F416270

General Info

Members Datasets Scaffolds Average Seq Length
345 167 690 256

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100137669|Ga0070711_1001376691
Length 290
Sequence MPGTIDGVIPVIGAVVAALLFAQAVVRLRRRGRADLAGWDRVALFAAGLGVTLFALVGPLDRIADDKLLSAHMAQHVLIGDLGPALMITALRGPLLVFFLPAPILVPLARNARVRAVLGTLLRPRVAFSIWAANLAIWHVPYLYDKAAEHELLHDFEHVCWMFAGILVWTLLVDPGSHRRLTVGGRVALAAAMFATGQILTDVLVFTFTPLYPLYHGAYGISAQTDQQLAGIVMMVEQLLTLGTCVALLLRPRWSRGRRAHLAAPPVAEGDGELRPGGGGLAAVASSRQP

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
61 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.01
Rhizosphere 88.99
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100137669 3300005439 Unclassified 1827
2 Ga0070658_10465133 3300005327 Bacteria 1091
3 Ga0070680_100051939 3300005336 Bacteria 3346
4 Ga0070680_100095687 3300005336 Bacteria 2462
5 Ga0068868_100210892 3300005338 Bacteria 1623
6 Ga0070660_100015398 3300005339 Bacteria 5521
7 Ga0070660_100455372 3300005339 Bacteria 1062
8 Ga0070691_10012322 3300005341 Bacteria 3916
9 Ga0070671_100027682 3300005355 Bacteria 4667
10 Ga0070709_10002278 3300005434 Bacteria 10408
11 Ga0070714_100000941 3300005435 Bacteria 20721
12 Ga0070714_100013745 3300005435 Bacteria 6492
13 Ga0070714_100066161 3300005435 Unclassified 3114
14 Ga0070714_100132592 3300005435 Bacteria 2227
15 Ga0070714_100212587 3300005435 Bacteria 1773
16 Ga0070713_100003536 3300005436 Bacteria 10320
17 Ga0070713_100235193 3300005436 Bacteria 1667
18 Ga0070713_100243792 3300005436 Bacteria 1637
19 Ga0070710_10001745 3300005437 Bacteria 10281
20 Ga0070710_10011823 3300005437 Bacteria 4322
21 Ga0070711_100017881 3300005439 Bacteria 4518
22 Ga0070705_100146057 3300005440 Bacteria 1563
23 Ga0070705_100216873 3300005440 Bacteria 1322
24 Ga0070678_100202135 3300005456 Bacteria 1640
25 Ga0070681_10037257 3300005458 Bacteria 4881
26 Ga0070707_100000967 3300005468 Bacteria 28411
27 Ga0070707_100640969 3300005468 Bacteria 1025
28 Ga0070679_100018919 3300005530 Bacteria 6688
29 Ga0070679_100085144 3300005530 Bacteria 3148
30 Ga0070679_100414362 3300005530 Unclassified 1293
31 Ga0070697_100361352 3300005536 Bacteria 1255
32 Ga0070695_100000009 3300005545 Bacteria 87710
33 Ga0068855_100202246 3300005563 Bacteria 2236
34 Ga0068856_100109900 3300005614 Bacteria 2753
35 Ga0070717_10058281 3300006028 Bacteria 3193
36 Ga0070717_10082793 3300006028 Bacteria 2697
37 Ga0070717_10124186 3300006028 Bacteria 2214
38 Ga0070717_10168760 3300006028 Bacteria 1902
39 Ga0070717_10729543 3300006028 Bacteria 901
40 Ga0070715_10000348 3300006163 Bacteria 11570
41 Ga0070716_100005957 3300006173 Bacteria 5931
42 Ga0070716_100360850 3300006173 Bacteria 1032
43 Ga0070712_100060036 3300006175 Bacteria 2680
44 Ga0070712_100089973 3300006175 Bacteria 2247
45 Ga0075434_100017932 3300006871 Bacteria 6829
46 Ga0111539_10315575 3300009094 Bacteria 1819
47 Ga0105245_10117545 3300009098 Bacteria 2480
48 Ga0105245_10275918 3300009098 Bacteria 1641
49 Ga0105248_10074059 3300009177 Bacteria 3827
50 Ga0099796_10091628 3300010159 Unclassified 1131
51 Ga0157369_10088807 3300013105 Bacteria 3300
52 Ga0157369_10332195 3300013105 Bacteria 1579
53 Ga0157372_10022340 3300013307 Bacteria 6844
54 Ga0157372_10393523 3300013307 Bacteria 1615
55 Ga0206356_11858707 3300020070 Bacteria 1373
56 Ga0206353_11491888 3300020082 Bacteria 1260
