F416247

General Info

Members Datasets Scaffolds Average Seq Length
345 169 690 176

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100016606|Ga0070689_1000166062
Length 205
Sequence MRWVRLVRSVFTCATAENPLKIYLYSQPIPAMTNRRKVLKKLAIAAGGLVTLPQWMASCGISDSNVHSTSFSSADQQLLASVSDTLIPAGNSIGALSVGVDKYLQKLIDDCYENDVQQNVKRQLNGLQKSAKAKFNKSFAECSQLQRQELFSALSTSKVKAEKDFCTLIKSETIRGFNTSQKVMQDYLNYKIAPGHYYGCVDAKA

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100016606 3300005340 Bacteria 5389
2 MRS1b_contig_8141601 2162886011 Unclassified 870
3 Ga0065712_10069313 3300005290 Bacteria 7543
4 Ga0065712_10070308 3300005290 Bacteria 6126
5 Ga0065712_10113278 3300005290 Bacteria 1785
6 Ga0065712_10396181 3300005290 Bacteria 736
7 Ga0065715_10291536 3300005293 Unclassified 1062
8 Ga0065715_10459501 3300005293 Bacteria 817
9 Ga0070683_100006461 3300005329 Bacteria 9837
10 Ga0070683_100076187 3300005329 Bacteria 3135
11 Ga0070690_100019248 3300005330 Bacteria 4139
12 Ga0070690_100072071 3300005330 Bacteria 2245
13 Ga0070670_100063814 3300005331 Bacteria 3161
14 Ga0070670_100147052 3300005331 Unclassified 2039
15 Ga0070670_101357272 3300005331 Bacteria 651
16 Ga0070677_10395834 3300005333 Bacteria 727
17 Ga0068869_100021236 3300005334 Bacteria 4464
18 Ga0068869_100051358 3300005334 Bacteria 2992
19 Ga0068869_100097513 3300005334 Bacteria 2220
20 Ga0068869_100649132 3300005334 Bacteria 896
21 Ga0068869_100725793 3300005334 Bacteria 849
22 Ga0070666_10044718 3300005335 Bacteria 2967
23 Ga0070682_100035458 3300005337 Bacteria 3046
24 Ga0068868_100015976 3300005338 Bacteria 5567
25 Ga0068868_100017334 3300005338 Bacteria 5363
26 Ga0068868_100781435 3300005338 Bacteria 860
27 Ga0070689_100036801 3300005340 Bacteria 3742
28 Ga0070689_100086988 3300005340 Bacteria 2458
29 Ga0070661_100005613 3300005344 Bacteria 8643
30 Ga0070668_100204556 3300005347 Bacteria 1622
31 Ga0070669_100228750 3300005353 Bacteria 1473
32 Ga0070669_100440663 3300005353 Bacteria 1072
33 Ga0070675_100019322 3300005354 Bacteria 5428
34 Ga0070675_100054718 3300005354 Bacteria 3283
35 Ga0070675_100114868 3300005354 Bacteria 2281
36 Ga0070675_100174573 3300005354 Bacteria 1855
37 Ga0070671_100457242 3300005355 Bacteria 1096
38 Ga0070673_100094916 3300005364 Bacteria 2446
39 Ga0070673_100280261 3300005364 Unclassified 1462
40 Ga0070673_100288023 3300005364 Bacteria 1443
41 Ga0070673_100716506 3300005364 Unclassified 920
42 Ga0070688_100015490 3300005365 Bacteria 4340
43 Ga0070688_100039824 3300005365 Bacteria 2878
44 Ga0070659_100058127 3300005366 Bacteria 3051
45 Ga0070701_10578742 3300005438 Unclassified 741
46 Ga0070705_101123167 3300005440 Bacteria 644
47 Ga0070700_100480258 3300005441 Bacteria 952
48 Ga0070700_100640671 3300005441 Bacteria 838
49 Ga0070678_100651898 3300005456 Unclassified 944
50 Ga0070662_100008286 3300005457 Bacteria 6771
51 Ga0070662_100025190 3300005457 Bacteria 4105
52 Ga0070662_100077827 3300005457 Bacteria 2462
53 Ga0070662_100085163 3300005457 Bacteria 2362
54 Ga0070662_100224322 3300005457 Bacteria 1501
55 Ga0068867_100037722 3300005459 Bacteria 3514
56 Ga0068867_100042274 3300005459 Bacteria 3334
57 Ga0068867_100512480 3300005459 Bacteria 1033
58 Ga0070685_10002628 3300005466 Bacteria 9205
59 Ga0070685_10055800 3300005466 Bacteria 2295
60 Ga0070685_10068118 3300005466 Bacteria 2101
61 Ga0070685_10151724 3300005466 Bacteria 1469
