F416543

General Info

Members Datasets Scaffolds Average Seq Length
345 238 690 306

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0059339|Ga0501032_0059339_588_1784
Length 363
Sequence MIEAHGLTKRFGQRVAVDNLSFQIRPGKVTGFLGPNGAGKSTTIRMIMGLDSPTSGSVTVGGRAVRSMPLPMLQVGALLDARQVHPGRNGYNHLLVLAQANKLPKRRVTEVLEMVGLTSVAKQRVGKYSLGMQQRLGIAAAMLGSPGVLIFDEPANGLDPEGVRWIRELMRALAREGRTVFVSSHLMSEMAQTADDLIVIGMGRLIAHTTVEDFVARNAANFIRVRTPRGEELAKALSEAGGKVEPRQETNLLHVTNLPIERVGEIAAQENIALHELVRQTGSLEEAYMRMTGSAVEYRTAPGNPAGFALPGAPNQFGGQQQFQQAPYPQQAPQGPGPQYQVTQVVRPPASASDNASQDQGEA

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
83 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
84 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
215 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
216 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
217 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
218 2643221670 Streptomyces sp. Root431 Isolate Unclassified
219 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
220 2643221714 Streptomyces sp. Root264 Isolate Unclassified
221 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
222 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
223 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
224 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
225 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
226 2862574272 Streptomyces sp. AcE210 Isolate Nodule
227 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
228 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
229 2891562705 Microbispora tritici MT50 Isolate Unclassified
230 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
231 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
232 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
233 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
234 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
235 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
236 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
237 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
238 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.17
Metatranscriptomes 0.29
Isolates 7.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0.29
Rhizoplane 2.32
Rhizosphere 86.09
Stem 0
Stem Tuber 0.29
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0059339 3300049569 Bacteria 2568
2 JGI24739J22299_10029435 3300001989 Bacteria 1909
3 JGI24737J22298_10011103 3300001990 Bacteria 2957
4 JGI24735J21928_10023173 3300002067 Bacteria 1885
5 Ga0070690_100152466 3300005330 Bacteria 1578
6 Ga0068869_100146065 3300005334 Bacteria 1830
7 Ga0070666_10034419 3300005335 Bacteria 3357
8 Ga0070668_100076252 3300005347 Bacteria 2619
9 Ga0070709_10020317 3300005434 Bacteria 3851
10 Ga0070713_100301949 3300005436 Bacteria 1474
11 Ga0070710_10000186 3300005437 Bacteria 28871
12 Ga0070708_100021096 3300005445 Bacteria 5502
13 Ga0070662_100308361 3300005457 Bacteria 1288
14 Ga0070706_100279061 3300005467 Bacteria 1559
15 Ga0068853_100019275 3300005539 Bacteria 5655
16 Ga0068853_100126503 3300005539 Bacteria 2283
17 Ga0068853_100182013 3300005539 Bacteria 1906
18 Ga0070686_100217563 3300005544 Bacteria 1379
19 Ga0070695_100309958 3300005545 Bacteria 1170
20 Ga0070665_100021903 3300005548 Bacteria 6427
21 Ga0070665_100052801 3300005548 Bacteria 4076
22 Ga0068855_100006514 3300005563 Bacteria 14196
23 Ga0068855_100024398 3300005563 Bacteria 7234
