F416696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 150 | 346 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100043832|Ga0068854_1000438323 |
| Length | 371 |
| Sequence | MAALATVFRVASLYIPTPMDMISGWGGRFRGLFTDTKGPWGHGSDDGGEAPPDDGAGNRRGRRSGIGGANVSALDELLRRSRARFGGGGGLPGRPDGSLILWGLAGLVVLWLIFTSFHSIAPGQRGVVTRFGRYSSTLGPGVSMTLPAPIDRVKKLDVEAIRTVDLGSSSSDDLMLTGDQNLIDLAYNVRWNIRTPELYLFQLAQPDETIQEVAESAMRAVISQVTLNDAMGDRRAEIEQQVAQNMQRILDAYRSGIQVQGIAIKQADPPSQVNDAFKEVTAAQQDAQTSINNANAYALQLRQKAQGEATAFDKVYAQYKLAPEVTRRRMYYETMEDVLSKIDKTVVEVPGVTPYLPLPEVKKKQPQGAPQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 123 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 125 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 126 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 127 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 128 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 145 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 146 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 147 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 148 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.73 |
| Nodule | 0 |
| Rhizoplane | 3.76 |
| Rhizosphere | 92.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001017 | 3300001979 | Bacteria | 12544 |
| 2 | JGI24740J21852_10001233 | 3300001979 | Bacteria | 11575 |
| 3 | JGI24740J21852_10026241 | 3300001979 | Bacteria | 1954 |
| 4 | JGI24737J22298_10011655 | 3300001990 | Bacteria | 2877 |
| 5 | JGI24735J21928_10007606 | 3300002067 | Bacteria | 3530 |
| 6 | JGI24744J21845_10000080 | 3300002077 | Bacteria | 12237 |
| 7 | JGI25165J46597_1000127 | 3300003214 | Bacteria | 130786 |
| 8 | Ga0055542_1002573 | 3300003762 | Bacteria | 5774 |
| 9 | Ga0070658_10000405 | 3300005327 | Bacteria | 37355 |
| 10 | Ga0070658_10002097 | 3300005327 | Bacteria | 16720 |
| 11 | Ga0070658_10033134 | 3300005327 | Bacteria | 4155 |
| 12 | Ga0070658_10103225 | 3300005327 | Bacteria | 2358 |
| 13 | Ga0070676_10016633 | 3300005328 | Bacteria | 4067 |
| 14 | Ga0070683_100002474 | 3300005329 | Bacteria | 14703 |
| 15 | Ga0070683_100172093 | 3300005329 | Bacteria | 2056 |
| 16 | Ga0070670_100003009 | 3300005331 | Bacteria | 13952 |
| 17 | Ga0070670_100026687 | 3300005331 | Bacteria | 4969 |
| 18 | Ga0070670_100333785 | 3300005331 | Bacteria | 1330 |
| 19 | Ga0070666_10234848 | 3300005335 | Bacteria | 1295 |
| 20 | Ga0070680_100001983 | 3300005336 | Bacteria | 15063 |
| 21 | Ga0070680_100003473 | 3300005336 | Bacteria | 11764 |
| 22 | Ga0070680_100117621 | 3300005336 | Bacteria | 2216 |
| 23 | Ga0070680_100124980 | 3300005336 | Bacteria | 2149 |
| 24 | Ga0070682_100015332 | 3300005337 | Bacteria | 4439 |
| 25 | Ga0070660_100000194 | 3300005339 | Bacteria | 40512 |
| 26 | Ga0070660_100000667 | 3300005339 | Bacteria | 22709 |
| 27 | Ga0070660_100000972 | 3300005339 | Bacteria | 19155 |
| 28 | Ga0070660_100073001 | 3300005339 | Bacteria | 2682 |
| 29 | Ga0070660_100112430 | 3300005339 | Bacteria | 2168 |
| 30 | Ga0070660_100136021 | 3300005339 | Bacteria | 1969 |
| 31 | Ga0070660_100215180 | 3300005339 | Bacteria | 1561 |
| 32 | Ga0070660_100346196 | 3300005339 | Bacteria | 1223 |
| 33 | Ga0070691_10003475 | 3300005341 | Bacteria | 7092 |
| 34 | Ga0070661_100010542 | 3300005344 | Bacteria | 6426 |
| 35 | Ga0070661_100031145 | 3300005344 | Bacteria | 3856 |
| 36 | Ga0070661_100034536 | 3300005344 | Bacteria | 3667 |
| 37 | Ga0070661_100035957 | 3300005344 | Bacteria | 3600 |
| 38 | Ga0070668_100106501 | 3300005347 | Bacteria | 2228 |
| 39 | Ga0070675_100004619 | 3300005354 | Bacteria | 10516 |
| 40 | Ga0070675_100044077 | 3300005354 | Bacteria | 3648 |
| 41 | Ga0070671_100002763 | 3300005355 | Bacteria | 13629 |
| 42 | Ga0070671_100009099 | 3300005355 | Bacteria | 7973 |
| 43 | Ga0070671_100027641 | 3300005355 | Bacteria | 4671 |
| 44 | Ga0070674_100030541 | 3300005356 | Bacteria | 3562 |
| 45 | Ga0070674_100041991 | 3300005356 | Bacteria | 3104 |
| 46 | Ga0070674_100174149 | 3300005356 | Bacteria | 1643 |
| 47 | Ga0070673_100381447 | 3300005364 | Bacteria | 1257 |
| 48 | Ga0070659_100002896 | 3300005366 | Bacteria | 12219 |
| 49 | Ga0070659_100012707 | 3300005366 | Bacteria | 6247 |
| 50 | Ga0070659_100019051 | 3300005366 | Bacteria | 5189 |
| 51 | Ga0070659_100032506 | 3300005366 | Bacteria | 4047 |
| 52 | Ga0070659_100043116 | 3300005366 | Bacteria | 3528 |
| 53 | Ga0070659_100054232 | 3300005366 | Bacteria | 3157 |
| 54 | Ga0070659_100056080 | 3300005366 | Bacteria | 3106 |
| 55 | Ga0070659_100060520 | 3300005366 | Bacteria | 2991 |
| 56 | Ga0070659_100091284 | 3300005366 | Bacteria | 2441 |
| 57 | Ga0070659_100148757 | 3300005366 | Bacteria | 1909 |
| 58 | Ga0070714_100107075 | 3300005435 | Bacteria | 2470 |
| 59 | Ga0070713_100229967 | 3300005436 | Unclassified | 1685 |
| 60 | Ga0070694_100070959 | 3300005444 | Bacteria | 2400 |
| 61 | Ga0070663_100001332 | 3300005455 | Bacteria | 13499 |
| 62 | Ga0070663_100004950 | 3300005455 | Bacteria | 7866 |
| 63 | Ga0070663_100017027 | 3300005455 | Bacteria | 4733 |
| 64 | Ga0070678_100009430 | 3300005456 | Bacteria | 5915 |
| 65 | Ga0070681_10002999 | 3300005458 | Bacteria | 15667 |
| 66 | Ga0070681_10068138 | 3300005458 | Bacteria | 3526 |
| 67 | Ga0070681_10134063 | 3300005458 | Bacteria | 2407 |
| 68 | Ga0070681_10147940 | 3300005458 | Bacteria | 2277 |
| 69 | Ga0070681_10190264 | 3300005458 | Bacteria | 1972 |
| 70 | Ga0070679_100001108 | 3300005530 | Bacteria | 23557 |
| 71 | Ga0070684_100002773 | 3300005535 | Bacteria | 12975 |
| 72 | Ga0070684_100063059 | 3300005535 | Bacteria | 3248 |
| 73 | Ga0068853_100025957 | 3300005539 | Bacteria | 4917 |
| 74 | Ga0068853_100029912 | 3300005539 | Bacteria | 4595 |
| 75 | Ga0068853_100222111 | 3300005539 | Bacteria | 1726 |
| 76 | Ga0068853_100251454 | 3300005539 | Bacteria | 1622 |
| 77 | Ga0070672_100008130 | 3300005543 | Bacteria | 7171 |
