044805 343
341 3300026078 Ga0207702_10006113 Ga0207702_100061136 343
342 3300026116 Ga0207674_10002506 Ga0207674_1000250612 343
343 3300026142 Ga0207698_10008550 Ga0207698_100085504 343
344 3300037312 Ga0395899_0032447 Ga0395899_0032447_2376_3476 343
345 3300037418 Ga0395900_0123843 Ga0395900_0123843_1460_2560 343
346 3300038443 Ga0395901_0428452 Ga0395901_0428452_151_1251 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

118

298

0.96

Feature Viewer

pLDDT pTM Quality
60.53 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map