24 Ga0068855_100382716 3300005563 Bacteria 1544
25 Ga0068857_100137801 3300005577 Bacteria 2204
26 Ga0068854_100005744 3300005578 Bacteria 7848
27 Ga0068854_100021121 3300005578 Bacteria 4415
28 Ga0068854_100073305 3300005578 Bacteria 2509
29 Ga0068854_100284331 3300005578 Bacteria 1333
30 Ga0068856_100055463 3300005614 Bacteria 3911
31 Ga0068852_100051564 3300005616 Bacteria 3532
32 Ga0068852_100173626 3300005616 Bacteria 2022
33 Ga0068864_100701803 3300005618 Bacteria 988
34 Ga0068851_10132523 3300005834 Bacteria 1349
35 Ga0068858_100335900 3300005842 Bacteria 1445
36 Ga0068860_100007293 3300005843 Bacteria 11058
37 Ga0081455_10000300 3300005937 Bacteria 65485
38 Ga0070717_10350504 3300006028 Bacteria 1320
39 Ga0070715_10007115 3300006163 Bacteria 3839
40 Ga0075367_10193263 3300006178 Bacteria 1270
41 Ga0075428_100005200 3300006844 Bacteria 14458
42 Ga0075428_100230105 3300006844 Bacteria 2000
43 Ga0075430_100002978 3300006846 Bacteria 14175
44 Ga0075431_100011223 3300006847 Bacteria 9023
45 Ga0075429_100059855 3300006880 Bacteria 3318
46 Ga0105240_10060717 3300009093 Bacteria 4712
47 Ga0105240_10067901 3300009093 Bacteria 4418
48 Ga0105240_10076479 3300009093 Bacteria 4126
49 Ga0114129_10008380 3300009147 Bacteria 14730
50 Ga0114129_10517600 3300009147 Bacteria 1556
51 Ga0105243_10171111 3300009148 Bacteria 1881
52 Ga0105241_10002988 3300009174 Bacteria 12627
53 Ga0105248_10132727 3300009177 Bacteria 2809
54 Ga0105237_10031972 3300009545 Bacteria 5329
55 Ga0105238_10051596 3300009551 Bacteria 4137
56 Ga0105238_10288134 3300009551 Bacteria 1624
57 Ga0105239_10056206 3300010375 Bacteria 4317
58 Ga0105239_10180333 3300010375 Bacteria 2363
59 Ga0157374_10115558 3300013296 Bacteria 2585
60 Ga0157372_10208075 3300013307 Bacteria 2267
61 Ga0157375_10223047 3300013308 Bacteria 2044
62 Ga0163163_10374054 3300014325 Bacteria 1482
63 Ga0157380_10678117 3300014326 Bacteria 1032
64 Ga0163161_10109236 3300017792 Bacteria 2066
65 Ga0213874_10009765 3300021377 Bacteria 2384
66 Ga0224712_10029738 3300022467 Bacteria 1965
67 Ga0207692_10000077 3300025898 Bacteria 28193
68 Ga0207647_10001288 3300025904 Bacteria 19277
69 Ga0207699_10016263 3300025906 Bacteria 3886
70 Ga0207654_10018275 3300025911 Bacteria 3676
71 Ga0207654_10253931 3300025911 Bacteria 1180
72 Ga0207695_10001477 3300025913 Bacteria 39315
73 Ga0207695_10002634 3300025913 Bacteria 26254
74 Ga0207671_10000313 3300025914 Bacteria 71480
75 Ga0207671_10000445 3300025914 Bacteria 57046
76 Ga0207662_10006185 3300025918 Bacteria 6444
77 Ga0207657_10005312 3300025919 Bacteria 13498
78 Ga0207657_10152779 3300025919 Bacteria 1879
79 Ga0207652_10523895 3300025921 Bacteria 1066
80 Ga0207681_10354769 3300025923 Bacteria 1175
81 Ga0207694_10002394 3300025924 Bacteria 15342
82 Ga0207694_10009205 3300025924 Bacteria 7453
83 Ga0207664_10236242 3300025929 Bacteria 1590
84 Ga0207691_10161573 3300025940 Bacteria 1965
85 Ga0207689_10040620 3300025942 Bacteria 3850
86 Ga0207667_10035587 3300025949 Bacteria 5341
87 Ga0207667_10226209 3300025949 Bacteria 1916
88 Ga0207712_10054303 3300025961 Bacteria 2814
89 Ga0207640_10021451 3300025981 Bacteria 3850
90 Ga0207640_10279140 3300025981 Bacteria 1311
91 Ga0207639_10095470 3300026041 Bacteria 2390
92 Ga0207678_10008595 3300026067 Bacteria 8996
93 Ga0207678_10124902 3300026067 Bacteria 2195
94 Ga0207708_10155446 3300026075 Bacteria 1803
95 Ga0207702_10150549 3300026078 Bacteria 2116