| 78 | Ga0070672_100054255 | 3300005543 | Bacteria | 3137 |
| 79 | Ga0070695_100024406 | 3300005545 | Bacteria | 3723 |
| 80 | Ga0070696_100001223 | 3300005546 | Bacteria | 16677 |
| 81 | Ga0070665_100021092 | 3300005548 | Bacteria | 6549 |
| 82 | Ga0070665_100055502 | 3300005548 | Bacteria | 3973 |
| 83 | Ga0070704_100137398 | 3300005549 | Bacteria | 1903 |
| 84 | Ga0068855_100000123 | 3300005563 | Bacteria | 97174 |
| 85 | Ga0068855_100001534 | 3300005563 | Bacteria | 29001 |
| 86 | Ga0068855_100009355 | 3300005563 | Bacteria | 11831 |
| 87 | Ga0068855_100100929 | 3300005563 | Bacteria | 3322 |
| 88 | Ga0068855_100114506 | 3300005563 | Bacteria | 3092 |
| 89 | Ga0068855_100177480 | 3300005563 | Bacteria | 2409 |
| 90 | Ga0070664_100004931 | 3300005564 | Bacteria | 10689 |
| 91 | Ga0070664_100028495 | 3300005564 | Bacteria | 4646 |
| 92 | Ga0070664_100089997 | 3300005564 | Bacteria | 2655 |
| 93 | Ga0070664_100096670 | 3300005564 | Bacteria | 2563 |
| 94 | Ga0070664_100184371 | 3300005564 | Bacteria | 1857 |
| 95 | Ga0068857_100005015 | 3300005577 | Bacteria | 11256 |
| 96 | Ga0068854_100002108 | 3300005578 | Bacteria | 12190 |
| 97 | Ga0068854_100006275 | 3300005578 | Bacteria | 7556 |
| 98 | Ga0068854_100007615 | 3300005578 | Bacteria | 6925 |
| 99 | Ga0068854_100043832 | 3300005578 | Bacteria | 3173 |
| 100 | Ga0068854_100060243 | 3300005578 | Bacteria | 2745 |
| 101 | Ga0068854_100071991 | 3300005578 | Bacteria | 2530 |
| 102 | Ga0068854_100085692 | 3300005578 | Bacteria | 2334 |
| 103 | Ga0068854_100132361 | 3300005578 | Bacteria | 1905 |
| 104 | Ga0068856_100059289 | 3300005614 | Bacteria | 3781 |
| 105 | Ga0068856_100065439 | 3300005614 | Bacteria | 3593 |
| 106 | Ga0068856_100184680 | 3300005614 | Bacteria | 2099 |
| 107 | Ga0068852_100040707 | 3300005616 | Bacteria | 3922 |
| 108 | Ga0068852_100068555 | 3300005616 | Bacteria | 3105 |
| 109 | Ga0068859_100330443 | 3300005617 | Bacteria | 1618 |
| 110 | Ga0068859_100452611 | 3300005617 | Bacteria | 1380 |
| 111 | Ga0068864_100029100 | 3300005618 | Bacteria | 4674 |
| 112 | Ga0068864_100038352 | 3300005618 | Bacteria | 4092 |
| 113 | Ga0068851_10017213 | 3300005834 | Bacteria | 3468 |
| 114 | Ga0068851_10021214 | 3300005834 | Bacteria | 3154 |
| 115 | Ga0068863_100012738 | 3300005841 | Bacteria | 8109 |
| 116 | Ga0068860_100023527 | 3300005843 | Bacteria | 5954 |
| 117 | Ga0068862_100008153 | 3300005844 | Bacteria | 8660 |
| 118 | Ga0068862_100187503 | 3300005844 | Bacteria | 1859 |
| 119 | Ga0081539_10012933 | 3300005985 | Bacteria | 6349 |
| 120 | Ga0081539_10016021 | 3300005985 | Bacteria | 5393 |
| 121 | Ga0068871_100141889 | 3300006358 | Bacteria | 2043 |
| 122 | Ga0097620_100330429 | 3300006931 | Bacteria | 1618 |
| 123 | Ga0097620_100452645 | 3300006931 | Bacteria | 1380 |
| 124 | Ga0105240_10041442 | 3300009093 | Bacteria | 5877 |
| 125 | Ga0105240_10087202 | 3300009093 | Bacteria | 3822 |
| 126 | Ga0111539_10023710 | 3300009094 | Bacteria | 7539 |
| 127 | Ga0105241_10056329 | 3300009174 | Bacteria | 3014 |
| 128 | Ga0105241_10076090 | 3300009174 | Bacteria | 2617 |
| 129 | Ga0105241_10259003 | 3300009174 | Bacteria | 1478 |
| 130 | Ga0105248_10003106 | 3300009177 | Bacteria | 18389 |
| 131 | Ga0105248_10093111 | 3300009177 | Bacteria | 3393 |
| 132 | Ga0105237_10027881 | 3300009545 | Bacteria | 5755 |
| 133 | Ga0105238_10003788 | 3300009551 | Bacteria | 15030 |
| 134 | Ga0105238_10197373 | 3300009551 | Bacteria | 1988 |
| 135 | Ga0157373_10027432 | 3300013100 | Bacteria | 4108 |
| 136 | Ga0157373_10061757 | 3300013100 | Bacteria | 2654 |
| 137 | Ga0157373_10237810 | 3300013100 | Bacteria | 1287 |
| 138 | Ga0157371_10000915 | 3300013102 | Bacteria | 33246 |
| 139 | Ga0157371_10089143 | 3300013102 | Bacteria | 2184 |
| 140 | Ga0157370_10000176 | 3300013104 | Bacteria | 79656 |
| 141 | Ga0157370_10003914 | 3300013104 | Bacteria | 17343 |
| 142 | Ga0157370_10005659 | 3300013104 | Bacteria | 13970 |
| 143 | Ga0157370_10039439 | 3300013104 | Bacteria | 4564 |
| 144 | Ga0157370_10105035 | 3300013104 | Bacteria | 2644 |
| 145 | Ga0157370_10137829 | 3300013104 | Bacteria | 2274 |
| 146 | Ga0157369_10005408 | 3300013105 | Bacteria | 14865 |
| 147 | Ga0157374_10010960 | 3300013296 | Bacteria | 7828 |
| 148 | Ga0163162_10081079 | 3300013306 | Bacteria | 3315 |
| 149 | Ga0157372_10012937 | 3300013307 | Bacteria | 8897 |
| 150 | Ga0157372_10100529 | 3300013307 | Bacteria | 3300 |
| 151 | Ga0157372_10156506 | 3300013307 | Bacteria | 2632 |
| 152 | Ga0157372_10198275 | 3300013307 | Bacteria | 2325 |
| 153 | Ga0157372_10582142 | 3300013307 | Bacteria | 1305 |
| 154 | Ga0157375_10063401 | 3300013308 | Bacteria | 3677 |
| 155 | Ga0157379_10040676 | 3300014968 | Bacteria | 4150 |
| 156 | Ga0207427_101817 | 3300025231 | Bacteria | 6826 |
| 157 | Ga0209026_1001387 | 3300025250 | Bacteria | 10790 |
| 158 | Ga0209148_1000114 | 3300025254 | Bacteria | 192073 |
| 159 | Ga0209233_1000120 | 3300025261 | Bacteria | 233311 |
| 160 | Ga0209455_1017265 | 3300025272 | Bacteria | 1521 |
| 161 | Ga0207697_10008190 | 3300025315 | Bacteria | 4598 |
| 162 | Ga0207647_10002240 | 3300025904 | Bacteria | 14734 |
| 163 | Ga0207647_10002659 | 3300025904 | Bacteria | 13489 |
| 164 | Ga0207645_10006658 | 3300025907 | Bacteria | 8251 |
| 165 | Ga0207705_10000066 | 3300025909 | Bacteria | 136520 |
| 166 | Ga0207705_10000276 | 3300025909 | Bacteria | 49160 |
| 167 | Ga0207705_10000333 | 3300025909 | Bacteria | 42908 |
| 168 | Ga0207705_10013569 | 3300025909 | Bacteria | 5882 |
| 169 | Ga0207705_10018723 | 3300025909 | Bacteria | 4954 |
| 170 | Ga0207705_10118649 | 3300025909 | Bacteria | 1961 |
| 171 | Ga0207654_10136092 | 3300025911 | Bacteria | 1561 |
| 172 | Ga0207707_10008798 | 3300025912 | Bacteria | 8761 |
| 173 | Ga0207695_10018238 | 3300025913 | Bacteria | 8122 |
| 174 | Ga0207695_10066590 | 3300025913 | Bacteria | 3699 |