62 Ga0070685_10283525 3300005466 Bacteria 1110
63 Ga0070698_100007300 3300005471 Bacteria 11966
64 Ga0070698_100012277 3300005471 Bacteria 9070
65 Ga0070698_101320244 3300005471 Bacteria 671
66 Ga0070684_100001297 3300005535 Bacteria 17907
67 Ga0070684_100238383 3300005535 Bacteria 1661
68 Ga0070684_100534028 3300005535 Bacteria 1088
69 Ga0068853_100016975 3300005539 Bacteria 6002
70 Ga0070672_100103975 3300005543 Bacteria 2307
71 Ga0070672_100341151 3300005543 Bacteria 1276
72 Ga0070672_100457750 3300005543 Bacteria 1099
73 Ga0070686_100116010 3300005544 Bacteria 1832
74 Ga0070686_100759997 3300005544 Unclassified 778
75 Ga0070695_100160574 3300005545 Unclassified 1577
76 Ga0070693_100450281 3300005547 Unclassified 903
77 Ga0070665_100104167 3300005548 Bacteria 2840
78 Ga0070704_100128938 3300005549 Bacteria 1957
79 Ga0070664_100005627 3300005564 Bacteria 10087
80 Ga0070664_100036745 3300005564 Bacteria 4115
81 Ga0070664_100535652 3300005564 Unclassified 1082
82 Ga0070664_100621272 3300005564 Bacteria 1003
83 Ga0068857_100008296 3300005577 Bacteria 8977
84 Ga0068857_100222176 3300005577 Bacteria 1725
85 Ga0068857_100676833 3300005577 Bacteria 979
86 Ga0068857_100760112 3300005577 Bacteria 923
87 Ga0068856_100912627 3300005614 Bacteria 897
88 Ga0068852_100706854 3300005616 Bacteria 1018
89 Ga0068852_101950431 3300005616 Unclassified 609
90 Ga0068859_100060815 3300005617 Bacteria 3806
91 Ga0068859_100070703 3300005617 Bacteria 3525
92 Ga0068859_100081212 3300005617 Bacteria 3284
93 Ga0068859_100248077 3300005617 Bacteria 1870
94 Ga0068859_100376753 3300005617 Bacteria 1515
95 Ga0068859_100485789 3300005617 Bacteria 1330
96 Ga0068864_100009237 3300005618 Bacteria 8129
97 Ga0068864_100330651 3300005618 Bacteria 1434
98 Ga0068866_10223500 3300005718 Bacteria 1137
99 Ga0068870_10011584 3300005840 Bacteria 4094
100 Ga0068863_100000546 3300005841 Bacteria 38297
101 Ga0068863_100062274 3300005841 Bacteria 3528
102 Ga0068863_100191304 3300005841 Bacteria 1966
103 Ga0068863_100209756 3300005841 Bacteria 1876
104 Ga0068863_100844042 3300005841 Bacteria 915
105 Ga0068858_100204177 3300005842 Bacteria 1869
106 Ga0068860_100016462 3300005843 Bacteria 7210
107 Ga0068860_100082883 3300005843 Bacteria 3050
108 Ga0068862_100029326 3300005844 Bacteria 4636
109 Ga0068862_100043348 3300005844 Bacteria 3835
110 Ga0070717_10772956 3300006028 Unclassified 873
111 Ga0068871_100093843 3300006358 Bacteria 2504
112 Ga0068871_100252650 3300006358 Unclassified 1536
113 Ga0075428_100006212 3300006844 Bacteria 13289
114 Ga0075428_100090257 3300006844 Bacteria 3342
115 Ga0075428_100383924 3300006844 Bacteria 1506
116 Ga0075430_100017220 3300006846 Bacteria 6154
117 Ga0075430_100075871 3300006846 Bacteria 2818
118 Ga0075431_100047629 3300006847 Bacteria 4419
119 Ga0075431_100110507 3300006847 Bacteria 2837
120 Ga0075431_100117422 3300006847 Unclassified 2745
121 Ga0075434_100201514 3300006871 Bacteria 2010
122 Ga0068865_100191645 3300006881 Bacteria 1581
123 Ga0068865_100479042 3300006881 Bacteria 1034
124 Ga0068865_100730648 3300006881 Bacteria 849
125 Ga0097620_100060814 3300006931 Bacteria 3806
126 Ga0097620_100070700 3300006931 Bacteria 3525
127 Ga0097620_100081212 3300006931 Bacteria 3284
128 Ga0097620_100248085 3300006931 Bacteria 1870
129 Ga0097620_100376729 3300006931 Bacteria 1515
130 Ga0097620_100485815 3300006931 Bacteria 1330