96 Ga0207641_10098411 3300026088 Bacteria 2572
97 Ga0207674_10050685 3300026116 Bacteria 4240
98 Ga0207674_10052471 3300026116 Bacteria 4159
99 Ga0207675_100016427 3300026118 Bacteria 6913
100 Ga0207683_10013047 3300026121 Bacteria 7091
101 Ga0207698_10150744 3300026142 Bacteria 2018
102 Ga0268266_10188714 3300028379 Bacteria 1881
103 Ga0268264_10008132 3300028381 Bacteria 8719
104 Ga0268264_10204613 3300028381 Bacteria 1808
105 Ga0307517_10002481 3300028786 Bacteria 29521
106 Ga0307512_10021056 3300030522 Bacteria 5887
107 Ga0316176_1024044 3300030732 Bacteria 7998
108 Ga0314311_1010646 3300030733 Bacteria 5332
109 Ga0316178_1154593 3300030735 Bacteria 1794
110 Ga0265325_10021641 3300031241 Bacteria 3530
111 Ga0307509_10090327 3300031507 Bacteria 3139
112 Ga0307408_100252368 3300031548 Bacteria 1456
113 Ga0316576_10115154 3300031727 Bacteria 2017
114 Ga0307405_10098499 3300031731 Bacteria 1955
115 Ga0307407_10245104 3300031903 Bacteria 1225
116 Ga0307409_100012252 3300031995 Bacteria 5455
117 Ga0307409_100015641 3300031995 Bacteria 4987
118 Ga0307409_100131940 3300031995 Bacteria 2137
119 Ga0307409_100271749 3300031995 Bacteria 1561
120 Ga0307416_100003241 3300032002 Bacteria 9539
121 Ga0307416_100072809 3300032002 Bacteria 2862
122 Ga0307416_100105035 3300032002 Bacteria 2471
123 Ga0307415_100040999 3300032126 Bacteria 3071
124 Ga0307507_10012554 3300033179 Bacteria 10448
125 Ga0307507_10026578 3300033179 Bacteria 6232
126 Ga0373926_0003844 3300035083 Bacteria 4902
127 Ga0373934_0006901 3300035086 Bacteria 4214
128 Ga0373944_0017200 3300035089 Bacteria 2049
129 Ga0373936_0001868 3300035113 Bacteria 7770
130 Ga0373945_0005891 3300035116 Bacteria 3934
131 Ga0373956_0000715 3300035119 Bacteria 13663
132 Ga0373943_0184363 3300035170 Bacteria 1148
133 Ga0373946_0010588 3300035171 Bacteria 3417
134 Ga0373955_0009197 3300035172 Bacteria 4621
135 Ga0373931_0070814 3300035691 Bacteria 1903
136 Ga0373935_0118370 3300035692 Bacteria 1766
137 Ga0373935_0277547 3300035692 Bacteria 1179
138 Ga0373927_0342110 3300035695 Bacteria 985
139 Ga0373933_0071329 3300035724 Bacteria 2114
140 Ga0373947_0031836 3300035725 Bacteria 3106
141 Ga0316582_0083014 3300036647 Bacteria 2096
142 Ga0316584_0017786 3300036712 Bacteria 5118
143 Ga0316584_0306684 3300036712 Bacteria 1148
144 Ga0373925_0008760 3300037068 Bacteria 7369
145 Ga0436364_0904395 3300037853 Bacteria 8301
146 Ga0436363_0792560 3300039450 Bacteria 3730
147 Ga0439442_009663 3300042002 Bacteria 1950
148 Ga0466969_0033220 3300044656 Bacteria 2621
149 Ga0466972_0018720 3300044658 Bacteria 3462
150 Ga0466965_0021835 3300044683 Bacteria 3084
151 Ga0466966_0002786 3300044684 Bacteria 11489
152 Ga0466966_0029220 3300044684 Bacteria 3588
153 Ga0466966_0071390 3300044684 Bacteria 2175
154 Ga0466961_0009340 3300044693 Bacteria 6247
155 Ga0466961_0019350 3300044693 Bacteria 4380
156 Ga0466961_0028006 3300044693 Bacteria 3624
157 Ga0466970_0002617 3300044765 Bacteria 8682
158 Ga0466970_0034174 3300044765 Bacteria 2690
159 Ga0466960_0164458 3300044901 Bacteria 1193
160 Ga0466959_0003285 3300045049 Bacteria 10543
161 Ga0466959_0032631 3300045049 Bacteria 3854
162 Ga0466959_0074684 3300045049 Bacteria 2451
163 Ga0466958_0020229 3300045836 Bacteria 3881
164 Ga0495592_0015715 3300046454 Bacteria 5742
165 Ga0495603_0036419 3300046455 Bacteria 2954
166 Ga0495641_0009441 3300046461 Bacteria 5792
167 Ga0495651_0010235 3300046462 Bacteria 7199