57 Ga0207653_10106794 3300025885 Bacteria 996
58 Ga0207692_10001420 3300025898 Bacteria 8972
59 Ga0207685_10000435 3300025905 Bacteria 6948
60 Ga0207699_10021303 3300025906 Bacteria 3491
61 Ga0207699_10043992 3300025906 Bacteria 2597
62 Ga0207699_10307593 3300025906 Bacteria 1108
63 Ga0207695_10039054 3300025913 Bacteria 5104
64 Ga0207693_10000877 3300025915 Bacteria 26923
65 Ga0207693_10077578 3300025915 Bacteria 2602
66 Ga0207663_10053070 3300025916 Bacteria 2531
67 Ga0207663_10177977 3300025916 Bacteria 1516
68 Ga0207657_10303106 3300025919 Bacteria 1265
69 Ga0207649_10425655 3300025920 Unclassified 998
70 Ga0207652_10176755 3300025921 Bacteria 1917
71 Ga0207652_10206415 3300025921 Bacteria 1769
72 Ga0207652_10624959 3300025921 Bacteria 964
73 Ga0207646_10000523 3300025922 Bacteria 51093
74 Ga0207646_10067003 3300025922 Bacteria 3205
75 Ga0207646_10082732 3300025922 Bacteria 2871
76 Ga0207687_10170348 3300025927 Bacteria 1679
77 Ga0207687_10299747 3300025927 Bacteria 1294
78 Ga0207687_10581935 3300025927 Bacteria 942
79 Ga0207700_10008486 3300025928 Bacteria 6370
80 Ga0207700_10124414 3300025928 Bacteria 2095
81 Ga0207700_10193968 3300025928 Bacteria 1708
82 Ga0207664_10004761 3300025929 Bacteria 9225
83 Ga0207664_10005909 3300025929 Bacteria 8374
84 Ga0207664_10007265 3300025929 Bacteria 7680
85 Ga0207664_10494569 3300025929 Bacteria 1095
86 Ga0207644_10067774 3300025931 Bacteria 2602
87 Ga0207665_10001089 3300025939 Bacteria 18270
88 Ga0207665_10104773 3300025939 Unclassified 1980
89 Ga0207711_10573271 3300025941 Bacteria 1053
90 Ga0207702_10832850 3300026078 Unclassified 913
91 Ga0207676_10278829 3300026095 Bacteria 1517
92 Ga0207683_10055234 3300026121 Bacteria 3482
93 Ga0265337_1028083 3300028556 Bacteria 1692
94 Ga0265337_1058974 3300028556 Bacteria 1066
95 Ga0265319_1022734 3300028563 Bacteria 2279
96 Ga0265334_10001490 3300028573 Bacteria 11295
97 Ga0265318_10000400 3300028577 Bacteria 33867
98 Ga0265336_10004333 3300028666 Bacteria 5381
99 Ga0265336_10049495 3300028666 Bacteria 1272
100 Ga0265336_10072915 3300028666 Bacteria 1026
101 Ga0265338_10004790 3300028800 Bacteria 18080
102 Ga0265338_10007252 3300028800 Bacteria 13838
103 Ga0265338_10012829 3300028800 Bacteria 9524
104 Ga0265338_10051938 3300028800 Bacteria 3685
105 Ga0265338_10078491 3300028800 Bacteria 2784
106 Ga0265338_10181081 3300028800 Bacteria 1606
107 Ga0265324_10041504 3300029957 Bacteria 1591
108 Ga0265330_10031234 3300031235 Bacteria 2387
109 Ga0265330_10038754 3300031235 Bacteria 2118
110 Ga0265332_10001216 3300031238 Bacteria 14908
111 Ga0265332_10062192 3300031238 Bacteria 1595
112 Ga0265328_10006611 3300031239 Bacteria 4882
113 Ga0265320_10030318 3300031240 Bacteria 2789
114 Ga0265320_10049018 3300031240 Bacteria 2058
115 Ga0265325_10003479 3300031241 Bacteria 10265
116 Ga0265325_10096574 3300031241 Bacteria 1451
117 Ga0265329_10002550 3300031242 Bacteria 8219
118 Ga0265340_10003891 3300031247 Bacteria 8414
119 Ga0265339_10022838 3300031249 Bacteria 3618
120 Ga0265339_10048529 3300031249 Bacteria 2327
121 Ga0265331_10004229 3300031250 Bacteria 8989
122 Ga0265331_10032138 3300031250 Bacteria 2603
123 Ga0265327_10014748 3300031251 Bacteria 5091
124 Ga0265316_10008149 3300031344 Bacteria 9750
125 Ga0265316_10038959 3300031344 Bacteria 3822
126 Ga0265313_10038261 3300031595 Bacteria 2390