| 175 | Ga0207660_10001841 | 3300025917 | Bacteria | 14140 |
| 176 | Ga0207660_10023203 | 3300025917 | Bacteria | 4189 |
| 177 | Ga0207660_10076832 | 3300025917 | Bacteria | 2442 |
| 178 | Ga0207657_10000218 | 3300025919 | Bacteria | 59661 |
| 179 | Ga0207657_10001002 | 3300025919 | Bacteria | 30045 |
| 180 | Ga0207657_10002257 | 3300025919 | Bacteria | 20882 |
| 181 | Ga0207657_10005932 | 3300025919 | Bacteria | 12715 |
| 182 | Ga0207657_10010268 | 3300025919 | Bacteria | 9347 |
| 183 | Ga0207657_10010519 | 3300025919 | Bacteria | 9227 |
| 184 | Ga0207657_10012476 | 3300025919 | Bacteria | 8388 |
| 185 | Ga0207657_10014023 | 3300025919 | Bacteria | 7841 |
| 186 | Ga0207657_10014724 | 3300025919 | Bacteria | 7616 |
| 187 | Ga0207657_10022785 | 3300025919 | Bacteria | 5849 |
| 188 | Ga0207657_10023620 | 3300025919 | Bacteria | 5720 |
| 189 | Ga0207657_10156421 | 3300025919 | Bacteria | 1854 |
| 190 | Ga0207649_10003573 | 3300025920 | Bacteria | 8496 |
| 191 | Ga0207649_10044821 | 3300025920 | Bacteria | 2709 |
| 192 | Ga0207649_10086592 | 3300025920 | Bacteria | 2042 |
| 193 | Ga0207649_10116203 | 3300025920 | Bacteria | 1796 |
| 194 | Ga0207652_10000597 | 3300025921 | Bacteria | 36153 |
| 195 | Ga0207652_10024070 | 3300025921 | Bacteria | 5050 |
| 196 | Ga0207652_10128218 | 3300025921 | Bacteria | 2261 |
| 197 | Ga0207652_10240690 | 3300025921 | Bacteria | 1631 |
| 198 | Ga0207652_10411146 | 3300025921 | Bacteria | 1220 |
| 199 | Ga0207681_10277048 | 3300025923 | Bacteria | 1319 |
| 200 | Ga0207694_10010800 | 3300025924 | Bacteria | 6896 |
| 201 | Ga0207650_10004781 | 3300025925 | Bacteria | 9254 |
| 202 | Ga0207650_10016054 | 3300025925 | Bacteria | 5226 |
| 203 | Ga0207700_10177804 | 3300025928 | Bacteria | 1780 |
| 204 | Ga0207664_10022937 | 3300025929 | Bacteria | 4669 |
| 205 | Ga0207644_10000227 | 3300025931 | Bacteria | 38835 |
| 206 | Ga0207644_10095980 | 3300025931 | Bacteria | 2218 |
| 207 | Ga0207690_10005020 | 3300025932 | Bacteria | 7818 |
| 208 | Ga0207690_10009060 | 3300025932 | Bacteria | 5908 |
| 209 | Ga0207690_10012140 | 3300025932 | Bacteria | 5154 |
| 210 | Ga0207690_10018215 | 3300025932 | Bacteria | 4305 |
| 211 | Ga0207690_10021836 | 3300025932 | Bacteria | 3975 |
| 212 | Ga0207706_10015961 | 3300025933 | Bacteria | 6786 |
| 213 | Ga0207706_10020614 | 3300025933 | Bacteria | 5924 |
| 214 | Ga0207706_10075408 | 3300025933 | Bacteria | 2966 |
| 215 | Ga0207691_10085439 | 3300025940 | Bacteria | 2832 |
| 216 | Ga0207691_10101281 | 3300025940 | Bacteria | 2570 |
| 217 | Ga0207711_10006676 | 3300025941 | Bacteria | 9716 |
| 218 | Ga0207711_10018615 | 3300025941 | Bacteria | 5774 |
| 219 | Ga0207661_10018837 | 3300025944 | Bacteria | 5136 |
| 220 | Ga0207679_10006758 | 3300025945 | Bacteria | 7269 |
| 221 | Ga0207679_10010296 | 3300025945 | Bacteria | 6017 |
| 222 | Ga0207679_10015121 | 3300025945 | Bacteria | 5091 |
| 223 | Ga0207679_10020775 | 3300025945 | Bacteria | 4438 |
| 224 | Ga0207679_10030210 | 3300025945 | Bacteria | 3781 |
| 225 | Ga0207679_10046658 | 3300025945 | Bacteria | 3142 |
| 226 | Ga0207679_10116533 | 3300025945 | Bacteria | 2118 |
| 227 | Ga0207667_10000122 | 3300025949 | Bacteria | 121588 |
| 228 | Ga0207667_10000167 | 3300025949 | Bacteria | 97188 |
| 229 | Ga0207667_10005133 | 3300025949 | Bacteria | 15991 |
| 230 | Ga0207667_10018604 | 3300025949 | Bacteria | 7785 |
| 231 | Ga0207667_10040278 | 3300025949 | Bacteria | 4975 |
| 232 | Ga0207667_10040320 | 3300025949 | Bacteria | 4972 |
| 233 | Ga0207667_10065782 | 3300025949 | Bacteria | 3780 |
| 234 | Ga0207667_10100544 | 3300025949 | Bacteria | 2983 |
| 235 | Ga0207667_10229810 | 3300025949 | Bacteria | 1900 |
| 236 | Ga0207667_10289686 | 3300025949 | Bacteria | 1673 |
| 237 | Ga0207668_10046425 | 3300025972 | Bacteria | 2968 |
| 238 | Ga0207640_10000261 | 3300025981 | Bacteria | 35598 |
| 239 | Ga0207640_10006954 | 3300025981 | Bacteria | 6226 |
| 240 | Ga0207640_10053531 | 3300025981 | Bacteria | 2635 |
| 241 | Ga0207658_10009752 | 3300025986 | Bacteria | 6521 |
| 242 | Ga0207639_10004480 | 3300026041 | Bacteria | 9429 |
| 243 | Ga0207639_10110196 | 3300026041 | Bacteria | 2242 |
| 244 | Ga0207639_10110639 | 3300026041 | Bacteria | 2238 |
| 245 | Ga0207639_10121302 | 3300026041 | Bacteria | 2148 |
| 246 | Ga0207639_10140014 | 3300026041 | Bacteria | 2014 |
| 247 | Ga0207678_10001504 | 3300026067 | Bacteria | 21347 |
| 248 | Ga0207678_10003033 | 3300026067 | Bacteria | 15198 |
| 249 | Ga0207678_10004788 | 3300026067 | Bacteria | 12151 |
| 250 | Ga0207678_10011670 | 3300026067 | Bacteria | 7714 |
| 251 | Ga0207678_10013626 | 3300026067 | Bacteria | 7140 |
| 252 | Ga0207678_10018090 | 3300026067 | Bacteria | 6190 |
| 253 | Ga0207678_10071160 | 3300026067 | Bacteria | 2982 |
| 254 | Ga0207702_10001769 | 3300026078 | Bacteria | 21261 |
| 255 | Ga0207702_10006113 | 3300026078 | Bacteria | 10432 |
| 256 | Ga0207702_10007514 | 3300026078 | Bacteria | 9292 |
| 257 | Ga0207702_10036757 | 3300026078 | Bacteria | 4097 |
| 258 | Ga0207641_10008285 | 3300026088 | Bacteria | 8590 |
| 259 | Ga0207676_10011305 | 3300026095 | Bacteria | 6380 |
| 260 | Ga0207674_10002506 | 3300026116 | Bacteria | 23153 |
| 261 | Ga0207674_10116077 | 3300026116 | Bacteria | 2648 |
| 262 | Ga0207683_10053294 | 3300026121 | Bacteria | 3546 |
| 263 | Ga0207683_10081688 | 3300026121 | Bacteria | 2869 |
| 264 | Ga0207698_10008550 | 3300026142 | Bacteria | 6484 |
| 265 | Ga0207698_10040197 | 3300026142 | Bacteria | 3472 |
| 266 | Ga0268265_10155664 | 3300028380 | Bacteria | 1933 |
| 267 | Ga0268264_10017507 | 3300028381 | Bacteria | 5869 |
| 268 | Ga0307413_10207012 | 3300031824 | Bacteria | 1421 |
| 269 | Ga0307410_10019820 | 3300031852 | Bacteria | 4100 |
| 270 | Ga0307412_10139102 | 3300031911 | Bacteria | 1775 |
| 271 | Ga0307409_100005156 | 3300031995 | Bacteria | 7468 |