168 Ga0495651_0010299 3300046462 Bacteria 7184
169 Ga0495651_0011764 3300046462 Bacteria 6724
170 Ga0495651_0012952 3300046462 Bacteria 6445
171 Ga0495651_0019681 3300046462 Bacteria 5232
172 Ga0495651_0037001 3300046462 Bacteria 3799
173 Ga0495651_0045918 3300046462 Bacteria 3382
174 Ga0495651_0055453 3300046462 Bacteria 3045
175 Ga0495653_0084343 3300046463 Bacteria 2340
176 Ga0495653_0134999 3300046463 Bacteria 1742
177 Ga0495580_0061720 3300046472 Bacteria 2631
178 Ga0495582_0019732 3300046473 Bacteria 3686
179 Ga0495639_0010645 3300046475 Bacteria 3959
180 Ga0495662_0000974 3300046476 Bacteria 14012
181 Ga0495662_0010101 3300046476 Bacteria 4629
182 Ga0495662_0049116 3300046476 Bacteria 2037
183 Ga0495664_0013046 3300046477 Bacteria 4711
184 Ga0495585_0038800 3300046492 Bacteria 2680
185 Ga0495585_0080115 3300046492 Bacteria 1770
186 Ga0495594_0071676 3300046499 Bacteria 1927
187 Ga0495608_0021008 3300046511 Bacteria 4484
188 Ga0495618_0024385 3300046514 Bacteria 3745
189 Ga0495628_0017686 3300046516 Bacteria 5926
190 Ga0495628_0019325 3300046516 Bacteria 5633
191 Ga0495628_0080090 3300046516 Bacteria 2539
192 Ga0495630_0014328 3300046517 Bacteria 5774
193 Ga0495630_0092966 3300046517 Bacteria 2279
194 Ga0495630_0111333 3300046517 Bacteria 2073
195 Ga0495630_0119741 3300046517 Bacteria 1997
196 Ga0495643_0086574 3300046522 Bacteria 1623
197 Ga0495666_0004878 3300046526 Bacteria 6783
198 Ga0495666_0006570 3300046526 Bacteria 5850
199 Ga0495652_0005818 3300046529 Bacteria 11537
200 Ga0495652_0015743 3300046529 Bacteria 6768
201 Ga0495652_0017945 3300046529 Bacteria 6313
202 Ga0495652_0033284 3300046529 Bacteria 4501
203 Ga0495652_0185138 3300046529 Bacteria 1594
204 Ga0495665_0001893 3300046531 Bacteria 11285
205 Ga0495665_0019180 3300046531 Bacteria 3676
206 Ga0495640_0014439 3300046533 Bacteria 5977
207 Ga0495640_0015172 3300046533 Bacteria 5802
208 Ga0495640_0143560 3300046533 Bacteria 1537
209 Ga0495586_0007798 3300046535 Bacteria 5708
210 Ga0495587_0016608 3300046536 Bacteria 4578
211 Ga0495587_0069855 3300046536 Bacteria 2044
212 Ga0495645_0093267 3300046543 Bacteria 2149
213 Ga0495645_0096497 3300046543 Bacteria 2106
214 Ga0495645_0108550 3300046543 Bacteria 1965
215 Ga0495645_0247749 3300046543 Bacteria 1185
216 Ga0495622_0032502 3300046557 Bacteria 2436
217 Ga0495667_0025171 3300046559 Bacteria 4012
218 Ga0495667_0044707 3300046559 Bacteria 2932
219 Ga0495667_0154945 3300046559 Bacteria 1474
220 Ga0495634_0030879 3300046642 Bacteria 3694
221 Ga0495634_0121101 3300046642 Bacteria 1675
222 Ga0495611_0032681 3300046648 Bacteria 2294
223 Ga0495611_0056443 3300046648 Bacteria 1778
224 Ga0495625_0088922 3300046660 Bacteria 2139
225 Ga0495635_0028590 3300046663 Bacteria 3875
226 Ga0495635_0083164 3300046663 Bacteria 2190
227 Ga0495588_0080475 3300046674 Bacteria 1700
228 Ga0495657_0004345 3300046675 Bacteria 11319
229 Ga0495657_0027608 3300046675 Bacteria 4003
230 Ga0495657_0045007 3300046675 Bacteria 2997
231 Ga0495657_0380526 3300046675 Bacteria 832
232 Ga0495599_0015697 3300046678 Bacteria 4700
233 Ga0495599_0028205 3300046678 Bacteria 3518
234 Ga0495599_0092653 3300046678 Bacteria 1885
235 Ga0495623_0022841 3300046679 Bacteria 4038
236 Ga0495646_0010124 3300046680 Bacteria 5993
237 Ga0495646_0209386 3300046680 Bacteria 1058
238 Ga0495646_0234643 3300046680 Bacteria 987
239 Ga0495613_0009359 3300046689 Bacteria 7268
240 Ga0495624_0072429 3300046690 Bacteria 2143