127 Ga0265313_10059894 3300031595 Bacteria 1789
128 Ga0265313_10118369 3300031595 Bacteria 1158
129 Ga0265314_10017782 3300031711 Bacteria 5570
130 Ga0265314_10033674 3300031711 Bacteria 3752
131 Ga0265342_10041685 3300031712 Bacteria 2777
132 Ga0265342_10085975 3300031712 Bacteria 1809
133 Ga0373955_0120912 3300035172 Bacteria 1523
134 Ga0373935_0065013 3300035692 Bacteria 2340
135 Ga0373947_0000609 3300035725 Bacteria 21058
136 Ga0373937_0000609 3300036401 Bacteria 31584
137 Ga0373925_0223535 3300037068 Bacteria 1503
138 Ga0395900_0089339 3300037418 Bacteria 3167
139 Ga0395900_0363702 3300037418 Bacteria 1418
140 Ga0395898_0035606 3300037466 Bacteria 4948
141 Ga0466969_0002430 3300044656 Bacteria 9944
142 Ga0466969_0032928 3300044656 Bacteria 2634
143 Ga0466969_0112671 3300044656 Unclassified 1272
144 Ga0466965_0013692 3300044683 Bacteria 3830
145 Ga0466966_0043013 3300044684 Bacteria 2897
146 Ga0466966_0129197 3300044684 Bacteria 1548
147 Ga0466961_0012746 3300044693 Bacteria 5383
148 Ga0466961_0028316 3300044693 Bacteria 3602
149 Ga0466961_0105082 3300044693 Bacteria 1778
150 Ga0466963_0000298 3300044694 Bacteria 22349
151 Ga0466963_0000460 3300044694 Bacteria 18911
152 Ga0466963_0004021 3300044694 Bacteria 8501
153 Ga0466963_0004702 3300044694 Bacteria 7971
154 Ga0466963_0005236 3300044694 Bacteria 7576
155 Ga0466963_0006177 3300044694 Bacteria 7071
156 Ga0466963_0011180 3300044694 Bacteria 5461
157 Ga0466963_0017059 3300044694 Bacteria 4522
158 Ga0466963_0049868 3300044694 Bacteria 2769
159 Ga0466963_0056235 3300044694 Bacteria 2618
160 Ga0466963_0198891 3300044694 Unclassified 1401
161 Ga0466963_0221109 3300044694 Bacteria 1326
162 Ga0466964_0001361 3300044706 Bacteria 8350
163 Ga0466964_0028261 3300044706 Unclassified 2209
164 Ga0466964_0060351 3300044706 Bacteria 1577
165 Ga0466971_0013686 3300044719 Bacteria 3567
166 Ga0466971_0035259 3300044719 Unclassified 2242
167 Ga0466968_0000700 3300044735 Bacteria 11561
168 Ga0466968_0004573 3300044735 Bacteria 5176
169 Ga0466968_0077317 3300044735 Bacteria 1458
170 Ga0466970_0006171 3300044765 Bacteria 5972
171 Ga0466970_0089611 3300044765 Unclassified 1669
172 Ga0466957_0002864 3300044842 Bacteria 9339
173 Ga0466957_0008109 3300044842 Bacteria 5960
174 Ga0466957_0010298 3300044842 Bacteria 5360
175 Ga0466957_0015522 3300044842 Bacteria 4448
176 Ga0466957_0021685 3300044842 Bacteria 3786
177 Ga0466957_0025111 3300044842 Bacteria 3530
178 Ga0466957_0089361 3300044842 Bacteria 1928
179 Ga0466957_0130209 3300044842 Bacteria 1611
180 Ga0466957_0213873 3300044842 Bacteria 1270
181 Ga0466959_0015679 3300045049 Bacteria 5525
182 Ga0466959_0046372 3300045049 Bacteria 3198
183 Ga0466959_0097057 3300045049 Unclassified 2112
184 Ga0466958_0000712 3300045836 Bacteria 14533
185 Ga0466958_0003335 3300045836 Bacteria 8319
186 Ga0466958_0018753 3300045836 Bacteria 4019
187 Ga0466958_0042727 3300045836 Bacteria 2729
188 Ga0466958_0155101 3300045836 Unclassified 1445
189 Ga0466967_0000563 3300045976 Bacteria 18180
190 Ga0466967_0000880 3300045976 Bacteria 16000
191 Ga0466967_0009009 3300045976 Bacteria 7374
192 Ga0466967_0010690 3300045976 Bacteria 6900
193 Ga0466967_0011668 3300045976 Bacteria 6675
194 Ga0466967_0044164 3300045976 Bacteria 3863
195 Ga0466967_0052531 3300045976 Bacteria 3577
196 Ga0466967_0067825 3300045976 Bacteria 3183