| 272 | Ga0307416_100007191 | 3300032002 | Bacteria | 7048 |
| 273 | Ga0307411_10003682 | 3300032005 | Bacteria | 7177 |
| 274 | Ga0307411_10064825 | 3300032005 | Bacteria | 2447 |
| 275 | Ga0307415_100005541 | 3300032126 | Bacteria | 6716 |
| 276 | Ga0307415_100015728 | 3300032126 | Bacteria | 4490 |
| 277 | Ga0307415_100052892 | 3300032126 | Bacteria | 2764 |
| 278 | Ga0307415_100229268 | 3300032126 | Bacteria | 1495 |
| 279 | Ga0395899_0002686 | 3300037312 | Bacteria | 14343 |
| 280 | Ga0395899_0004002 | 3300037312 | Bacteria | 11613 |
| 281 | Ga0395899_0032447 | 3300037312 | Bacteria | 3922 |
| 282 | Ga0395899_0047027 | 3300037312 | Bacteria | 3213 |
| 283 | Ga0395899_0058890 | 3300037312 | Bacteria | 2832 |
| 284 | Ga0395899_0117716 | 3300037312 | Bacteria | 1905 |
| 285 | Ga0395900_0035960 | 3300037418 | Bacteria | 5103 |
| 286 | Ga0395900_0067319 | 3300037418 | Bacteria | 3679 |
| 287 | Ga0395900_0075932 | 3300037418 | Bacteria | 3454 |
| 288 | Ga0395900_0080272 | 3300037418 | Bacteria | 3352 |
| 289 | Ga0395900_0109708 | 3300037418 | Bacteria | 2835 |
| 290 | Ga0395900_0123843 | 3300037418 | Bacteria | 2651 |
| 291 | Ga0395900_0193267 | 3300037418 | Bacteria | 2063 |
| 292 | Ga0395900_0318842 | 3300037418 | Bacteria | 1535 |
| 293 | Ga0395900_0331613 | 3300037418 | Bacteria | 1499 |
| 294 | Ga0395898_0005157 | 3300037466 | Bacteria | 14138 |
| 295 | Ga0395898_0065806 | 3300037466 | Bacteria | 3513 |
| 296 | Ga0395898_0083534 | 3300037466 | Bacteria | 3078 |
| 297 | Ga0395905_0004914 | 3300037471 | Bacteria | 13766 |
| 298 | Ga0395905_0010843 | 3300037471 | Bacteria | 8828 |
| 299 | Ga0395905_0020890 | 3300037471 | Bacteria | 6199 |
| 300 | Ga0395905_0147142 | 3300037471 | Bacteria | 2216 |
| 301 | Ga0395901_0020056 | 3300038443 | Bacteria | 6840 |
| 302 | Ga0395901_0053705 | 3300038443 | Bacteria | 4187 |
| 303 | Ga0395901_0134776 | 3300038443 | Bacteria | 2595 |
| 304 | Ga0395901_0143840 | 3300038443 | Bacteria | 2506 |
| 305 | Ga0395901_0168103 | 3300038443 | Bacteria | 2301 |
| 306 | Ga0395901_0428452 | 3300038443 | Bacteria | 1355 |
| 307 | Ga0436365_0731157 | 3300039437 | Bacteria | 3816 |
| 308 | Ga0439438_020664 | 3300041405 | Bacteria | 1846 |
| 309 | Ga0451806_256298 | 3300041462 | Bacteria | 6321 |
| 310 | Ga0451807_0218438 | 3300041486 | Bacteria | 2169 |
| 311 | Ga0439448_0004407 | 3300042005 | Bacteria | 3971 |
| 312 | Ga0439455_0034575 | 3300042012 | Bacteria | 1272 |
| 313 | Ga0450889_000193 | 3300042144 | Bacteria | 6640 |
| 314 | Ga0439458_0001189 | 3300042157 | Bacteria | 6621 |
| 315 | Ga0466966_0081205 | 3300044684 | Bacteria | 2019 |
| 316 | Ga0466963_0002345 | 3300044694 | Bacteria | 10566 |
| 317 | Ga0466963_0034674 | 3300044694 | Bacteria | 3285 |
| 318 | Ga0466963_0119691 | 3300044694 | Bacteria | 1811 |
| 319 | Ga0466963_0149837 | 3300044694 | Bacteria | 1619 |
| 320 | Ga0466967_0075095 | 3300045976 | Bacteria | 3037 |
| 321 | Ga0466967_0114563 | 3300045976 | Bacteria | 2482 |
| 322 | Ga0466967_0221996 | 3300045976 | Bacteria | 1796 |
| 323 | Ga0495663_0020800 | 3300046525 | Bacteria | 1885 |
| 324 | Ga0495647_0050109 | 3300046681 | Bacteria | 1620 |
| 325 | Ga0495669_0008463 | 3300046684 | Bacteria | 4328 |
| 326 | Ga0495669_0011083 | 3300046684 | Bacteria | 3819 |
| 327 | Ga0495670_0039331 | 3300046691 | Bacteria | 2359 |
| 328 | Ga0495677_0004952 | 3300047445 | Bacteria | 5080 |
| 329 | Ga0496102_0301484 | 3300048905 | Bacteria | 1510 |
| 330 | Ga0496106_0373904 | 3300048909 | Bacteria | 1145 |
| 331 | Ga0496107_0034100 | 3300048910 | Bacteria | 3644 |
| 332 | Ga0496107_0090849 | 3300048910 | Bacteria | 2231 |
| 333 | Ga0496109_0024385 | 3300048912 | Bacteria | 5377 |
| 334 | Ga0496111_0019968 | 3300048914 | Bacteria | 4661 |
| 335 | Ga0496111_0311574 | 3300048914 | Bacteria | 1166 |
| 336 | Ga0496112_0028855 | 3300048915 | Bacteria | 5360 |
| 337 | Ga0496112_0035621 | 3300048915 | Bacteria | 4850 |
| 338 | Ga0496112_0042408 | 3300048915 | Bacteria | 4452 |
| 339 | Ga0496113_0042787 | 3300048916 | Bacteria | 3348 |
| 340 | Ga0496117_0013556 | 3300048920 | Bacteria | 7105 |
| 341 | Ga0496122_0039132 | 3300048925 | Bacteria | 3785 |
| 342 | Ga0496123_0001812 | 3300048926 | Bacteria | 28119 |
| 343 | Ga0496124_0033231 | 3300048927 | Bacteria | 4539 |
| 344 | Ga0501070_0085426 | 3300049586 | Bacteria | 2613 |
| 345 | nmdc:mga08y16_17261_c1 | 3300050511 | Bacteria | 7598 |
| 346 | Ga0466962_0109777 | 3300061719 | Bacteria | 1328 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100005156 | Ga0307409_1000051564 | 289 |
| 2 | 3300005336 | Ga0070680_100117621 | Ga0070680_1001176212 | 290 |
| 3 | 3300005339 | Ga0070660_100215180 | Ga0070660_1002151802 | 291 |
| 4 | 3300025917 | Ga0207660_10023203 | Ga0207660_100232035 | 293 |
| 5 | 3300025919 | Ga0207657_10023620 | Ga0207657_100236206 | 293 |
| 6 | 3300025921 | Ga0207652_10128218 | Ga0207652_101282182 | 293 |
| 7 | 3300045976 | Ga0466967_0221996 | Ga0466967_0221996_140_1048 | 294 |
| 8 | 3300048909 | Ga0496106_0373904 | Ga0496106_0373904_165_1070 | 294 |
| 9 | 3300013104 | Ga0157370_10003914 | Ga0157370_100039148 | 296 |
| 10 | 3300048925 | Ga0496122_0039132 | Ga0496122_0039132_2265_3305 | 296 |
| 11 | 3300048926 | Ga0496123_0001812 | Ga0496123_0001812_11755_12795 | 296 |
| 12 | 3300005563 | Ga0068855_100114506 | Ga0068855_1001145063 | 297 |
| 13 | 3300013104 | Ga0157370_10000176 | Ga0157370_1000017617 | 297 |
| 14 | 3300025949 | Ga0207667_10100544 | Ga0207667_101005442 | 297 |
| 15 | 3300026078 | Ga0207702_10036757 | Ga0207702_100367574 | 297 |
| 16 | 3300048914 | Ga0496111_0311574 | Ga0496111_0311574_84_1124 | 297 |
| 17 | 3300048927 | Ga0496124_0033231 | Ga0496124_0033231_2186_3226 | 297 |
| 18 | 3300003214 | JGI25165J46597_1000127 | JGI25165J46597_100012734 | 298 |
| 19 | 3300013105 | Ga0157369_10005408 | Ga0157369_100054085 | 298 |
| 20 | 3300025231 | Ga0207427_101817 | Ga0207427_1018173 | 298 |