131 Ga0105251_10201525 3300009011 Bacteria 897
132 Ga0105240_11031472 3300009093 Bacteria 878
133 Ga0111539_10007515 3300009094 Bacteria 13941
134 Ga0111539_10073623 3300009094 Bacteria 4027
135 Ga0111539_10087464 3300009094 Bacteria 3661
136 Ga0111539_10282981 3300009094 Bacteria 1930
137 Ga0111539_10333533 3300009094 Unclassified 1765
138 Ga0111539_10472301 3300009094 Bacteria 1460
139 Ga0114129_10166810 3300009147 Bacteria 3005
140 Ga0114129_10206814 3300009147 Bacteria 2655
141 Ga0114129_10539641 3300009147 Bacteria 1518
142 Ga0105243_10624201 3300009148 Bacteria 1041
143 Ga0105242_10213411 3300009176 Unclassified 1721
144 Ga0105242_10267830 3300009176 Bacteria 1546
145 Ga0105242_10883122 3300009176 Unclassified 892
146 Ga0105248_10167943 3300009177 Bacteria 2473
147 Ga0105249_10001780 3300009553 Bacteria 18768
148 Ga0105249_10002465 3300009553 Bacteria 16041
149 Ga0105249_10259371 3300009553 Bacteria 1726
150 Ga0105249_10517447 3300009553 Bacteria 1240
151 Ga0105239_11723943 3300010375 Bacteria 725
152 Ga0105246_10239917 3300011119 Bacteria 1432
153 Ga0157373_10323057 3300013100 Bacteria 1098
154 Ga0157373_10501473 3300013100 Unclassified 877
155 Ga0157371_10113323 3300013102 Unclassified 1926
156 Ga0157374_10001792 3300013296 Bacteria 18071
157 Ga0157374_10139688 3300013296 Bacteria 2351
158 Ga0157374_10577775 3300013296 Bacteria 1133
159 Ga0157374_10837508 3300013296 Bacteria 936
160 Ga0157378_10301661 3300013297 Bacteria 1550
161 Ga0157378_10463815 3300013297 Bacteria 1259
162 Ga0157378_10700590 3300013297 Bacteria 1032
163 Ga0163162_10032525 3300013306 Bacteria 5182
164 Ga0163162_10055495 3300013306 Unclassified 3989
165 Ga0163162_10069558 3300013306 Bacteria 3572
166 Ga0163162_10122863 3300013306 Bacteria 2701
167 Ga0163162_10145502 3300013306 Bacteria 2486
168 Ga0163162_11262237 3300013306 Bacteria 839
169 Ga0157372_10578246 3300013307 Bacteria 1309
170 Ga0157372_10723161 3300013307 Bacteria 1158
171 Ga0157375_10035998 3300013308 Bacteria 4730
172 Ga0157375_10037570 3300013308 Bacteria 4641
173 Ga0157375_10072202 3300013308 Bacteria 3467
174 Ga0157375_10189049 3300013308 Bacteria 2214
175 Ga0157375_10220170 3300013308 Bacteria 2056
176 Ga0157375_10682655 3300013308 Unclassified 1181
177 Ga0163163_10005369 3300014325 Bacteria 11073
178 Ga0157380_10001271 3300014326 Bacteria 16392
179 Ga0157380_10004706 3300014326 Bacteria 9499
180 Ga0157380_10017824 3300014326 Bacteria 5262
181 Ga0157380_10716874 3300014326 Bacteria 1007
182 Ga0157380_11037369 3300014326 Bacteria 856
183 Ga0157380_12175702 3300014326 Bacteria 618
184 Ga0157380_12291625 3300014326 Unclassified 604
185 Ga0157377_10005552 3300014745 Bacteria 5937
186 Ga0157377_10013498 3300014745 Bacteria 4135
187 Ga0157377_10153187 3300014745 Unclassified 1427
188 Ga0157377_10543905 3300014745 Bacteria 819
189 Ga0157379_10195075 3300014968 Bacteria 1830
190 Ga0157379_10478973 3300014968 Bacteria 1152
191 Ga0157376_10006975 3300014969 Bacteria 8014
192 Ga0157376_10583132 3300014969 Bacteria 1111
193 Ga0163161_10014435 3300017792 Bacteria 5499
194 Ga0163161_10019179 3300017792 Bacteria 4796
195 Ga0163161_10036533 3300017792 Bacteria 3518
196 Ga0163161_10183204 3300017792 Bacteria 1607
197 Ga0163161_10738096 3300017792 Bacteria 823
198 Ga0207682_10004429 3300025893 Bacteria 5878
199 Ga0207642_10526217 3300025899 Bacteria 727