197 Ga0466967_0098777 3300045976 Unclassified 2665
198 Ga0466967_0112875 3300045976 Bacteria 2499
199 Ga0466967_0208822 3300045976 Bacteria 1851
200 Ga0466967_0265251 3300045976 Bacteria 1644
201 Ga0466967_0370077 3300045976 Bacteria 1390
202 Ga0495592_0065496 3300046454 Bacteria 2660
203 Ga0495629_0006862 3300046459 Bacteria 8406
204 Ga0495629_0024319 3300046459 Bacteria 4312
205 Ga0495629_0120435 3300046459 Bacteria 1828
206 Ga0495629_0329249 3300046459 Bacteria 1043
207 Ga0495641_0013510 3300046461 Bacteria 4480
208 Ga0495641_0027078 3300046461 Bacteria 2791
209 Ga0495641_0038554 3300046461 Bacteria 2232
210 Ga0495641_0103705 3300046461 Bacteria 1269
211 Ga0495651_0000037 3300046462 Bacteria 97257
212 Ga0495651_0305091 3300046462 Bacteria 1066
213 Ga0495653_0022105 3300046463 Bacteria 5147
214 Ga0495580_0063963 3300046472 Bacteria 2579
215 Ga0495582_0006334 3300046473 Bacteria 6582
216 Ga0495582_0039110 3300046473 Bacteria 2612
217 Ga0495605_0166212 3300046474 Bacteria 977
218 Ga0495662_0089833 3300046476 Unclassified 1497
219 Ga0495584_0058082 3300046491 Bacteria 1946
220 Ga0495596_0049189 3300046500 Bacteria 1653
221 Ga0495607_0030409 3300046501 Bacteria 3316
222 Ga0495608_0000697 3300046511 Bacteria 23289
223 Ga0495608_0074685 3300046511 Bacteria 2209
224 Ga0495618_0001860 3300046514 Bacteria 13905
225 Ga0495618_0005092 3300046514 Bacteria 8027
226 Ga0495618_0008693 3300046514 Bacteria 6136
227 Ga0495618_0058364 3300046514 Bacteria 2444
228 Ga0495628_0000721 3300046516 Bacteria 30671
229 Ga0495628_0010224 3300046516 Bacteria 7981
230 Ga0495628_0030370 3300046516 Bacteria 4375
231 Ga0495630_0036567 3300046517 Bacteria 3670
232 Ga0495630_0062141 3300046517 Bacteria 2805
233 Ga0495631_0172151 3300046518 Bacteria 928
234 Ga0495644_0005973 3300046523 Bacteria 4746
235 Ga0495663_0011779 3300046525 Bacteria 2435
236 Ga0495666_0038822 3300046526 Unclassified 2314
237 Ga0495642_0050333 3300046528 Bacteria 1713
238 Ga0495652_0000015 3300046529 Bacteria 222624
239 Ga0495652_0355398 3300046529 Bacteria 1048
240 Ga0495665_0051161 3300046531 Bacteria 2188
241 Ga0495665_0226538 3300046531 Bacteria 966
242 Ga0495640_0006782 3300046533 Bacteria 9035
243 Ga0495586_0018786 3300046535 Bacteria 3680
244 Ga0495587_0000051 3300046536 Bacteria 101923
245 Ga0495587_0016428 3300046536 Bacteria 4604
246 Ga0495645_0000097 3300046543 Bacteria 60603
247 Ga0495645_0009731 3300046543 Bacteria 6724
248 Ga0495667_0011007 3300046559 Bacteria 6115
249 Ga0495667_0080900 3300046559 Bacteria 2112
250 Ga0495656_0012783 3300046615 Bacteria 3107
251 Ga0495634_0011039 3300046642 Bacteria 6592
252 Ga0495634_0016127 3300046642 Bacteria 5348
253 Ga0495634_0062530 3300046642 Unclassified 2472
254 Ga0495634_0100720 3300046642 Bacteria 1866
255 Ga0495635_0013421 3300046663 Bacteria 5732
256 Ga0495635_0052160 3300046663 Bacteria 2817
257 Ga0495657_0012870 3300046675 Bacteria 6197
258 Ga0495657_0049311 3300046675 Bacteria 2837
259 Ga0495599_0000049 3300046678 Bacteria 84569
260 Ga0495599_0000748 3300046678 Bacteria 18362
261 Ga0495623_0000011 3300046679 Bacteria 120974
262 Ga0495623_0021639 3300046679 Bacteria 4153
263 Ga0495647_0000589 3300046681 Bacteria 10770
264 Ga0495658_0000971 3300046683 Bacteria 15218
265 Ga0495613_0017523 3300046689 Bacteria 5332
266 Ga0495613_0031168 3300046689 Bacteria 3960