| 21 | 3300025250 | Ga0209026_1001387 | Ga0209026_10013875 | 298 |
| 22 | 3300025261 | Ga0209233_1000120 | Ga0209233_100012033 | 298 |
| 23 | 3300025272 | Ga0209455_1017265 | Ga0209455_10172652 | 298 |
| 24 | 3300037418 | Ga0395900_0109708 | Ga0395900_0109708_668_1708 | 298 |
| 25 | 3300005336 | Ga0070680_100124980 | Ga0070680_1001249802 | 299 |
| 26 | 3300005339 | Ga0070660_100112430 | Ga0070660_1001124302 | 299 |
| 27 | 3300005444 | Ga0070694_100070959 | Ga0070694_1000709592 | 299 |
| 28 | 3300005458 | Ga0070681_10190264 | Ga0070681_101902642 | 299 |
| 29 | 3300005539 | Ga0068853_100222111 | Ga0068853_1002221112 | 299 |
| 30 | 3300005539 | Ga0068853_100251454 | Ga0068853_1002514542 | 299 |
| 31 | 3300005545 | Ga0070695_100024406 | Ga0070695_1000244061 | 299 |
| 32 | 3300005546 | Ga0070696_100001223 | Ga0070696_10000122312 | 299 |
| 33 | 3300005549 | Ga0070704_100137398 | Ga0070704_1001373982 | 299 |
| 34 | 3300005563 | Ga0068855_100100929 | Ga0068855_1001009292 | 299 |
| 35 | 3300005614 | Ga0068856_100065439 | Ga0068856_1000654392 | 299 |
| 36 | 3300005844 | Ga0068862_100008153 | Ga0068862_1000081532 | 299 |
| 37 | 3300009094 | Ga0111539_10023710 | Ga0111539_100237103 | 299 |
| 38 | 3300025904 | Ga0207647_10002659 | Ga0207647_100026595 | 299 |
| 39 | 3300025909 | Ga0207705_10000333 | Ga0207705_1000033312 | 299 |
| 40 | 3300025917 | Ga0207660_10001841 | Ga0207660_100018413 | 299 |
| 41 | 3300025917 | Ga0207660_10076832 | Ga0207660_100768322 | 299 |
| 42 | 3300025919 | Ga0207657_10001002 | Ga0207657_1000100216 | 299 |
| 43 | 3300025921 | Ga0207652_10000597 | Ga0207652_1000059738 | 299 |
| 44 | 3300025921 | Ga0207652_10411146 | Ga0207652_104111462 | 299 |
| 45 | 3300025923 | Ga0207681_10277048 | Ga0207681_102770481 | 299 |
| 46 | 3300025932 | Ga0207690_10018215 | Ga0207690_100182153 | 299 |
| 47 | 3300025933 | Ga0207706_10075408 | Ga0207706_100754082 | 299 |
| 48 | 3300025949 | Ga0207667_10005133 | Ga0207667_100051337 | 299 |
| 49 | 3300025972 | Ga0207668_10046425 | Ga0207668_100464252 | 299 |
| 50 | 3300025981 | Ga0207640_10053531 | Ga0207640_100535312 | 299 |
| 51 | 3300026041 | Ga0207639_10110196 | Ga0207639_101101962 | 299 |
| 52 | 3300026067 | Ga0207678_10001504 | Ga0207678_100015046 | 299 |
| 53 | 3300026067 | Ga0207678_10071160 | Ga0207678_100711603 | 299 |
| 54 | 3300026078 | Ga0207702_10007514 | Ga0207702_100075144 | 299 |
| 55 | 3300041405 | Ga0439438_020664 | Ga0439438_020664_397_1470 | 299 |
| 56 | 3300042144 | Ga0450889_000193 | Ga0450889_000193_1502_2575 | 299 |
| 57 | 3300050511 | nmdc:mga08y16_17261_c1 | nmdc:mga08y16_17261_c1_2037_3110 | 299 |
| 58 | 3300005347 | Ga0070668_100106501 | Ga0070668_1001065012 | 301 |
| 59 | 3300005366 | Ga0070659_100056080 | Ga0070659_1000560802 | 301 |
| 60 | 3300005844 | Ga0068862_100187503 | Ga0068862_1001875032 | 301 |
| 61 | 3300028380 | Ga0268265_10155664 | Ga0268265_101556642 | 301 |
| 62 | 3300032126 | Ga0307415_100052892 | Ga0307415_1000528924 | 302 |
| 63 | 3300032126 | Ga0307415_100229268 | Ga0307415_1002292682 | 302 |
| 64 | 3300001979 | JGI24740J21852_10001233 | JGI24740J21852_1000123312 | 303 |
| 65 | 3300005329 | Ga0070683_100002474 | Ga0070683_1000024744 | 303 |
| 66 | 3300005336 | Ga0070680_100001983 | Ga0070680_1000019835 | 303 |
| 67 | 3300005339 | Ga0070660_100000972 | Ga0070660_1000009727 | 303 |
| 68 | 3300005455 | Ga0070663_100001332 | Ga0070663_1000013328 | 303 |
| 69 | 3300005458 | Ga0070681_10134063 | Ga0070681_101340633 | 303 |
| 70 | 3300005530 | Ga0070679_100001108 | Ga0070679_10000110812 | 303 |
| 71 | 3300005535 | Ga0070684_100063059 | Ga0070684_1000630593 | 303 |
| 72 | 3300013104 | Ga0157370_10005659 | Ga0157370_1000565912 | 303 |
| 73 | 3300013307 | Ga0157372_10100529 | Ga0157372_101005294 | 303 |
| 74 | 3300031824 | Ga0307413_10207012 | Ga0307413_102070121 | 303 |
| 75 | 3300037312 | Ga0395899_0002686 | Ga0395899_0002686_12369_13484 | 303 |
| 76 | 3300037466 | Ga0395898_0005157 | Ga0395898_0005157_863_1972 | 303 |
| 77 | 3300005331 | Ga0070670_100003009 | Ga0070670_1000030097 | 305 |
| 78 | 3300005356 | Ga0070674_100030541 | Ga0070674_1000305412 | 305 |
| 79 | 3300005543 | Ga0070672_100008130 | Ga0070672_1000081303 | 305 |
| 80 | 3300005564 | Ga0070664_100096670 | Ga0070664_1000966702 | 305 |
| 81 | 3300005618 | Ga0068864_100038352 | Ga0068864_1000383523 | 305 |
| 82 | 3300025925 | Ga0207650_10016054 | Ga0207650_100160544 | 305 |
| 83 | 3300025940 | Ga0207691_10085439 | Ga0207691_100854392 | 305 |
| 84 | 3300025945 | Ga0207679_10030210 | Ga0207679_100302102 | 305 |
| 85 | 3300026121 | Ga0207683_10081688 | Ga0207683_100816883 | 305 |
| 86 | 3300037312 | Ga0395899_0047027 | Ga0395899_0047027_1517_2605 | 308 |
| 87 | 3300037418 | Ga0395900_0075932 | Ga0395900_0075932_162_1250 | 308 |
| 88 | 3300005366 | Ga0070659_100148757 | Ga0070659_1001487572 | 309 |
| 89 | 3300037418 | Ga0395900_0193267 | Ga0395900_0193267_664_1758 | 309 |
| 90 | 3300038443 | Ga0395901_0143840 | Ga0395901_0143840_641_1735 | 309 |
| 91 | 3300038443 | Ga0395901_0020056 | Ga0395901_0020056_4395_5474 | 310 |
| 92 | 3300005435 | Ga0070714_100107075 | Ga0070714_1001070752 | 312 |
| 93 | 3300005354 | Ga0070675_100044077 | Ga0070675_1000440773 | 313 |
| 94 | 3300005366 | Ga0070659_100043116 | Ga0070659_1000431162 | 313 |
| 95 | 3300005366 | Ga0070659_100054232 | Ga0070659_1000542324 | 313 |
| 96 | 3300005539 | Ga0068853_100029912 | Ga0068853_1000299123 | 313 |
| 97 | 3300005616 | Ga0068852_100040707 | Ga0068852_1000407074 | 313 |
| 98 | 3300005834 | Ga0068851_10017213 | Ga0068851_100172134 | 313 |
| 99 | 3300025909 | Ga0207705_10013569 | Ga0207705_100135692 | 313 |
| 100 | 3300025919 | Ga0207657_10014724 | Ga0207657_100147243 | 313 |
| 101 | 3300025920 | Ga0207649_10116203 | Ga0207649_101162032 | 313 |
| 102 | 3300025932 | Ga0207690_10009060 | Ga0207690_100090605 | 313 |
| 103 | 3300025945 | Ga0207679_10116533 | Ga0207679_101165332 | 313 |