200 Ga0207680_10049117 3300025903 Bacteria 2509
201 Ga0207647_10062445 3300025904 Bacteria 2270
202 Ga0207645_10142345 3300025907 Bacteria 1563
203 Ga0207645_10197764 3300025907 Bacteria 1322
204 Ga0207643_10007963 3300025908 Bacteria 5687
205 Ga0207643_10070691 3300025908 Bacteria 2008
206 Ga0207654_10716784 3300025911 Unclassified 719
207 Ga0207649_10315051 3300025920 Bacteria 1148
208 Ga0207681_10088429 3300025923 Bacteria 2206
209 Ga0207681_10226832 3300025923 Bacteria 1448
210 Ga0207681_10348974 3300025923 Bacteria 1184
211 Ga0207650_10783911 3300025925 Bacteria 807
212 Ga0207650_11033179 3300025925 Bacteria 699
213 Ga0207659_10048917 3300025926 Bacteria 2997
214 Ga0207659_10467502 3300025926 Bacteria 1064
215 Ga0207690_10011902 3300025932 Bacteria 5202
216 Ga0207690_10242145 3300025932 Bacteria 1390
217 Ga0207706_10005984 3300025933 Bacteria 11310
218 Ga0207706_10027175 3300025933 Bacteria 5118
219 Ga0207706_10083297 3300025933 Bacteria 2811
220 Ga0207706_10099760 3300025933 Bacteria 2555
221 Ga0207706_10197143 3300025933 Bacteria 1766
222 Ga0207686_10010993 3300025934 Bacteria 4940
223 Ga0207686_10057240 3300025934 Bacteria 2453
224 Ga0207670_10014263 3300025936 Bacteria 4711
225 Ga0207670_10028005 3300025936 Bacteria 3571
226 Ga0207670_10418803 3300025936 Bacteria 1074
227 Ga0207704_10076883 3300025938 Bacteria 2141
228 Ga0207691_10103953 3300025940 Bacteria 2532
229 Ga0207691_10162982 3300025940 Unclassified 1955
230 Ga0207711_10390179 3300025941 Bacteria 1293
231 Ga0207689_10012914 3300025942 Bacteria 7132
232 Ga0207689_10067440 3300025942 Bacteria 2940
233 Ga0207689_10099976 3300025942 Bacteria 2383
234 Ga0207689_10100540 3300025942 Bacteria 2376
235 Ga0207661_10147750 3300025944 Bacteria 2029
236 Ga0207661_10289343 3300025944 Bacteria 1466
237 Ga0207679_10003836 3300025945 Bacteria 9319
238 Ga0207651_10055160 3300025960 Bacteria 2728
239 Ga0207651_10066485 3300025960 Unclassified 2533
240 Ga0207651_10067043 3300025960 Bacteria 2524
241 Ga0207651_10134002 3300025960 Bacteria 1902
242 Ga0207651_10467176 3300025960 Bacteria 1085
243 Ga0207712_10000871 3300025961 Bacteria 21972
244 Ga0207712_10007619 3300025961 Bacteria 6842
245 Ga0207668_10030669 3300025972 Bacteria 3535
246 Ga0207640_11071495 3300025981 Unclassified 712
247 Ga0207658_10038151 3300025986 Bacteria 3459
248 Ga0207658_10145814 3300025986 Bacteria 1922
249 Ga0207658_10185956 3300025986 Bacteria 1723
250 Ga0207658_10216291 3300025986 Bacteria 1609
251 Ga0207677_10032647 3300026023 Bacteria 3349
252 Ga0207677_10315822 3300026023 Bacteria 1296
253 Ga0207703_10314397 3300026035 Bacteria 1432
254 Ga0207703_10348226 3300026035 Bacteria 1363
255 Ga0207639_10047298 3300026041 Bacteria 3250
256 Ga0207678_10085366 3300026067 Bacteria 2699
257 Ga0207708_10059529 3300026075 Bacteria 2915
258 Ga0207708_10119118 3300026075 Bacteria 2056
259 Ga0207708_10371920 3300026075 Bacteria 1177
260 Ga0207708_10536006 3300026075 Bacteria 985
261 Ga0207702_10557099 3300026078 Bacteria 1122
262 Ga0207641_10000539 3300026088 Bacteria 42499
263 Ga0207641_10048435 3300026088 Bacteria 3587
264 Ga0207641_10217841 3300026088 Bacteria 1769
265 Ga0207641_10230484 3300026088 Bacteria 1721
266 Ga0207641_10253606 3300026088 Bacteria 1644
267 Ga0207648_10033550 3300026089 Bacteria 4527
268 Ga0207648_10060649 3300026089 Bacteria 3298
269 Ga0207648_11345252 3300026089 Bacteria 671