241 Ga0495589_0005667 3300046794 Bacteria 6584
242 Ga0495589_0011549 3300046794 Bacteria 4585
243 Ga0495600_0001405 3300046809 Bacteria 13294
244 Ga0495600_0024739 3300046809 Bacteria 3866
245 Ga0495600_0095482 3300046809 Bacteria 1938
246 Ga0495581_0016190 3300047315 Bacteria 4335
247 Ga0495581_0016599 3300047315 Bacteria 4279
248 Ga0495604_0005115 3300047317 Bacteria 10383
249 Ga0495604_0035946 3300047317 Bacteria 3907
250 Ga0495604_0063110 3300047317 Bacteria 2827
251 Ga0495604_0410365 3300047317 Bacteria 890
252 Ga0495674_0044859 3300047319 Bacteria 3928
253 Ga0495674_0336966 3300047319 Bacteria 1226
254 Ga0495674_0349960 3300047319 Bacteria 1199
255 Ga0495676_0032164 3300047321 Bacteria 4431
256 Ga0495676_0048519 3300047321 Bacteria 3422
257 Ga0495680_0040012 3300047322 Bacteria 3736
258 Ga0495680_0235066 3300047322 Bacteria 1303
259 Ga0495675_0024150 3300047444 Bacteria 3875
260 Ga0495685_004827 3300047447 Bacteria 4376
261 Ga0495684_0023399 3300047471 Bacteria 4749
262 Ga0495684_0034509 3300047471 Bacteria 3881
263 Ga0495684_0064790 3300047471 Bacteria 2777
264 Ga0495684_0073017 3300047471 Bacteria 2606
265 Ga0495686_0036845 3300047472 Bacteria 3138
266 Ga0495593_0015642 3300047673 Bacteria 4293
267 Ga0495593_0049177 3300047673 Bacteria 2238
268 Ga0495602_0077008 3300048088 Bacteria 2823
269 Ga0495602_0284998 3300048088 Bacteria 1215
270 Ga0495602_0321100 3300048088 Bacteria 1126
271 Ga0495614_0006775 3300048089 Bacteria 5126
272 Ga0496101_0257458 3300048904 Bacteria 1360
273 Ga0496104_0294743 3300048907 Bacteria 1535
274 Ga0496107_0174310 3300048910 Bacteria 1596
275 Ga0496109_0258695 3300048912 Bacteria 1639
276 Ga0496110_0294531 3300048913 Bacteria 1478
277 Ga0496112_0008151 3300048915 Bacteria 9362
278 Ga0496112_0256074 3300048915 Bacteria 1700
279 Ga0496114_0126303 3300048917 Bacteria 2205
280 Ga0496119_0021514 3300048922 Bacteria 4659
281 Ga0496122_0001293 3300048925 Bacteria 41500
282 Ga0496122_0003688 3300048925 Bacteria 19851
283 Ga0496123_0000142 3300048926 Bacteria 146932
284 Ga0496124_0000461 3300048927 Bacteria 70566
285 Ga0496125_0002969 3300048928 Bacteria 21324
286 Ga0496126_0009863 3300048929 Bacteria 10105
287 Ga0496126_0194331 3300048929 Bacteria 1717
288 Ga0501036_0036967 3300049572 Bacteria 4131
289 Ga0501036_0220833 3300049572 Bacteria 1591
290 Ga0501038_0003900 3300049574 Bacteria 13869
291 Ga0501038_0433702 3300049574 Bacteria 1012
292 Ga0501040_0036345 3300049576 Bacteria 3342
293 Ga0501041_0013686 3300049577 Bacteria 4813
294 Ga0501042_0028353 3300049578 Bacteria 3944
295 Ga0501047_0005537 3300049581 Bacteria 11884
296 Ga0501047_0025328 3300049581 Bacteria 5702
297 Ga0501048_0027913 3300049582 Bacteria 4099
298 Ga0501071_0025824 3300049587 Bacteria 4117
299 Ga0501074_0079962 3300049590 Bacteria 2346
300 Ga0501075_0028803 3300049591 Bacteria 4102
301 Ga0501076_0031148 3300049592 Bacteria 4158
302 Ga0501076_0116759 3300049592 Bacteria 2160
303 Ga0501077_0055459 3300049593 Bacteria 2516
304 Ga0501045_0027470 3300049824 Bacteria 4101
305 nmdc:mga05p37_48417_c1 3300050507 Bacteria 5228
306 nmdc:mga09592_125017_c1 3300050508 Bacteria 2211
307 nmdc:mga0qj67_20254_c1 3300050509 Bacteria 5091
308 nmdc:mga06r32_4564_c1 3300050510 Bacteria 12411
309 Ga0495601_0003174 3300053077 Bacteria 9411
310 Ga0495601_0169790 3300053077 Bacteria 1426
311 Ga0495612_0004767 3300053078 Bacteria 5612
312 Ga0495595_0033055 3300053084 Bacteria 2332