| 104 | 3300026041 | Ga0207639_10140014 | Ga0207639_101400142 | 313 |
| 105 | 3300026067 | Ga0207678_10003033 | Ga0207678_100030339 | 313 |
| 106 | 3300005356 | Ga0070674_100174149 | Ga0070674_1001741492 | 314 |
| 107 | 3300005578 | Ga0068854_100060243 | Ga0068854_1000602432 | 314 |
| 108 | 3300005985 | Ga0081539_10012933 | Ga0081539_100129337 | 314 |
| 109 | 3300025933 | Ga0207706_10020614 | Ga0207706_100206145 | 314 |
| 110 | 3300005355 | Ga0070671_100002763 | Ga0070671_1000027637 | 318 |
| 111 | 3300013308 | Ga0157375_10063401 | Ga0157375_100634012 | 319 |
| 112 | 3300044684 | Ga0466966_0081205 | Ga0466966_0081205_519_1631 | 319 |
| 113 | 3300044694 | Ga0466963_0149837 | Ga0466963_0149837_490_1590 | 319 |
| 114 | 3300046691 | Ga0495670_0039331 | Ga0495670_0039331_1058_2167 | 319 |
| 115 | 3300061719 | Ga0466962_0109777 | Ga0466962_0109777_119_1231 | 319 |
| 116 | 3300005455 | Ga0070663_100017027 | Ga0070663_1000170274 | 321 |
| 117 | 3300005578 | Ga0068854_100002108 | Ga0068854_1000021085 | 321 |
| 118 | 3300006358 | Ga0068871_100141889 | Ga0068871_1001418892 | 321 |
| 119 | 3300009551 | Ga0105238_10197373 | Ga0105238_101973732 | 321 |
| 120 | 3300013296 | Ga0157374_10010960 | Ga0157374_100109606 | 321 |
| 121 | 3300013307 | Ga0157372_10198275 | Ga0157372_101982751 | 321 |
| 122 | 3300025981 | Ga0207640_10000261 | Ga0207640_1000026138 | 321 |
| 123 | 3300005331 | Ga0070670_100026687 | Ga0070670_1000266873 | 322 |
| 124 | 3300048920 | Ga0496117_0013556 | Ga0496117_0013556_4549_5589 | 322 |
| 125 | 3300005331 | Ga0070670_100333785 | Ga0070670_1003337851 | 323 |
| 126 | 3300005563 | Ga0068855_100000123 | Ga0068855_10000012316 | 323 |
| 127 | 3300025315 | Ga0207697_10008190 | Ga0207697_100081903 | 323 |
| 128 | 3300025925 | Ga0207650_10004781 | Ga0207650_100047817 | 323 |
| 129 | 3300025940 | Ga0207691_10101281 | Ga0207691_101012812 | 323 |
| 130 | 3300025945 | Ga0207679_10015121 | Ga0207679_100151215 | 323 |
| 131 | 3300025949 | Ga0207667_10000167 | Ga0207667_1000016716 | 323 |
| 132 | 3300026041 | Ga0207639_10121302 | Ga0207639_101213022 | 323 |
| 133 | 3300026067 | Ga0207678_10011670 | Ga0207678_100116703 | 323 |
| 134 | 3300042005 | Ga0439448_0004407 | Ga0439448_0004407_1479_2513 | 323 |
| 135 | 3300042012 | Ga0439455_0034575 | Ga0439455_0034575_147_1181 | 323 |
| 136 | 3300048915 | Ga0496112_0042408 | Ga0496112_0042408_2748_3833 | 323 |
| 137 | 3300005339 | Ga0070660_100000667 | Ga0070660_10000066716 | 324 |
| 138 | 3300005436 | Ga0070713_100229967 | Ga0070713_1002299672 | 324 |
| 139 | 3300025919 | Ga0207657_10002257 | Ga0207657_1000225716 | 324 |
| 140 | 3300025928 | Ga0207700_10177804 | Ga0207700_101778042 | 324 |
| 141 | 3300025949 | Ga0207667_10229810 | Ga0207667_102298101 | 324 |
| 142 | 3300005614 | Ga0068856_100059289 | Ga0068856_1000592893 | 326 |
| 143 | 3300025949 | Ga0207667_10289686 | Ga0207667_102896862 | 327 |
| 144 | 3300041462 | Ga0451806_256298 | Ga0451806_256298_878_1918 | 327 |
| 145 | 3300041486 | Ga0451807_0218438 | Ga0451807_0218438_528_1568 | 327 |
| 146 | 3300005617 | Ga0068859_100452611 | Ga0068859_1004526111 | 328 |
| 147 | 3300006931 | Ga0097620_100452645 | Ga0097620_1004526452 | 328 |
| 148 | 3300042157 | Ga0439458_0001189 | Ga0439458_0001189_3787_4884 | 328 |
| 149 | 3300005327 | Ga0070658_10002097 | Ga0070658_1000209715 | 329 |
| 150 | 3300005543 | Ga0070672_100054255 | Ga0070672_1000542553 | 329 |
| 151 | 3300005548 | Ga0070665_100055502 | Ga0070665_1000555023 | 329 |
| 152 | 3300005843 | Ga0068860_100023527 | Ga0068860_1000235272 | 329 |
| 153 | 3300009177 | Ga0105248_10093111 | Ga0105248_100931113 | 329 |
| 154 | 3300013306 | Ga0163162_10081079 | Ga0163162_100810792 | 329 |
| 155 | 3300014968 | Ga0157379_10040676 | Ga0157379_100406762 | 329 |
| 156 | 3300025909 | Ga0207705_10000066 | Ga0207705_1000006691 | 329 |
| 157 | 3300025941 | Ga0207711_10018615 | Ga0207711_100186155 | 329 |
| 158 | 3300025986 | Ga0207658_10009752 | Ga0207658_100097523 | 329 |
| 159 | 3300028381 | Ga0268264_10017507 | Ga0268264_100175075 | 329 |
| 160 | 3300001990 | JGI24737J22298_10011655 | JGI24737J22298_100116553 | 330 |
| 161 | 3300002077 | JGI24744J21845_10000080 | JGI24744J21845_100000805 | 330 |
| 162 | 3300003762 | Ga0055542_1002573 | Ga0055542_10025735 | 330 |
| 163 | 3300005354 | Ga0070675_100004619 | Ga0070675_1000046191 | 330 |
| 164 | 3300005355 | Ga0070671_100027641 | Ga0070671_1000276414 | 330 |
| 165 | 3300005356 | Ga0070674_100041991 | Ga0070674_1000419912 | 330 |
| 166 | 3300005366 | Ga0070659_100019051 | Ga0070659_1000190513 | 330 |
| 167 | 3300005456 | Ga0070678_100009430 | Ga0070678_1000094304 | 330 |
| 168 | 3300025254 | Ga0209148_1000114 | Ga0209148_100011417 | 330 |
| 169 | 3300025919 | Ga0207657_10010519 | Ga0207657_100105193 | 330 |
| 170 | 3300026041 | Ga0207639_10110639 | Ga0207639_101106392 | 330 |
| 171 | 3300026121 | Ga0207683_10053294 | Ga0207683_100532944 | 330 |
| 172 | 3300031852 | Ga0307410_10019820 | Ga0307410_100198203 | 330 |
| 173 | 3300031911 | Ga0307412_10139102 | Ga0307412_101391022 | 330 |
| 174 | 3300032002 | Ga0307416_100007191 | Ga0307416_1000071917 | 330 |
| 175 | 3300032005 | Ga0307411_10003682 | Ga0307411_100036828 | 330 |
| 176 | 3300032126 | Ga0307415_100005541 | Ga0307415_1000055412 | 330 |
| 177 | 3300037418 | Ga0395900_0318842 | Ga0395900_0318842_41_1132 | 330 |
| 178 | 3300038443 | Ga0395901_0053705 | Ga0395901_0053705_1942_3033 | 330 |
| 179 | 3300048910 | Ga0496107_0034100 | Ga0496107_0034100_843_1910 | 330 |
| 180 | 3300005344 | Ga0070661_100031145 | Ga0070661_1000311452 | 331 |
| 181 | 3300005366 | Ga0070659_100032506 | Ga0070659_1000325064 | 331 |
| 182 | 3300005458 | Ga0070681_10068138 | Ga0070681_100681381 | 331 |
| 183 | 3300005563 | Ga0068855_100009355 | Ga0068855_1000093553 | 331 |
| 184 | 3300005578 | Ga0068854_100085692 | Ga0068854_1000856922 | 331 |