270 Ga0207676_10206334 3300026095 Bacteria 1740
271 Ga0207676_10235848 3300026095 Unclassified 1638
272 Ga0207676_10616256 3300026095 Unclassified 1044
273 Ga0207674_10001383 3300026116 Bacteria 31265
274 Ga0207674_10009892 3300026116 Bacteria 10850
275 Ga0207674_10108516 3300026116 Unclassified 2752
276 Ga0207674_10190606 3300026116 Bacteria 2000
277 Ga0207674_10247863 3300026116 Bacteria 1728
278 Ga0207675_100039691 3300026118 Bacteria 4393
279 Ga0207683_10101190 3300026121 Bacteria 2573
280 Ga0207698_10092177 3300026142 Unclassified 2483
281 Ga0207698_11778580 3300026142 Unclassified 631
282 Ga0207428_10441483 3300027907 Bacteria 949
283 Ga0268266_10241982 3300028379 Bacteria 1666
284 Ga0268266_10259472 3300028379 Bacteria 1610
285 Ga0268265_10029427 3300028380 Bacteria 3942
286 Ga0268265_10159124 3300028380 Bacteria 1916
287 Ga0268264_10006949 3300028381 Bacteria 9496
288 Ga0268264_10288556 3300028381 Bacteria 1540
289 Ga0268264_10700422 3300028381 Bacteria 1006
290 Ga0307406_10040453 3300031901 Bacteria 2899
291 Ga0307412_10011841 3300031911 Bacteria 5064
292 Ga0307412_11064882 3300031911 Bacteria 718
293 Ga0307409_100030134 3300031995 Unclassified 3894
294 Ga0307416_100066279 3300032002 Bacteria 2972
295 Ga0307415_100140108 3300032126 Bacteria 1846
296 Ga0373944_0099922 3300035089 Unclassified 979
297 Ga0373923_0202827 3300035111 Unclassified 917
298 Ga0373956_0182591 3300035119 Unclassified 992
299 Ga0373946_0212712 3300035171 Unclassified 931
300 Ga0373955_0132072 3300035172 Bacteria 1458
301 Ga0373933_0090952 3300035724 Bacteria 1883
302 Ga0373937_0104511 3300036401 Bacteria 2631
303 Ga0373925_0255973 3300037068 Bacteria 1405
304 Ga0439453_0051051 3300041408 Bacteria 836
305 Ga0439441_002038 3300042001 Bacteria 2781
306 Ga0495580_0455872 3300046472 Unclassified 858
307 Ga0495608_0070103 3300046511 Bacteria 2288
308 Ga0495628_0041948 3300046516 Bacteria 3651
309 Ga0495630_0052024 3300046517 Bacteria 3066
310 Ga0495645_0103054 3300046543 Bacteria 2028
311 Ga0495634_0162698 3300046642 Bacteria 1406
312 Ga0495635_0146764 3300046663 Bacteria 1606
313 Ga0495613_0132985 3300046689 Bacteria 1781
314 Ga0495671_0058709 3300046692 Bacteria 1903
315 Ga0495600_0331793 3300046809 Unclassified 955
316 Ga0495680_0165243 3300047322 Bacteria 1605
317 Ga0495675_0487032 3300047444 Unclassified 709
318 Ga0495684_0204777 3300047471 Bacteria 1453
319 Ga0496104_0586798 3300048907 Bacteria 1025
320 Ga0496104_0639272 3300048907 Bacteria 973
321 Ga0496110_0076717 3300048913 Bacteria 2972
322 Ga0496110_0399347 3300048913 Bacteria 1253
323 Ga0496110_0551921 3300048913 Unclassified 1047
324 Ga0496113_0331661 3300048916 Bacteria 1220
325 Ga0496114_0315658 3300048917 Bacteria 1381
326 Ga0501032_0018509 3300049569 Bacteria 4879
327 Ga0501033_0032219 3300049570 Unclassified 3936
328 Ga0501034_0064423 3300049571 Bacteria 3679
329 Ga0501034_0811345 3300049571 Bacteria 828
330 Ga0501036_0232914 3300049572 Bacteria 1545
331 Ga0501037_0014583 3300049573 Bacteria 5781
332 Ga0501038_0039323 3300049574 Unclassified 4137
333 Ga0501043_0047520 3300049579 Unclassified 3375
334 Ga0501047_0039790 3300049581 Unclassified 4547
335 Ga0501035_0016542 3300049822 Bacteria 6800
336 Ga0501044_0159749 3300049823 Bacteria 2231
337 nmdc:mga09592_1014956_c1 3300050508 Unclassified 693
338 nmdc:mga09592_15546_c1 3300050508 Bacteria 6221