313 Ga0495619_0009862 3300053085 Bacteria 6021
314 Ga0500644_0039785 3300053088 Bacteria 1552
315 Ga0500568_0000047 3300053139 Bacteria 120511
316 Ga0500573_0006567 3300053140 Bacteria 6309
317 Ga0500573_0077083 3300053140 Bacteria 1897
318 Ga0500616_0068168 3300053153 Bacteria 1823
319 Ga0530510_0201977 3300061734 Bacteria 1476
320 2516086326 2515154202 Bacteria 5471270
321 2643942382 2643221587 Bacteria 7586415
322 2644016052 2643221601 Bacteria 7493239
323 2644176693 2643221631 Bacteria 8168043
324 2644390009 2643221670 Bacteria 6497041
325 2644429463 2643221677 Bacteria 7584031
326 2644631081 2643221714 Bacteria 9015452
327 2768646860 2767802112 Bacteria 6465194
328 2791911344 2791354901 Bacteria 8322202
329 2816422834 2816332119 Bacteria 8120218
330 2819745734 2818991472 Bacteria 10089953
331 2856742736 2856741275 Bacteria 8096094
332 2862583462 2862574272 Bacteria 10567477
333 2891404237 2891395885 Bacteria 9251614
334 2891559074 2891554331 Bacteria 8812224
335 2891564987 2891562705 Bacteria 8039471
336 2899359897 2899359706 Bacteria 10940472
337 2899377031 2899370129 Bacteria 6781179
338 2939658621 2939657138 Bacteria 3740283
339 2946079885 2946072368 Bacteria 8999607
340 8008486779 8008485437 Bacteria 7198341
341 8025525931 8025524527 Bacteria 7197316
342 8025531432 8025530807 Bacteria 8495698
343 8025537370 8025530807 Bacteria 8495698
344 8047711947 8047710418 Bacteria 11023148
345 8056454178 8056447290 Bacteria 7680491
346 Ga0501032_0059339
347 JGI24739J22299_10029435
348 JGI24737J22298_10011103
349 JGI24735J21928_10023173
350 Ga0070690_100152466
351 Ga0068869_100146065
352 Ga0070666_10034419
353 Ga0070668_100076252
354 Ga0070709_10020317
355 Ga0070713_100301949
356 Ga0070710_10000186
357 Ga0070708_100021096
358 Ga0070662_100308361
359 Ga0070706_100279061
360 Ga0068853_100019275
361 Ga0068853_100126503
362 Ga0068853_100182013
363 Ga0070686_100217563
364 Ga0070695_100309958
365 Ga0070665_100021903
366 Ga0070665_100052801
367 Ga0068855_100006514
368 Ga0068855_100024398
369 Ga0068855_100382716
370 Ga0068857_100137801
371 Ga0068854_100005744
372 Ga0068854_100021121
373 Ga0068854_100073305
374 Ga0068854_100284331
375 Ga0068856_100055463
376 Ga0068852_100051564
377 Ga0068852_100173626
378 Ga0068864_100701803
379 Ga0068851_10132523
380 Ga0068858_100335900
381 Ga0068860_100007293
382 Ga0081455_10000300
383 Ga0070717_10350504
384 Ga0070715_10007115
385 Ga0075367_10193263
386 Ga0075428_100005200
387 Ga0075428_100230105
388 Ga0075430_100002978
389 Ga0075431_100011223
390 Ga0075429_100059855
391 Ga0105240_10060717
392 Ga0105240_10067901
393 Ga0105240_10076479
394 Ga0114129_10008380
395 Ga0114129_10517600
396 Ga0105243_10171111
397 Ga0105241_10002988
398 Ga0105248_10132727
399 Ga0105237_10031972
400 Ga0105238_10051596
401 Ga0105238_10288134
402 Ga0105239_10056206
403 Ga0105239_10180333
404 Ga0157374_10115558
405 Ga0157372_10208075
406 Ga0157375_10223047
407 Ga0163163_10374054
408 Ga0157380_10678117
409 Ga0163161_10109236
410 Ga0213874_10009765
411 Ga0224712_10029738
412 Ga0207692_10000077
413 Ga0207647_10001288
414 Ga0207699_10016263
415 Ga0207654_10018275
416 Ga0207654_10253931
417 Ga0207695_10001477
418 Ga0207695_10002634
419 Ga0207671_10000313
420 Ga0207671_10000445
421 Ga0207662_10006185
422 Ga0207657_10005312
423 Ga0207657_10152779
424 Ga0207652_10523895
425 Ga0207681_10354769
426 Ga0207694_10002394
427 Ga0207694_10009205
428 Ga0207664_10236242
429 Ga0207691_10161573
430 Ga0207689_10040620
431 Ga0207667_10035587
432 Ga0207667_10226209
433 Ga0207712_10054303
434 Ga0207640_10021451
435 Ga0207640_10279140
436 Ga0207639_10095470
437 Ga0207678_10008595
438 Ga0207678_10124902
439 Ga0207708_10155446
440 Ga0207702_10150549
441 Ga0207641_10098411
442 Ga0207674_10050685
443 Ga0207674_10052471
444 Ga0207675_100016427
445 Ga0207683_10013047
446 Ga0207698_10150744
447 Ga0268266_10188714
448 Ga0268264_10008132
449 Ga0268264_10204613
450 Ga0307517_10002481
451 Ga0307512_10021056
452 Ga0316176_1024044
453 Ga0314311_1010646
454 Ga0316178_1154593
455 Ga0265325_10021641
456 Ga0307509_10090327
457 Ga0307408_100252368
458 Ga0316576_10115154
459 Ga0307405_10098499
460 Ga0307407_10245104
461 Ga0307409_100012252
462 Ga0307409_100015641
463 Ga0307409_100131940
464 Ga0307409_100271749
465 Ga0307416_100003241
466 Ga0307416_100072809
467 Ga0307416_100105035
468 Ga0307415_100040999
469 Ga0307507_10012554
470 Ga0307507_10026578
471 Ga0373926_0003844
472 Ga0373934_0006901
473 Ga0373944_0017200
474 Ga0373936_0001868
475 Ga0373945_0005891
476 Ga0373956_0000715
477 Ga0373943_0184363
478 Ga0373946_0010588
479 Ga0373955_0009197
480 Ga0373931_0070814
481 Ga0373935_0118370
482 Ga0373935_0277547
483 Ga0373927_0342110
484 Ga0373933_0071329
485 Ga0373947_0031836
486 Ga0316582_0083014
487 Ga0316584_0017786
488 Ga0316584_0306684
489 Ga0373925_0008760
490 Ga0436364_0904395
491 Ga0436363_0792560
492 Ga0439442_009663
493 Ga0466969_0033220
494 Ga0466972_0018720
495 Ga0466965_0021835
496 Ga0466966_0002786
497 Ga0466966_0029220
498 Ga0466966_0071390
499 Ga0466961_0009340
500 Ga0466961_0019350
501 Ga0466961_0028006
502 Ga0466970_0002617
503 Ga0466970_0034174
504 Ga0466960_0164458
505 Ga0466959_0003285
506 Ga0466959_0032631
507 Ga0466959_0074684
508 Ga0466958_0020229
509 Ga0495592_0015715
510 Ga0495603_0036419
511 Ga0495641_0009441
512 Ga0495651_0010235
513 Ga0495651_0010299
514 Ga0495651_0011764
515 Ga0495651_0012952
516 Ga0495651_0019681
517 Ga0495651_0037001
518 Ga0495651_0045918
519 Ga0495651_0055453
520 Ga0495653_0084343
521 Ga0495653_0134999
522 Ga0495580_0061720
523 Ga0495582_0019732
524 Ga0495639_0010645
525 Ga0495662_0000974
526 Ga0495662_0010101
527 Ga0495662_0049116
528 Ga0495664_0013046
529 Ga0495585_0038800
530 Ga0495585_0080115
531 Ga0495594_0071676
532 Ga0495608_0021008
533 Ga0495618_0024385
534 Ga0495628_0017686
535 Ga0495628_0019325
536 Ga0495628_0080090
537 Ga0495630_0014328
538 Ga0495630_0092966
539 Ga0495630_0111333
540 Ga0495630_0119741
541 Ga0495643_0086574
542 Ga0495666_0004878
543 Ga0495666_0006570
544 Ga0495652_0005818
545 Ga0495652_0015743
546 Ga0495652_0017945
547 Ga0495652_0033284
548 Ga0495652_0185138
549 Ga0495665_0001893
550 Ga0495665_0019180
551 Ga0495640_0014439
552 Ga0495640_0015172
553 Ga0495640_0143560
554 Ga0495586_0007798
555 Ga0495587_0016608
556 Ga0495587_0069855
557 Ga0495645_0093267
558 Ga0495645_0096497
559 Ga0495645_0108550
560 Ga0495645_0247749
561 Ga0495622_0032502
562 Ga0495667_0025171
563 Ga0495667_0044707
564 Ga0495667_0154945
565 Ga0495634_0030879
566 Ga0495634_0121101
567 Ga0495611_0032681
568 Ga0495611_0056443
569 Ga0495625_0088922
570 Ga0495635_0028590
571 Ga0495635_0083164
572 Ga0495588_0080475
573 Ga0495657_0004345
574 Ga0495657_0027608
575 Ga0495657_0045007
576 Ga0495657_0380526
577 Ga0495599_0015697
578 Ga0495599_0028205
579 Ga0495599_0092653
580 Ga0495623_0022841
581 Ga0495646_0010124
582 Ga0495646_0209386
583 Ga0495646_0234643
584 Ga0495613_0009359
585 Ga0495624_0072429
586 Ga0495589_0005667
587 Ga0495589_0011549
588 Ga0495600_0001405
589 Ga0495600_0024739
590 Ga0495600_0095482
591 Ga0495581_0016190
592 Ga0495581_0016599
593 Ga0495604_0005115
594 Ga0495604_0035946
595 Ga0495604_0063110
596 Ga0495604_0410365
597 Ga0495674_0044859
598 Ga0495674_0336966
599 Ga0495674_0349960
600 Ga0495676_0032164
601 Ga0495676_0048519
602 Ga0495680_0040012
603 Ga0495680_0235066
604 Ga0495675_0024150
605 Ga0495685_004827
606 Ga0495684_0023399
607 Ga0495684_0034509
608 Ga0495684_0064790
609 Ga0495684_0073017
610 Ga0495686_0036845
611 Ga0495593_0015642
612 Ga0495593_0049177
613 Ga0495602_0077008
614 Ga0495602_0284998
615 Ga0495602_0321100
616 Ga0495614_0006775
617 Ga0496101_0257458
618 Ga0496104_0294743
619 Ga0496107_0174310
620 Ga0496109_0258695
621 Ga0496110_0294531
622 Ga0496112_0008151
623 Ga0496112_0256074
624 Ga0496114_0126303
625 Ga0496119_0021514
626 Ga0496122_0001293
627 Ga0496122_0003688
628 Ga0496123_0000142
629 Ga0496124_0000461
630 Ga0496125_0002969
631 Ga0496126_0009863
632 Ga0496126_0194331
633 Ga0501036_0036967
634 Ga0501036_0220833
635 Ga0501038_0003900
636 Ga0501038_0433702
637 Ga0501040_0036345
638 Ga0501041_0013686
639 Ga0501042_0028353
640 Ga0501047_0005537
641 Ga0501047_0025328
642 Ga0501048_0027913
643 Ga0501071_0025824
644 Ga0501074_0079962
645 Ga0501075_0028803
646 Ga0501076_0031148
647 Ga0501076_0116759
648 Ga0501077_0055459
649 Ga0501045_0027470
650 nmdc:mga05p37_48417_c1
651 nmdc:mga09592_125017_c1
652 nmdc:mga0qj67_20254_c1
653 nmdc:mga06r32_4564_c1
654 Ga0495601_0003174
655 Ga0495601_0169790
656 Ga0495612_0004767
657 Ga0495595_0033055
658 Ga0495619_0009862
659 Ga0500644_0039785
660 Ga0500568_0000047
661 Ga0500573_0006567
662 Ga0500573_0077083
663 Ga0500616_0068168
664 Ga0530510_0201977
665 2516086326
666 2643942382
667 2644016052
668 2644176693
669 2644390009
670 2644429463
671 2644631081
672 2768646860
673 2791911344
674 2816422834
675 2819745734
676 2856742736
677 2862583462
678 2891404237
679 2891559074
680 2891564987
681 2899359897
682 2899377031
683 2939658621
684 2946079885
685 8008486779
686 8025525931
687 8025531432
688 8025537370
689 8047711947
690 8056454178

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

156

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

79

191

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9281 2 217
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9231 2 217
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9216 1 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9184 1 210
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9174 2 211
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 2 218 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9443 2 213 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.938 2 218 3.40.50.300
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9376 2 217 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 2 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3E2CUD3-F1-model_v4 deleted 0.9703 1 152
AF-A0A3E2CUD3-F1-model_v4 deleted 0.9641 1 152
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9492 1 214 GO:0005524
GO:0016887
AF-A0A5C6FK33-F1-model_v4 Putative ABC transporter ATP-binding protein YxlF (EC 3.6.3.-) 0.944 1 218 GO:0005524
GO:0016887
AF-A0A286GHK8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9396 2 218 GO:0005524
GO:0016887

Map