267 Ga0495624_0064338 3300046690 Bacteria 2292
268 Ga0495670_0044866 3300046691 Bacteria 2207
269 Ga0495589_0024327 3300046794 Bacteria 3079
270 Ga0495600_0053460 3300046809 Bacteria 2638
271 Ga0495581_0031037 3300047315 Bacteria 3096
272 Ga0495604_0000077 3300047317 Bacteria 84167
273 Ga0495674_0016082 3300047319 Bacteria 6982
274 Ga0495674_0070668 3300047319 Bacteria 3016
275 Ga0495674_0303927 3300047319 Bacteria 1302
276 Ga0495676_0035821 3300047321 Bacteria 4148
277 Ga0495676_0042853 3300047321 Bacteria 3711
278 Ga0495676_0413030 3300047321 Bacteria 894
279 Ga0495680_0003421 3300047322 Bacteria 15660
280 Ga0495680_0033320 3300047322 Bacteria 4172
281 Ga0495680_0166789 3300047322 Bacteria 1596
282 Ga0495680_0191400 3300047322 Bacteria 1472
283 Ga0495680_0379289 3300047322 Bacteria 980
284 Ga0495675_0000018 3300047444 Bacteria 115435
285 Ga0495675_0077796 3300047444 Bacteria 2090
286 Ga0495679_030313 3300047446 Bacteria 1757
287 Ga0495684_0008844 3300047471 Bacteria 7782
288 Ga0495684_0013675 3300047471 Bacteria 6250
289 Ga0495684_0315387 3300047471 Unclassified 1119
290 Ga0495593_0000271 3300047673 Bacteria 28123
291 Ga0495602_0000171 3300048088 Bacteria 60650
292 Ga0495614_0045513 3300048089 Bacteria 1881
293 Ga0496100_0184807 3300048903 Bacteria 1509
294 Ga0496100_0470713 3300048903 Bacteria 965
295 Ga0496101_0006406 3300048904 Bacteria 7577
296 Ga0496101_0137342 3300048904 Bacteria 1861
297 Ga0496102_0067385 3300048905 Bacteria 3283
298 Ga0496102_0218038 3300048905 Bacteria 1798
299 Ga0496103_0008079 3300048906 Bacteria 6248
300 Ga0496103_0087705 3300048906 Bacteria 1962
301 Ga0496104_0193942 3300048907 Bacteria 1943
302 Ga0496104_0369653 3300048907 Bacteria 1346
303 Ga0496104_0504353 3300048907 Bacteria 1121
304 Ga0496105_0030489 3300048908 Bacteria 4419
305 Ga0496105_0033201 3300048908 Bacteria 4236
306 Ga0496105_0094849 3300048908 Bacteria 2464
307 Ga0496105_0277160 3300048908 Bacteria 1353
308 Ga0496106_0011107 3300048909 Bacteria 6660
309 Ga0496107_0002595 3300048910 Bacteria 11779
310 Ga0496108_0082176 3300048911 Unclassified 2731
311 Ga0496108_0149437 3300048911 Bacteria 2015
312 Ga0496108_0615462 3300048911 Bacteria 946
313 Ga0496109_0003770 3300048912 Bacteria 12662
314 Ga0496109_0057665 3300048912 Bacteria 3545
315 Ga0496109_0125085 3300048912 Bacteria 2397
316 Ga0496110_0009517 3300048913 Bacteria 7865
317 Ga0496111_0008135 3300048914 Bacteria 6929
318 Ga0496111_0246960 3300048914 Unclassified 1325
319 Ga0496112_0087276 3300048915 Bacteria 3087
320 Ga0496112_0216522 3300048915 Bacteria 1871
321 Ga0496112_0279055 3300048915 Bacteria 1618
322 Ga0496113_0022930 3300048916 Bacteria 4423
323 Ga0496113_0034883 3300048916 Bacteria 3674
324 Ga0496114_0045324 3300048917 Bacteria 3652
325 Ga0496114_0060074 3300048917 Bacteria 3176
326 Ga0496114_0355530 3300048917 Bacteria 1296
327 Ga0496114_0399947 3300048917 Bacteria 1216
328 Ga0496115_0000948 3300048918 Bacteria 21056
329 Ga0496115_0059937 3300048918 Bacteria 3066
330 Ga0496115_0064758 3300048918 Bacteria 2951
331 Ga0495601_0000076 3300053077 Bacteria 54429
332 Ga0495601_0017819 3300053077 Bacteria 4315
333 Ga0495601_0065617 3300053077 Bacteria 2310
334 Ga0495601_0196772 3300053077 Bacteria 1318
335 Ga0495612_0049697 3300053078 Bacteria 1721
336 Ga0495595_0037327 3300053084 Bacteria 2208
337 Ga0495595_0345906 3300053084 Bacteria 750
338 Ga0495619_0006449 3300053085 Bacteria 7429
339 Ga0495619_0007399 3300053085 Bacteria 6958
340 Ga0495619_0140914 3300053085 Unclassified 1660
341 Ga0495619_0141533 3300053085 Bacteria 1657
342 Ga0466962_0020713 3300061719 Bacteria 3160
343 Ga0466962_0021856 3300061719 Unclassified 3071
344 Ga0466962_0025736 3300061719 Bacteria 2824
345 Ga0466962_0074806 3300061719 Bacteria 1618
346 Ga0070711_100137669
347 Ga0070658_10465133
348 Ga0070680_100051939
349 Ga0070680_100095687
350 Ga0068868_100210892
351 Ga0070660_100015398
352 Ga0070660_100455372
353 Ga0070691_10012322
354 Ga0070671_100027682
355 Ga0070709_10002278
356 Ga0070714_100000941
357 Ga0070714_100013745
358 Ga0070714_100066161
359 Ga0070714_100132592
360 Ga0070714_100212587
361 Ga0070713_100003536
362 Ga0070713_100235193
363 Ga0070713_100243792
364 Ga0070710_10001745
365 Ga0070710_10011823
366 Ga0070711_100017881
367 Ga0070705_100146057
368 Ga0070705_100216873
369 Ga0070678_100202135
370 Ga0070681_10037257
371 Ga0070707_100000967
372 Ga0070707_100640969
373 Ga0070679_100018919
374 Ga0070679_100085144
375 Ga0070679_100414362
376 Ga0070697_100361352
377 Ga0070695_100000009
378 Ga0068855_100202246
379 Ga0068856_100109900
380 Ga0070717_10058281
381 Ga0070717_10082793
382 Ga0070717_10124186
383 Ga0070717_10168760
384 Ga0070717_10729543
385 Ga0070715_10000348
386 Ga0070716_100005957
387 Ga0070716_100360850
388 Ga0070712_100060036
389 Ga0070712_100089973
390 Ga0075434_100017932
391 Ga0111539_10315575
392 Ga0105245_10117545
393 Ga0105245_10275918
394 Ga0105248_10074059
395 Ga0099796_10091628
396 Ga0157369_10088807
397 Ga0157369_10332195
398 Ga0157372_10022340
399 Ga0157372_10393523
400 Ga0206356_11858707
401 Ga0206353_11491888
402 Ga0207653_10106794
403 Ga0207692_10001420
404 Ga0207685_10000435
405 Ga0207699_10021303
406 Ga0207699_10043992
407 Ga0207699_10307593
408 Ga0207695_10039054
409 Ga0207693_10000877
410 Ga0207693_10077578
411 Ga0207663_10053070
412 Ga0207663_10177977
413 Ga0207657_10303106
414 Ga0207649_10425655
415 Ga0207652_10176755
416 Ga0207652_10206415
417 Ga0207652_10624959
418 Ga0207646_10000523
419 Ga0207646_10067003
420 Ga0207646_10082732
421 Ga0207687_10170348
422 Ga0207687_10299747
423 Ga0207687_10581935
424 Ga0207700_10008486
425 Ga0207700_10124414
426 Ga0207700_10193968
427 Ga0207664_10004761
428 Ga0207664_10005909
429 Ga0207664_10007265
430 Ga0207664_10494569
431 Ga0207644_10067774
432 Ga0207665_10001089
433 Ga0207665_10104773
434 Ga0207711_10573271
435 Ga0207702_10832850
436 Ga0207676_10278829
437 Ga0207683_10055234
438 Ga0265337_1028083
439 Ga0265337_1058974
440 Ga0265319_1022734
441 Ga0265334_10001490
442 Ga0265318_10000400
443 Ga0265336_10004333
444 Ga0265336_10049495
445 Ga0265336_10072915
446 Ga0265338_10004790
447 Ga0265338_10007252
448 Ga0265338_10012829
449 Ga0265338_10051938
450 Ga0265338_10078491
451 Ga0265338_10181081
452 Ga0265324_10041504
453 Ga0265330_10031234
454 Ga0265330_10038754
455 Ga0265332_10001216
456 Ga0265332_10062192
457 Ga0265328_10006611
458 Ga0265320_10030318
459 Ga0265320_10049018
460 Ga0265325_10003479
461 Ga0265325_10096574
462 Ga0265329_10002550
463 Ga0265340_10003891
464 Ga0265339_10022838
465 Ga0265339_10048529
466 Ga0265331_10004229
467 Ga0265331_10032138
468 Ga0265327_10014748
469 Ga0265316_10008149
470 Ga0265316_10038959
471 Ga0265313_10038261