339 nmdc:mga0qj67_213088_c1 3300050509 Unclassified 1568
340 nmdc:mga0qj67_346297_c1 3300050509 Bacteria 1202
341 nmdc:mga06r32_111989_c1 3300050510 Unclassified 2686
342 nmdc:mga06r32_774049_c1 3300050510 Bacteria 922
343 nmdc:mga08y16_258779_c1 3300050511 Unclassified 1797
344 nmdc:mga08y16_399136_c1 3300050511 Bacteria 1408
345 nmdc:mga0n895_221665_c1 3300050512 Bacteria 1920
346 Ga0070689_100016606
347 MRS1b_contig_8141601
348 Ga0065712_10069313
349 Ga0065712_10070308
350 Ga0065712_10113278
351 Ga0065712_10396181
352 Ga0065715_10291536
353 Ga0065715_10459501
354 Ga0070683_100006461
355 Ga0070683_100076187
356 Ga0070690_100019248
357 Ga0070690_100072071
358 Ga0070670_100063814
359 Ga0070670_100147052
360 Ga0070670_101357272
361 Ga0070677_10395834
362 Ga0068869_100021236
363 Ga0068869_100051358
364 Ga0068869_100097513
365 Ga0068869_100649132
366 Ga0068869_100725793
367 Ga0070666_10044718
368 Ga0070682_100035458
369 Ga0068868_100015976
370 Ga0068868_100017334
371 Ga0068868_100781435
372 Ga0070689_100036801
373 Ga0070689_100086988
374 Ga0070661_100005613
375 Ga0070668_100204556
376 Ga0070669_100228750
377 Ga0070669_100440663
378 Ga0070675_100019322
379 Ga0070675_100054718
380 Ga0070675_100114868
381 Ga0070675_100174573
382 Ga0070671_100457242
383 Ga0070673_100094916
384 Ga0070673_100280261
385 Ga0070673_100288023
386 Ga0070673_100716506
387 Ga0070688_100015490
388 Ga0070688_100039824
389 Ga0070659_100058127
390 Ga0070701_10578742
391 Ga0070705_101123167
392 Ga0070700_100480258
393 Ga0070700_100640671
394 Ga0070678_100651898
395 Ga0070662_100008286
396 Ga0070662_100025190
397 Ga0070662_100077827
398 Ga0070662_100085163
399 Ga0070662_100224322
400 Ga0068867_100037722
401 Ga0068867_100042274
402 Ga0068867_100512480
403 Ga0070685_10002628
404 Ga0070685_10055800
405 Ga0070685_10068118
406 Ga0070685_10151724
407 Ga0070685_10283525
408 Ga0070698_100007300
409 Ga0070698_100012277
410 Ga0070698_101320244
411 Ga0070684_100001297
412 Ga0070684_100238383
413 Ga0070684_100534028
414 Ga0068853_100016975
415 Ga0070672_100103975
416 Ga0070672_100341151
417 Ga0070672_100457750
418 Ga0070686_100116010
419 Ga0070686_100759997
420 Ga0070695_100160574
421 Ga0070693_100450281
422 Ga0070665_100104167
423 Ga0070704_100128938
424 Ga0070664_100005627
425 Ga0070664_100036745
426 Ga0070664_100535652
427 Ga0070664_100621272
428 Ga0068857_100008296
429 Ga0068857_100222176
430 Ga0068857_100676833
431 Ga0068857_100760112
432 Ga0068856_100912627
433 Ga0068852_100706854
434 Ga0068852_101950431
435 Ga0068859_100060815
436 Ga0068859_100070703
437 Ga0068859_100081212
438 Ga0068859_100248077
439 Ga0068859_100376753
440 Ga0068859_100485789
441 Ga0068864_100009237
442 Ga0068864_100330651
443 Ga0068866_10223500
444 Ga0068870_10011584
445 Ga0068863_100000546
446 Ga0068863_100062274
447 Ga0068863_100191304
448 Ga0068863_100209756
449 Ga0068863_100844042
450 Ga0068858_100204177
451 Ga0068860_100016462
452 Ga0068860_100082883
453 Ga0068862_100029326
454 Ga0068862_100043348
455 Ga0070717_10772956
456 Ga0068871_100093843
457 Ga0068871_100252650
458 Ga0075428_100006212
459 Ga0075428_100090257
460 Ga0075428_100383924
461 Ga0075430_100017220
462 Ga0075430_100075871
463 Ga0075431_100047629
464 Ga0075431_100110507
465 Ga0075431_100117422
466 Ga0075434_100201514
467 Ga0068865_100191645
468 Ga0068865_100479042
469 Ga0068865_100730648
470 Ga0097620_100060814
471 Ga0097620_100070700
472 Ga0097620_100081212
473 Ga0097620_100248085
474 Ga0097620_100376729
475 Ga0097620_100485815
476 Ga0105251_10201525
477 Ga0105240_11031472
478 Ga0111539_10007515
479 Ga0111539_10073623
480 Ga0111539_10087464
481 Ga0111539_10282981
482 Ga0111539_10333533
483 Ga0111539_10472301
484 Ga0114129_10166810
485 Ga0114129_10206814
486 Ga0114129_10539641
487 Ga0105243_10624201
488 Ga0105242_10213411
489 Ga0105242_10267830
490 Ga0105242_10883122
491 Ga0105248_10167943
492 Ga0105249_10001780
493 Ga0105249_10002465
494 Ga0105249_10259371
495 Ga0105249_10517447
496 Ga0105239_11723943
497 Ga0105246_10239917
498 Ga0157373_10323057
499 Ga0157373_10501473
500 Ga0157371_10113323
501 Ga0157374_10001792
502 Ga0157374_10139688
503 Ga0157374_10577775
504 Ga0157374_10837508
505 Ga0157378_10301661
506 Ga0157378_10463815
507 Ga0157378_10700590
508 Ga0163162_10032525
509 Ga0163162_10055495
510 Ga0163162_10069558
511 Ga0163162_10122863
512 Ga0163162_10145502
513 Ga0163162_11262237
514 Ga0157372_10578246
515 Ga0157372_10723161
516 Ga0157375_10035998
517 Ga0157375_10037570
518 Ga0157375_10072202
519 Ga0157375_10189049
520 Ga0157375_10220170
521 Ga0157375_10682655
522 Ga0163163_10005369
523 Ga0157380_10001271
524 Ga0157380_10004706
525 Ga0157380_10017824
526 Ga0157380_10716874
527 Ga0157380_11037369
528 Ga0157380_12175702
529 Ga0157380_12291625
530 Ga0157377_10005552
531 Ga0157377_10013498
532 Ga0157377_10153187
533 Ga0157377_10543905
534 Ga0157379_10195075
535 Ga0157379_10478973
536 Ga0157376_10006975
537 Ga0157376_10583132
538 Ga0163161_10014435
539 Ga0163161_10019179
540 Ga0163161_10036533
541 Ga0163161_10183204
542 Ga0163161_10738096
543 Ga0207682_10004429
544 Ga0207642_10526217
545 Ga0207680_10049117
546 Ga0207647_10062445
547 Ga0207645_10142345
548 Ga0207645_10197764
549 Ga0207643_10007963
550 Ga0207643_10070691
551 Ga0207654_10716784
552 Ga0207649_10315051
553 Ga0207681_10088429
554 Ga0207681_10226832
555 Ga0207681_10348974
556 Ga0207650_10783911
557 Ga0207650_11033179
558 Ga0207659_10048917
559 Ga0207659_10467502
560 Ga0207690_10011902
561 Ga0207690_10242145
562 Ga0207706_10005984
563 Ga0207706_10027175
564 Ga0207706_10083297
565 Ga0207706_10099760
566 Ga0207706_10197143
567 Ga0207686_10010993
568 Ga0207686_10057240
569 Ga0207670_10014263
570 Ga0207670_10028005
571 Ga0207670_10418803
572 Ga0207704_10076883
573 Ga0207691_10103953
574 Ga0207691_10162982
575 Ga0207711_10390179
576 Ga0207689_10012914
577 Ga0207689_10067440
578 Ga0207689_10099976
579 Ga0207689_10100540
580 Ga0207661_10147750
581 Ga0207661_10289343
582 Ga0207679_10003836
583 Ga0207651_10055160
584 Ga0207651_10066485
585 Ga0207651_10067043
586 Ga0207651_10134002
587 Ga0207651_10467176
588 Ga0207712_10000871
589 Ga0207712_10007619
590 Ga0207668_10030669
591 Ga0207640_11071495
592 Ga0207658_10038151
593 Ga0207658_10145814
594 Ga0207658_10185956
595 Ga0207658_10216291
596 Ga0207677_10032647
597 Ga0207677_10315822
598 Ga0207703_10314397
599 Ga0207703_10348226
600 Ga0207639_10047298
601 Ga0207678_10085366
602 Ga0207708_10059529
603 Ga0207708_10119118
604 Ga0207708_10371920
605 Ga0207708_10536006
606 Ga0207702_10557099
607 Ga0207641_10000539
608 Ga0207641_10048435
609 Ga0207641_10217841
610 Ga0207641_10230484
611 Ga0207641_10253606
612 Ga0207648_10033550
613 Ga0207648_10060649
614 Ga0207648_11345252
615 Ga0207676_10206334
616 Ga0207676_10235848
617 Ga0207676_10616256
618 Ga0207674_10001383
619 Ga0207674_10009892
620 Ga0207674_10108516
621 Ga0207674_10190606
622 Ga0207674_10247863
623 Ga0207675_100039691
624 Ga0207683_10101190
625 Ga0207698_10092177
626 Ga0207698_11778580
627 Ga0207428_10441483
628 Ga0268266_10241982
629 Ga0268266_10259472
630 Ga0268265_10029427
631 Ga0268265_10159124
632 Ga0268264_10006949
633 Ga0268264_10288556
634 Ga0268264_10700422
635 Ga0307406_10040453
636 Ga0307412_10011841
637 Ga0307412_11064882
638 Ga0307409_100030134
639 Ga0307416_100066279
640 Ga0307415_100140108
641 Ga0373944_0099922
642 Ga0373923_0202827
643 Ga0373956_0182591
644 Ga0373946_0212712
645 Ga0373955_0132072
646 Ga0373933_0090952
647 Ga0373937_0104511
648 Ga0373925_0255973
649 Ga0439453_0051051
650 Ga0439441_002038
651 Ga0495580_0455872
652 Ga0495608_0070103
653 Ga0495628_0041948
654 Ga0495630_0052024
655 Ga0495645_0103054
656 Ga0495634_0162698
657 Ga0495635_0146764
658 Ga0495613_0132985
659 Ga0495671_0058709
660 Ga0495600_0331793
661 Ga0495680_0165243
662 Ga0495675_0487032
663 Ga0495684_0204777
664 Ga0496104_0586798
665 Ga0496104_0639272
666 Ga0496110_0076717
667 Ga0496110_0399347
668 Ga0496110_0551921
669 Ga0496113_0331661
670 Ga0496114_0315658
671 Ga0501032_0018509
672 Ga0501033_0032219
673 Ga0501034_0064423
674 Ga0501034_0811345
675 Ga0501036_0232914
676 Ga0501037_0014583
677 Ga0501038_0039323
678 Ga0501043_0047520
679 Ga0501047_0039790
680 Ga0501035_0016542
681 Ga0501044_0159749
682 nmdc:mga09592_1014956_c1
683 nmdc:mga09592_15546_c1
684 nmdc:mga0qj67_213088_c1
685 nmdc:mga0qj67_346297_c1
686 nmdc:mga06r32_111989_c1
687 nmdc:mga06r32_774049_c1
688 nmdc:mga08y16_258779_c1
689 nmdc:mga08y16_399136_c1
690 nmdc:mga0n895_221665_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

73

195

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pvp-assembly1.cif.gz_B-2 basis for a switch in substrate specificity: crystal structure of selected variant of cre site-specific recombinase, alshg bound to the engineered recognition site loxm7 0.4463 68 163
2klq-assembly1.cif.gz_A the solution structure of cbd of human mcm6 0.4055 78 157
2n9d-assembly1.cif.gz_A structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states 0.4036 43 159
2n9d-assembly1.cif.gz_A structure analysis of the tom1 gat domain reveals distinct ligand-specific conformational states 0.3842 43 159
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.3516 40 151
ID Description Score Start End Superfamily
2crxA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.5251 68 154 1.10.150.130
af_Q9S7T5_199_261_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4859 82 143 1.10.238.10
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.4794 68 154 1.10.150.130
af_Q9S7T5_199_261_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4575 82 143 1.10.238.10
af_A0A1D6F7X9_133_243_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4468 78 154 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7C7KKN2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9337 38 111
AF-A0A1D8P7B3-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9052 39 171 GO:0016020
AF-A0A4Q1BYZ8-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9027 39 171
AF-A0A0D3LM83-F1-model_v4 Twin-arginine translocation pathway signal 0.901 37 171
AF-A0A0P7C4Z2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8938 39 171

Map