| 185 | 3300025932 | Ga0207690_10012140 | Ga0207690_100121405 | 331 |
| 186 | 3300025945 | Ga0207679_10046658 | Ga0207679_100466582 | 331 |
| 187 | 3300025949 | Ga0207667_10065782 | Ga0207667_100657823 | 331 |
| 188 | 3300026078 | Ga0207702_10001769 | Ga0207702_100017693 | 331 |
| 189 | 3300048905 | Ga0496102_0301484 | Ga0496102_0301484_224_1324 | 331 |
| 190 | 3300048910 | Ga0496107_0090849 | Ga0496107_0090849_274_1374 | 331 |
| 191 | 3300048914 | Ga0496111_0019968 | Ga0496111_0019968_1923_3023 | 331 |
| 192 | 3300048915 | Ga0496112_0035621 | Ga0496112_0035621_2343_3443 | 331 |
| 193 | 3300048916 | Ga0496113_0042787 | Ga0496113_0042787_779_1879 | 331 |
| 194 | 3300005339 | Ga0070660_100346196 | Ga0070660_1003461961 | 332 |
| 195 | 3300005366 | Ga0070659_100002896 | Ga0070659_1000028967 | 332 |
| 196 | 3300005458 | Ga0070681_10002999 | Ga0070681_1000299911 | 332 |
| 197 | 3300005539 | Ga0068853_100025957 | Ga0068853_1000259572 | 332 |
| 198 | 3300009174 | Ga0105241_10259003 | Ga0105241_102590031 | 332 |
| 199 | 3300025912 | Ga0207707_10008798 | Ga0207707_100087984 | 332 |
| 200 | 3300025919 | Ga0207657_10010268 | Ga0207657_100102682 | 332 |
| 201 | 3300025921 | Ga0207652_10024070 | Ga0207652_100240702 | 332 |
| 202 | 3300037312 | Ga0395899_0058890 | Ga0395899_0058890_1662_2774 | 332 |
| 203 | 3300037466 | Ga0395898_0083534 | Ga0395898_0083534_1555_2667 | 332 |
| 204 | 3300037471 | Ga0395905_0004914 | Ga0395905_0004914_5823_6935 | 332 |
| 205 | 3300044694 | Ga0466963_0002345 | Ga0466963_0002345_5199_6389 | 332 |
| 206 | 3300046525 | Ga0495663_0020800 | Ga0495663_0020800_12_1124 | 332 |
| 207 | 3300046684 | Ga0495669_0011083 | Ga0495669_0011083_1946_3058 | 332 |
| 208 | 3300047445 | Ga0495677_0004952 | Ga0495677_0004952_3454_4566 | 332 |
| 209 | 3300001979 | JGI24740J21852_10026241 | JGI24740J21852_100262412 | 333 |
| 210 | 3300005328 | Ga0070676_10016633 | Ga0070676_100166333 | 333 |
| 211 | 3300005335 | Ga0070666_10234848 | Ga0070666_102348481 | 333 |
| 212 | 3300005458 | Ga0070681_10147940 | Ga0070681_101479402 | 333 |
| 213 | 3300005548 | Ga0070665_100021092 | Ga0070665_1000210923 | 333 |
| 214 | 3300005563 | Ga0068855_100177480 | Ga0068855_1001774802 | 333 |
| 215 | 3300005564 | Ga0070664_100089997 | Ga0070664_1000899972 | 333 |
| 216 | 3300005578 | Ga0068854_100132361 | Ga0068854_1001323612 | 333 |
| 217 | 3300005614 | Ga0068856_100184680 | Ga0068856_1001846802 | 333 |
| 218 | 3300005617 | Ga0068859_100330443 | Ga0068859_1003304432 | 333 |
| 219 | 3300005834 | Ga0068851_10021214 | Ga0068851_100212142 | 333 |
| 220 | 3300006931 | Ga0097620_100330429 | Ga0097620_1003304292 | 333 |
| 221 | 3300025907 | Ga0207645_10006658 | Ga0207645_100066583 | 333 |
| 222 | 3300025919 | Ga0207657_10014023 | Ga0207657_100140233 | 333 |
| 223 | 3300025920 | Ga0207649_10044821 | Ga0207649_100448212 | 333 |
| 224 | 3300025921 | Ga0207652_10240690 | Ga0207652_102406902 | 333 |
| 225 | 3300025931 | Ga0207644_10095980 | Ga0207644_100959802 | 333 |
| 226 | 3300025933 | Ga0207706_10015961 | Ga0207706_100159611 | 333 |
| 227 | 3300026067 | Ga0207678_10004788 | Ga0207678_100047887 | 333 |
| 228 | 3300026116 | Ga0207674_10116077 | Ga0207674_101160773 | 333 |
| 229 | 3300046684 | Ga0495669_0008463 | Ga0495669_0008463_2510_3595 | 333 |
| 230 | 3300005355 | Ga0070671_100009099 | Ga0070671_1000090997 | 334 |
| 231 | 3300005366 | Ga0070659_100060520 | Ga0070659_1000605202 | 334 |
| 232 | 3300005578 | Ga0068854_100007615 | Ga0068854_1000076155 | 334 |
| 233 | 3300005618 | Ga0068864_100029100 | Ga0068864_1000291004 | 334 |
| 234 | 3300005841 | Ga0068863_100012738 | Ga0068863_1000127386 | 334 |
| 235 | 3300009177 | Ga0105248_10003106 | Ga0105248_1000310616 | 334 |
| 236 | 3300025919 | Ga0207657_10156421 | Ga0207657_101564212 | 334 |
| 237 | 3300025931 | Ga0207644_10000227 | Ga0207644_100002274 | 334 |
| 238 | 3300025941 | Ga0207711_10006676 | Ga0207711_100066763 | 334 |
| 239 | 3300026088 | Ga0207641_10008285 | Ga0207641_100082856 | 334 |
| 240 | 3300026095 | Ga0207676_10011305 | Ga0207676_100113055 | 334 |
| 241 | 3300037471 | Ga0395905_0147142 | Ga0395905_0147142_308_1405 | 334 |
| 242 | 3300045976 | Ga0466967_0114563 | Ga0466967_0114563_452_1558 | 334 |
| 243 | 3300048912 | Ga0496109_0024385 | Ga0496109_0024385_3943_5034 | 334 |
| 244 | 3300048915 | Ga0496112_0028855 | Ga0496112_0028855_3069_4160 | 334 |
| 245 | 3300005327 | Ga0070658_10000405 | Ga0070658_1000040524 | 335 |
| 246 | 3300005339 | Ga0070660_100000194 | Ga0070660_10000019426 | 335 |
| 247 | 3300005344 | Ga0070661_100034536 | Ga0070661_1000345363 | 335 |
| 248 | 3300005563 | Ga0068855_100001534 | Ga0068855_10000153418 | 335 |
| 249 | 3300005578 | Ga0068854_100071991 | Ga0068854_1000719912 | 335 |
| 250 | 3300009174 | Ga0105241_10076090 | Ga0105241_100760903 | 335 |
| 251 | 3300013100 | Ga0157373_10061757 | Ga0157373_100617572 | 335 |
| 252 | 3300013102 | Ga0157371_10000915 | Ga0157371_1000091520 | 335 |
| 253 | 3300013102 | Ga0157371_10089143 | Ga0157371_100891432 | 335 |
| 254 | 3300013104 | Ga0157370_10105035 | Ga0157370_101050352 | 335 |
| 255 | 3300013307 | Ga0157372_10156506 | Ga0157372_101565062 | 335 |
| 256 | 3300025909 | Ga0207705_10000276 | Ga0207705_1000027624 | 335 |
| 257 | 3300025919 | Ga0207657_10000218 | Ga0207657_1000021847 | 335 |
| 258 | 3300025919 | Ga0207657_10012476 | Ga0207657_100124763 | 335 |
| 259 | 3300025949 | Ga0207667_10000122 | Ga0207667_1000012262 | 335 |
| 260 | 3300025949 | Ga0207667_10040320 | Ga0207667_100403204 | 335 |
| 261 | 3300026067 | Ga0207678_10013626 | Ga0207678_100136262 | 335 |
| 262 | 3300026142 | Ga0207698_10040197 | Ga0207698_100401972 | 335 |
| 263 | 3300032126 | Ga0307415_100015728 | Ga0307415_1000157282 | 335 |
| 264 | 3300046681 | Ga0495647_0050109 | Ga0495647_0050109_418_1506 | 335 |
| 265 | 3300005339 | Ga0070660_100136021 | Ga0070660_1001360212 | 336 |