472 Ga0265313_10059894
473 Ga0265313_10118369
474 Ga0265314_10017782
475 Ga0265314_10033674
476 Ga0265342_10041685
477 Ga0265342_10085975
478 Ga0373955_0120912
479 Ga0373935_0065013
480 Ga0373947_0000609
481 Ga0373937_0000609
482 Ga0373925_0223535
483 Ga0395900_0089339
484 Ga0395900_0363702
485 Ga0395898_0035606
486 Ga0466969_0002430
487 Ga0466969_0032928
488 Ga0466969_0112671
489 Ga0466965_0013692
490 Ga0466966_0043013
491 Ga0466966_0129197
492 Ga0466961_0012746
493 Ga0466961_0028316
494 Ga0466961_0105082
495 Ga0466963_0000298
496 Ga0466963_0000460
497 Ga0466963_0004021
498 Ga0466963_0004702
499 Ga0466963_0005236
500 Ga0466963_0006177
501 Ga0466963_0011180
502 Ga0466963_0017059
503 Ga0466963_0049868
504 Ga0466963_0056235
505 Ga0466963_0198891
506 Ga0466963_0221109
507 Ga0466964_0001361
508 Ga0466964_0028261
509 Ga0466964_0060351
510 Ga0466971_0013686
511 Ga0466971_0035259
512 Ga0466968_0000700
513 Ga0466968_0004573
514 Ga0466968_0077317
515 Ga0466970_0006171
516 Ga0466970_0089611
517 Ga0466957_0002864
518 Ga0466957_0008109
519 Ga0466957_0010298
520 Ga0466957_0015522
521 Ga0466957_0021685
522 Ga0466957_0025111
523 Ga0466957_0089361
524 Ga0466957_0130209
525 Ga0466957_0213873
526 Ga0466959_0015679
527 Ga0466959_0046372
528 Ga0466959_0097057
529 Ga0466958_0000712
530 Ga0466958_0003335
531 Ga0466958_0018753
532 Ga0466958_0042727
533 Ga0466958_0155101
534 Ga0466967_0000563
535 Ga0466967_0000880
536 Ga0466967_0009009
537 Ga0466967_0010690
538 Ga0466967_0011668
539 Ga0466967_0044164
540 Ga0466967_0052531
541 Ga0466967_0067825
542 Ga0466967_0098777
543 Ga0466967_0112875
544 Ga0466967_0208822
545 Ga0466967_0265251
546 Ga0466967_0370077
547 Ga0495592_0065496
548 Ga0495629_0006862
549 Ga0495629_0024319
550 Ga0495629_0120435
551 Ga0495629_0329249
552 Ga0495641_0013510
553 Ga0495641_0027078
554 Ga0495641_0038554
555 Ga0495641_0103705
556 Ga0495651_0000037
557 Ga0495651_0305091
558 Ga0495653_0022105
559 Ga0495580_0063963
560 Ga0495582_0006334
561 Ga0495582_0039110
562 Ga0495605_0166212
563 Ga0495662_0089833
564 Ga0495584_0058082
565 Ga0495596_0049189
566 Ga0495607_0030409
567 Ga0495608_0000697
568 Ga0495608_0074685
569 Ga0495618_0001860
570 Ga0495618_0005092
571 Ga0495618_0008693
572 Ga0495618_0058364
573 Ga0495628_0000721
574 Ga0495628_0010224
575 Ga0495628_0030370
576 Ga0495630_0036567
577 Ga0495630_0062141
578 Ga0495631_0172151
579 Ga0495644_0005973
580 Ga0495663_0011779
581 Ga0495666_0038822
582 Ga0495642_0050333
583 Ga0495652_0000015
584 Ga0495652_0355398
585 Ga0495665_0051161
586 Ga0495665_0226538
587 Ga0495640_0006782
588 Ga0495586_0018786
589 Ga0495587_0000051
590 Ga0495587_0016428
591 Ga0495645_0000097
592 Ga0495645_0009731
593 Ga0495667_0011007
594 Ga0495667_0080900
595 Ga0495656_0012783
596 Ga0495634_0011039
597 Ga0495634_0016127
598 Ga0495634_0062530
599 Ga0495634_0100720
600 Ga0495635_0013421
601 Ga0495635_0052160
602 Ga0495657_0012870
603 Ga0495657_0049311
604 Ga0495599_0000049
605 Ga0495599_0000748
606 Ga0495623_0000011
607 Ga0495623_0021639
608 Ga0495647_0000589
609 Ga0495658_0000971
610 Ga0495613_0017523
611 Ga0495613_0031168
612 Ga0495624_0064338
613 Ga0495670_0044866
614 Ga0495589_0024327
615 Ga0495600_0053460
616 Ga0495581_0031037
617 Ga0495604_0000077
618 Ga0495674_0016082
619 Ga0495674_0070668
620 Ga0495674_0303927
621 Ga0495676_0035821
622 Ga0495676_0042853
623 Ga0495676_0413030
624 Ga0495680_0003421
625 Ga0495680_0033320
626 Ga0495680_0166789
627 Ga0495680_0191400
628 Ga0495680_0379289
629 Ga0495675_0000018
630 Ga0495675_0077796
631 Ga0495679_030313
632 Ga0495684_0008844
633 Ga0495684_0013675
634 Ga0495684_0315387
635 Ga0495593_0000271
636 Ga0495602_0000171
637 Ga0495614_0045513
638 Ga0496100_0184807
639 Ga0496100_0470713
640 Ga0496101_0006406
641 Ga0496101_0137342
642 Ga0496102_0067385
643 Ga0496102_0218038
644 Ga0496103_0008079
645 Ga0496103_0087705
646 Ga0496104_0193942
647 Ga0496104_0369653
648 Ga0496104_0504353
649 Ga0496105_0030489
650 Ga0496105_0033201
651 Ga0496105_0094849
652 Ga0496105_0277160
653 Ga0496106_0011107
654 Ga0496107_0002595
655 Ga0496108_0082176
656 Ga0496108_0149437
657 Ga0496108_0615462
658 Ga0496109_0003770
659 Ga0496109_0057665
660 Ga0496109_0125085
661 Ga0496110_0009517
662 Ga0496111_0008135
663 Ga0496111_0246960
664 Ga0496112_0087276
665 Ga0496112_0216522
666 Ga0496112_0279055
667 Ga0496113_0022930
668 Ga0496113_0034883
669 Ga0496114_0045324
670 Ga0496114_0060074
671 Ga0496114_0355530
672 Ga0496114_0399947
673 Ga0496115_0000948
674 Ga0496115_0059937
675 Ga0496115_0064758
676 Ga0495601_0000076
677 Ga0495601_0017819
678 Ga0495601_0065617
679 Ga0495601_0196772
680 Ga0495612_0049697
681 Ga0495595_0037327
682 Ga0495595_0345906
683 Ga0495619_0006449
684 Ga0495619_0007399
685 Ga0495619_0140914
686 Ga0495619_0141533
687 Ga0466962_0020713
688 Ga0466962_0021856
689 Ga0466962_0025736
690 Ga0466962_0074806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09678

Caa3_CtaG

Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG)

19

257

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yk1-assembly1.cif.gz_A crystal structure of the bid domain of bep6 from bartonella rochalimae 0.5509 176 253
4p79-assembly1.cif.gz_A crystal structure of mouse claudin-15 0.5299 139 240
6xbk-assembly1.cif.gz_R structure of human smo-g111c/i496c complex with gi 0.3805 28 258
4bv0-assembly1.cif.gz_A high resolution structure of evolved agonist-bound neurotensin receptor 1 mutant without lysozyme fusion 0.3789 32 244
7lx0-assembly1.cif.gz_U quantitative assessment of chlorophyll types in cryo-em maps of photosystem i acclimated to far-red light 0.3706 100 255
ID Description Score Start End Superfamily
af_A0A0G2KYS3_6_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5207 149 238 1.20.140.150
af_B6U3T4_15_155_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5162 148 240 1.20.1250.20
af_I1L234_15_155_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5099 148 240 1.20.1250.20
af_Q3UNB8_35_188_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4655 119 258 1.20.140.150
af_O70610_27_283_1.20.1440.80 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Gap junction channel protein cysteine-rich domain 0.4651 134 251 1.20.1440.80
ID Description Score Start End GO Terms
AF-A0A538J626-F1-model_v4 Cytochrome c oxidase assembly protein 0.983 2 243 GO:0005886
AF-A0A7V9CS48-F1-model_v4 Cytochrome c oxidase assembly protein 0.9742 7 243 GO:0005886
AF-A0A537TVZ7-F1-model_v4 Cytochrome c oxidase assembly protein 0.9638 3 256 GO:0005886
AF-A0A538LI55-F1-model_v4 Cytochrome c oxidase assembly protein 0.9585 1 257 GO:0005886
AF-A0A538LI55-F1-model_v4 Cytochrome c oxidase assembly protein 0.9509 1 257 GO:0005886

Map