| 266 | 3300005455 | Ga0070663_100004950 | Ga0070663_1000049508 | 336 |
| 267 | 3300025920 | Ga0207649_10086592 | Ga0207649_100865922 | 336 |
| 268 | 3300026067 | Ga0207678_10018090 | Ga0207678_100180903 | 336 |
| 269 | 3300032005 | Ga0307411_10064825 | Ga0307411_100648252 | 336 |
| 270 | 3300037466 | Ga0395898_0065806 | Ga0395898_0065806_552_1655 | 336 |
| 271 | 3300044694 | Ga0466963_0034674 | Ga0466963_0034674_1236_2348 | 336 |
| 272 | 3300045976 | Ga0466967_0075095 | Ga0466967_0075095_1852_2946 | 336 |
| 273 | 3300049586 | Ga0501070_0085426 | Ga0501070_0085426_543_1646 | 336 |
| 274 | 3300037312 | Ga0395899_0004002 | Ga0395899_0004002_1852_2937 | 337 |
| 275 | 3300037418 | Ga0395900_0035960 | Ga0395900_0035960_480_1565 | 337 |
| 276 | 3300037471 | Ga0395905_0010843 | Ga0395905_0010843_897_1982 | 337 |
| 277 | 3300038443 | Ga0395901_0168103 | Ga0395901_0168103_1168_2253 | 337 |
| 278 | 3300044694 | Ga0466963_0119691 | Ga0466963_0119691_384_1481 | 337 |
| 279 | 3300005985 | Ga0081539_10016021 | Ga0081539_100160214 | 338 |
| 280 | 3300039437 | Ga0436365_0731157 | Ga0436365_0731157_951_2060 | 338 |
| 281 | 3300005344 | Ga0070661_100035957 | Ga0070661_1000359573 | 339 |
| 282 | 3300005364 | Ga0070673_100381447 | Ga0070673_1003814471 | 339 |
| 283 | 3300005366 | Ga0070659_100012707 | Ga0070659_1000127072 | 339 |
| 284 | 3300005564 | Ga0070664_100184371 | Ga0070664_1001843711 | 339 |
| 285 | 3300025919 | Ga0207657_10022785 | Ga0207657_100227854 | 339 |
| 286 | 3300025932 | Ga0207690_10021836 | Ga0207690_100218362 | 339 |
| 287 | 3300025945 | Ga0207679_10020775 | Ga0207679_100207752 | 339 |
| 288 | 3300037418 | Ga0395900_0080272 | Ga0395900_0080272_742_1833 | 339 |
| 289 | 3300005327 | Ga0070658_10103225 | Ga0070658_101032252 | 341 |
| 290 | 3300005329 | Ga0070683_100172093 | Ga0070683_1001720932 | 341 |
| 291 | 3300005564 | Ga0070664_100004931 | Ga0070664_1000049315 | 341 |
| 292 | 3300005578 | Ga0068854_100043832 | Ga0068854_1000438323 | 341 |
| 293 | 3300005616 | Ga0068852_100068555 | Ga0068852_1000685554 | 341 |
| 294 | 3300009093 | Ga0105240_10087202 | Ga0105240_100872023 | 341 |
| 295 | 3300013100 | Ga0157373_10027432 | Ga0157373_100274323 | 341 |
| 296 | 3300013100 | Ga0157373_10237810 | Ga0157373_102378102 | 341 |
| 297 | 3300013104 | Ga0157370_10137829 | Ga0157370_101378292 | 341 |
| 298 | 3300013307 | Ga0157372_10582142 | Ga0157372_105821422 | 341 |
| 299 | 3300025909 | Ga0207705_10118649 | Ga0207705_101186492 | 341 |
| 300 | 3300025913 | Ga0207695_10066590 | Ga0207695_100665903 | 341 |
| 301 | 3300025929 | Ga0207664_10022937 | Ga0207664_100229372 | 341 |
| 302 | 3300025945 | Ga0207679_10006758 | Ga0207679_100067582 | 341 |
| 303 | 3300025949 | Ga0207667_10040278 | Ga0207667_100402784 | 341 |
| 304 | 3300037312 | Ga0395899_0117716 | Ga0395899_0117716_392_1486 | 341 |
| 305 | 3300037418 | Ga0395900_0067319 | Ga0395900_0067319_876_1970 | 341 |
| 306 | 3300037418 | Ga0395900_0331613 | Ga0395900_0331613_334_1428 | 341 |
| 307 | 3300037471 | Ga0395905_0020890 | Ga0395905_0020890_2455_3549 | 341 |
| 308 | 3300038443 | Ga0395901_0134776 | Ga0395901_0134776_1396_2532 | 341 |
| 309 | 3300001979 | JGI24740J21852_10001017 | JGI24740J21852_100010179 | 343 |
| 310 | 3300002067 | JGI24735J21928_10007606 | JGI24735J21928_100076063 | 343 |
| 311 | 3300005327 | Ga0070658_10033134 | Ga0070658_100331342 | 343 |
| 312 | 3300005336 | Ga0070680_100003473 | Ga0070680_1000034739 | 343 |
| 313 | 3300005337 | Ga0070682_100015332 | Ga0070682_1000153324 | 343 |
| 314 | 3300005339 | Ga0070660_100073001 | Ga0070660_1000730013 | 343 |
| 315 | 3300005341 | Ga0070691_10003475 | Ga0070691_100034753 | 343 |
| 316 | 3300005344 | Ga0070661_100010542 | Ga0070661_1000105424 | 343 |
| 317 | 3300005366 | Ga0070659_100091284 | Ga0070659_1000912842 | 343 |
| 318 | 3300005535 | Ga0070684_100002773 | Ga0070684_1000027733 | 343 |
| 319 | 3300005564 | Ga0070664_100028495 | Ga0070664_1000284953 | 343 |
| 320 | 3300005577 | Ga0068857_100005015 | Ga0068857_10000501511 | 343 |
| 321 | 3300005578 | Ga0068854_100006275 | Ga0068854_1000062754 | 343 |
| 322 | 3300009093 | Ga0105240_10041442 | Ga0105240_100414423 | 343 |
| 323 | 3300009174 | Ga0105241_10056329 | Ga0105241_100563293 | 343 |
| 324 | 3300009545 | Ga0105237_10027881 | Ga0105237_100278814 | 343 |
| 325 | 3300009551 | Ga0105238_10003788 | Ga0105238_100037883 | 343 |
| 326 | 3300013104 | Ga0157370_10039439 | Ga0157370_100394394 | 343 |
| 327 | 3300013307 | Ga0157372_10012937 | Ga0157372_100129376 | 343 |
| 328 | 3300025904 | Ga0207647_10002240 | Ga0207647_1000224013 | 343 |
| 329 | 3300025909 | Ga0207705_10018723 | Ga0207705_100187233 | 343 |
| 330 | 3300025911 | Ga0207654_10136092 | Ga0207654_101360922 | 343 |
| 331 | 3300025913 | Ga0207695_10018238 | Ga0207695_100182384 | 343 |
| 332 | 3300025919 | Ga0207657_10005932 | Ga0207657_100059326 | 343 |
| 333 | 3300025920 | Ga0207649_10003573 | Ga0207649_100035736 | 343 |
| 334 | 3300025924 | Ga0207694_10010800 | Ga0207694_100108003 | 343 |
| 335 | 3300025932 | Ga0207690_10005020 | Ga0207690_100050205 | 343 |
| 336 | 3300025944 | Ga0207661_10018837 | Ga0207661_100188374 | 343 |
| 337 | 3300025945 | Ga0207679_10010296 | Ga0207679_100102963 | 343 |
| 338 | 3300025949 | Ga0207667_10018604 | Ga0207667_100186044 | 343 |
| 339 | 3300025981 | Ga0207640_10006954 | Ga0207640_100069543 | 343 |
| 340 | 3300026041 | Ga0207639_10004480 | Ga0207639_100044805 | 343 |
| 341 | 3300026078 | Ga0207702_10006113 | Ga0207702_100061136 | 343 |
| 342 | 3300026116 | Ga0207674_10002506 | Ga0207674_1000250612 | 343 |
| 343 | 3300026142 | Ga0207698_10008550 | Ga0207698_100085504 | 343 |
| 344 | 3300037312 | Ga0395899_0032447 | Ga0395899_0032447_2376_3476 | 343 |
| 345 | 3300037418 | Ga0395900_0123843 | Ga0395900_0123843_1460_2560 | 343 |
| 346 | 3300038443 | Ga0395901_0428452 | Ga0395901_0428452_151_1251 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar