F416244

General Info

Members Datasets Scaffolds Average Seq Length
345 216 690 402

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100070019|Ga0068868_1000700193
Length 420
Sequence LSTEGERTRAETMSEDVAEPPPWPTELTLTTGPPANGGSCVARHEGRVVFVRYALPGETVRVRVVGDHGSYWHADVVEVIEPSSDRIDPLCPIAGVDGAGCCDMAFAAPDASRRLKGAVVANQLARLGGYRWRDEDSAVAEPVGDGGATGWRTRVRLDTSGEGRAGFHRYHSSELVTELNCAQLPAGMLDGLNEWTWPPGAQLHVAIDDDGDRHVVQSGPRTGRKTSTLVVEGRYEAVQRVGERIWRVPVTAFWQAHRDAARVYSELVAGWAQLDPGMTAWDLYGGAGVFAAVLAEGVGEAGRVLSVDTSRGASRSARAALAGLGSVSVMTDSVRRALAAQTERADVAVLDPPRSGAGREVIDLLAAAEVPRVIHIGCEAASFARDVGLYLGHGYAVEDLQVFDSFPLTHHVECVAVLTR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
211 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
212 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
213 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
214 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
215 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
216 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.68
Metatranscriptomes 0.29
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 0.29
Rhizoplane 10.43
Rhizosphere 72.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100070019 3300005338 Bacteria 2796
2 JGI24744J21845_10000101 3300002077 Bacteria 11442
3 Ga0055540_1000871 3300003792 Bacteria 20021
4 Ga0070658_10000919 3300005327 Bacteria 25144
5 Ga0070676_10007654 3300005328 Bacteria 5805
6 Ga0070683_100069741 3300005329 Bacteria 3278
7 Ga0068869_100011935 3300005334 Bacteria 5717
8 Ga0070666_10103108 3300005335 Bacteria 1968
9 Ga0068868_100001581 3300005338 Bacteria 15529
10 Ga0070689_100057962 3300005340 Bacteria 3007
11 Ga0070691_10001897 3300005341 Bacteria 9165
12 Ga0070691_10014196 3300005341 Bacteria 3653
13 Ga0070692_10046367 3300005345 Bacteria 2246
14 Ga0070692_10073459 3300005345 Bacteria 1827
15 Ga0070668_100000513 3300005347 Bacteria 25668
16 Ga0070669_100002410 3300005353 Bacteria 13537
17 Ga0070671_100028710 3300005355 Bacteria 4583
18 Ga0070671_100035114 3300005355 Bacteria 4153
19 Ga0070671_100036218 3300005355 Bacteria 4091
20 Ga0070674_100002997 3300005356 Bacteria 9385
21 Ga0070674_100054209 3300005356 Bacteria 2772
22 Ga0070688_100016237 3300005365 Bacteria 4253
23 Ga0070659_100043794 3300005366 Bacteria 3502
24 Ga0070659_100045829 3300005366 Bacteria 3426
25 Ga0070667_100000462 3300005367 Bacteria 41814
26 Ga0070667_100007116 3300005367 Bacteria 9302
27 Ga0070667_100013809 3300005367 Bacteria 6677
28 Ga0070667_100014974 3300005367 Bacteria 6407
29 Ga0070714_100054964 3300005435 Bacteria 3402
30 Ga0070713_100146499 3300005436 Bacteria 2097
31 Ga0070710_10000531 3300005437 Bacteria 17989
32 Ga0070710_10011347 3300005437 Bacteria 4402
33 Ga0070701_10001115 3300005438 Bacteria 9808
34 Ga0070701_10081507 3300005438 Bacteria 1753
35 Ga0070711_100000855 3300005439 Bacteria 16011
36 Ga0070705_100004295 3300005440 Bacteria 6946
37 Ga0070700_100003910 3300005441 Bacteria 7737
38 Ga0070694_100003548 3300005444 Bacteria 9330
39 Ga0070663_100006392 3300005455 Bacteria 7084
40 Ga0070678_100000475 3300005456 Bacteria 19227
41 Ga0070662_100001297 3300005457 Bacteria 15361
42 Ga0068867_100003106 3300005459 Bacteria 11704
43 Ga0070685_10028372 3300005466 Bacteria 3100
44 Ga0070672_100033142 3300005543 Bacteria 3908
45 Ga0070695_100000632 3300005545 Bacteria 18670
46 Ga0070696_100183467 3300005546 Bacteria 1553
47 Ga0070693_100001889 3300005547 Bacteria 9572
48 Ga0070665_100004564 3300005548 Bacteria 14511
49 Ga0070665_100006199 3300005548 Bacteria 12240
50 Ga0070665_100016829 3300005548 Bacteria 7331
51 Ga0070665_100043027 3300005548 Bacteria 4541
52 Ga0070704_100000532 3300005549 Bacteria 18257
53 Ga0070704_100026652 3300005549 Bacteria 3823
54 Ga0068854_100000639 3300005578 Bacteria 20736
55 Ga0070702_100000530 3300005615 Bacteria 13772
56 Ga0068859_100000837 3300005617 Bacteria 31230
57 Ga0068859_100001567 3300005617 Bacteria 23316
58 Ga0068859_100035432 3300005617 Bacteria 5007
59 Ga0068866_10000438 3300005718 Bacteria 19265
60 Ga0068861_100001027 3300005719 Bacteria 17086
61 Ga0068863_100000305 3300005841 Bacteria 50559
62 Ga0068863_100000794 3300005841 Bacteria 31746
63 Ga0068858_100003465 3300005842 Bacteria 15640
64 Ga0068858_100044768 3300005842 Bacteria 4102
65 Ga0068860_100000287 3300005843 Bacteria 71871
66 Ga0068860_100001844 3300005843 Bacteria 22572
67 Ga0068862_100000296 3300005844 Bacteria 54630
68 Ga0068862_100002144 3300005844 Bacteria 17758
69 Ga0068862_100153311 3300005844 Bacteria 2052
70 Ga0081455_10061556 3300005937 Bacteria 3158
71 Ga0081540_1002201 3300005983 Bacteria 16102
72 Ga0075365_10010625 3300006038 Bacteria 5375
73 Ga0075363_100001085 3300006048 Bacteria 9847
74 Ga0075363_100023836 3300006048 Bacteria 3106
75 Ga0075363_100047320 3300006048 Bacteria 2284
76 Ga0070715_10004094 3300006163 Bacteria 4740
77 Ga0070715_10027928 3300006163 Bacteria 2258
78 Ga0070716_100004791 3300006173 Bacteria 6496
79 Ga0070712_100001875 3300006175 Bacteria 12822
80 Ga0070712_100007056 3300006175 Bacteria 7005
81 Ga0075362_10080355 3300006177 Bacteria 1502
82 Ga0075367_10046367 3300006178 Bacteria 2553
83 Ga0075369_10001004 3300006186 Bacteria 9399
84 Ga0075369_10010174 3300006186 Bacteria 3675
85 Ga0075369_10016133 3300006186 Bacteria 3008
86 Ga0075369_10064639 3300006186 Bacteria 1602
87 Ga0075370_10005827 3300006353 Bacteria 6156
88 Ga0075370_10118344 3300006353 Bacteria 1541
89 Ga0068871_100014057 3300006358 Bacteria 5954
90 Ga0075428_100021611 3300006844 Bacteria 7124
91 Ga0075430_100035186 3300006846 Bacteria 4250
92 Ga0075431_100017919 3300006847 Bacteria 7203
93 Ga0068865_100000794 3300006881 Bacteria 17764
94 Ga0097620_100000837 3300006931 Bacteria 31230
95 Ga0097620_100001567 3300006931 Bacteria 23316
96 Ga0097620_100035432 3300006931 Bacteria 5007
97 Ga0099795_10005348 3300007788 Bacteria 3406
98 Ga0111539_10334911 3300009094 Bacteria 1762
99 Ga0105245_10001575 3300009098 Bacteria 20704
100 Ga0105247_10000134 3300009101 Bacteria 71986
101 Ga0105247_10000857 3300009101 Bacteria 23031
102 Ga0105247_10052469 3300009101 Bacteria 2514
103 Ga0114129_10021612 3300009147 Bacteria 9133
104 Ga0105243_10001317 3300009148 Bacteria 22131
105 Ga0105243_10102156 3300009148 Bacteria 2382
106 Ga0105241_10233159 3300009174 Bacteria 1553
107 Ga0105248_10000181 3300009177 Bacteria 73501
108 Ga0105248_10008680 3300009177 Bacteria 11166
109 Ga0105248_10094174 3300009177 Bacteria 3373
110 Ga0105249_10000189 3300009553 Bacteria 70627
111 Ga0099796_10011705 3300010159 Bacteria 2456
112 Ga0105239_10009252 3300010375 Bacteria 11138
113 Ga0105239_10222303 3300010375 Bacteria 2118
114 Ga0105246_10050383 3300011119 Bacteria 2856
115 Ga0157369_10012856 3300013105 Bacteria 9488
116 Ga0157369_10267916 3300013105 Bacteria 1780
117 Ga0157378_10003249 3300013297 Bacteria 14455
118 Ga0163162_10005695 3300013306 Bacteria 12040
119 Ga0163162_10263997 3300013306 Bacteria 1853
120 Ga0157372_10004231 3300013307 Bacteria 15349
121 Ga0157375_10003624 3300013308 Bacteria 13395
122 Ga0157380_10001153 3300014326 Bacteria 17083
123 Ga0157379_10032020 3300014968 Bacteria 4686
124 Ga0163161_10001096 3300017792 Bacteria 20479
125 Ga0206353_10023591 3300020082 Bacteria 7251
126 Ga0213876_10008212 3300021384 Bacteria 5651
127 Ga0213876_10020629 3300021384 Bacteria 3483
128 Ga0209051_1000612 3300025303 Bacteria 41270
129 Ga0209051_1000905 3300025303 Bacteria 29540
130 Ga0209051_1000965 3300025303 Bacteria 28164
131 Ga0207692_10000243 3300025898 Bacteria 18524
132 Ga0207642_10000860 3300025899 Bacteria 9456
133 Ga0207710_10000163 3300025900 Bacteria 70646
134 Ga0207710_10007335 3300025900 Bacteria 4673
135 Ga0207688_10002517 3300025901 Bacteria 9880
136 Ga0207688_10016717 3300025901 Bacteria 3983
137 Ga0207680_10011183 3300025903 Bacteria 4523
138 Ga0207685_10001870 3300025905 Bacteria 4624
139 Ga0207685_10021862 3300025905 Bacteria 2151
140 Ga0207699_10008831 3300025906 Bacteria 4992
141 Ga0207645_10019221 3300025907 Bacteria 4481
142 Ga0207693_10002644 3300025915 Bacteria 15565
143 Ga0207693_10004566 3300025915 Bacteria 11688
144 Ga0207663_10015045 3300025916 Bacteria 4257
145 Ga0207681_10004973 3300025923 Bacteria 8168
146 Ga0207681_10009709 3300025923 Bacteria 5891
147 Ga0207687_10000807 3300025927 Bacteria 21161
148 Ga0207700_10172036 3300025928 Bacteria 1808
149 Ga0207644_10185707 3300025931 Bacteria 1632
150 Ga0207690_10016440 3300025932 Bacteria 4501
151 Ga0207706_10007547 3300025933 Bacteria 10063
152 Ga0207706_10097413 3300025933 Bacteria 2587
153 Ga0207709_10001513 3300025935 Bacteria 16052
154 Ga0207670_10074144 3300025936 Bacteria 2361
155 Ga0207669_10000307 3300025937 Bacteria 22365
156 Ga0207704_10001745 3300025938 Bacteria 9743
157 Ga0207665_10008439 3300025939 Bacteria 6789
158 Ga0207665_10009064 3300025939 Bacteria 6532
159 Ga0207665_10091815 3300025939 Bacteria 2106
160 Ga0207665_10189511 3300025939 Bacteria 1493
161 Ga0207691_10122392 3300025940 Bacteria 2304
162 Ga0207711_10000214 3300025941 Bacteria 62139
163 Ga0207711_10098414 3300025941 Bacteria 2585
164 Ga0207689_10010078 3300025942 Bacteria 8144
165 Ga0207689_10023491 3300025942 Bacteria 5174
166 Ga0207661_10052374 3300025944 Bacteria 3261
167 Ga0207667_10267895 3300025949 Bacteria 1746
168 Ga0207712_10000006 3300025961 Bacteria 573204
169 Ga0207712_10004854 3300025961 Bacteria 8498
170 Ga0207668_10000927 3300025972 Bacteria 17604
171 Ga0207668_10071605 3300025972 Bacteria 2477
172 Ga0207640_10001968 3300025981 Bacteria 11073
173 Ga0207640_10094295 3300025981 Bacteria 2081
174 Ga0207658_10000477 3300025986 Bacteria 37087
175 Ga0207658_10028500 3300025986 Bacteria 3932
176 Ga0207658_10083865 3300025986 Bacteria 2451
177 Ga0207658_10114164 3300025986 Bacteria 2141
178 Ga0207658_10217768 3300025986 Bacteria 1604
179 Ga0207658_10336778 3300025986 Bacteria 1310
180 Ga0207677_10005730 3300026023 Bacteria 6755
181 Ga0207703_10004346 3300026035 Bacteria 11645
182 Ga0207639_10066175 3300026041 Bacteria 2808
183 Ga0207678_10006701 3300026067 Bacteria 10214
184 Ga0207708_10003793 3300026075 Bacteria 11149
185 Ga0207708_10007338 3300026075 Bacteria 8146
186 Ga0207641_10006734 3300026088 Bacteria 9629
187 Ga0207641_10020838 3300026088 Bacteria 5388
188 Ga0207641_10037520 3300026088 Bacteria 4048
189 Ga0207641_10052202 3300026088 Bacteria 3462
190 Ga0207648_10010674 3300026089 Bacteria 8682
191 Ga0207648_10021557 3300026089 Bacteria 5791
192 Ga0207675_100005908 3300026118 Bacteria 11679
193 Ga0207683_10003572 3300026121 Bacteria 13564
194 Ga0207683_10060897 3300026121 Bacteria 3320
195 Ga0207698_10445702 3300026142 Bacteria 1248
196 Ga0268266_10005210 3300028379 Bacteria 12232
197 Ga0268266_10023677 3300028379 Bacteria 5227
198 Ga0268265_10000192 3300028380 Bacteria 71772
199 Ga0268265_10044891 3300028380 Bacteria 3294
200 Ga0268264_10000339 3300028381 Bacteria 71891
201 Ga0268264_10002354 3300028381 Bacteria 16689
202 Ga0307409_100222572 3300031995 Bacteria 1705
203 Ga0373931_0016757 3300035691 Bacteria 3613
204 Ga0373947_0032430 3300035725 Bacteria 3079
205 Ga0316584_0150385 3300036712 Bacteria 1733
206 Ga0436364_1132689 3300037853 Bacteria 8446
207 Ga0436365_0863130 3300039437 Bacteria 48169
208 Ga0436365_1167796 3300039437 Bacteria 11139
209 Ga0436365_1499581 3300039437 Bacteria 19401
210 Ga0436363_0089200 3300039450 Bacteria 1589
211 Ga0439465_0008089 3300041413 Bacteria 3323
212 Ga0439465_0048443 3300041413 Bacteria 1386
213 Ga0451793_1479983 3300041452 Bacteria 1240
214 Ga0451795_0421307 3300041456 Bacteria 1303
215 Ga0439442_013355 3300042002 Bacteria 1684
216 Ga0466969_0009873 3300044656 Bacteria 5061
217 Ga0466972_0007542 3300044658 Bacteria 5460
218 Ga0466965_0002331 3300044683 Bacteria 8023
219 Ga0466965_0097907 3300044683 Bacteria 1497
220 Ga0466966_0011500 3300044684 Bacteria 5871
221 Ga0466961_0050282 3300044693 Bacteria 2662
222 Ga0466963_0001518 3300044694 Bacteria 12562
223 Ga0466963_0014160 3300044694 Bacteria 4914
224 Ga0466963_0162065 3300044694 Bacteria 1557
225 Ga0466968_0015440 3300044735 Bacteria 3026
226 Ga0466968_0020435 3300044735 Bacteria 2673
227 Ga0466957_0013352 3300044842 Bacteria 4765
228 Ga0466957_0083853 3300044842 Bacteria 1989
229 Ga0466957_0090626 3300044842 Bacteria 1915
230 Ga0466960_0000301 3300044901 Bacteria 17232
231 Ga0466959_0002707 3300045049 Bacteria 11386
232 Ga0466959_0061389 3300045049 Bacteria 2733
233 Ga0466959_0107411 3300045049 Bacteria 1995
234 Ga0466958_0003337 3300045836 Bacteria 8315
235 Ga0466958_0023957 3300045836 Bacteria 3589
236 Ga0466967_0002204 3300045976 Bacteria 11983
237 Ga0466967_0022970 3300045976 Bacteria 5102
238 Ga0466967_0040038 3300045976 Bacteria 4033
239 Ga0466967_0098783 3300045976 Bacteria 2665
240 Ga0466967_0168974 3300045976 Bacteria 2056
241 Ga0466967_0309411 3300045976 Bacteria 1522
242 Ga0495629_0003916 3300046459 Bacteria 11202
243 Ga0495638_0007001 3300046460 Bacteria 8133
244 Ga0495582_0011120 3300046473 Bacteria 4956
245 Ga0495648_0000665 3300046524 Bacteria 36750
246 Ga0495640_0012764 3300046533 Bacteria 6413
247 Ga0495613_0132999 3300046689 Bacteria 1781
248 Ga0495672_0014454 3300047320 Bacteria 5405
249 Ga0495673_0009311 3300047469 Bacteria 5442
250 Ga0495686_0001716 3300047472 Bacteria 22588
251 Ga0495593_0005683 3300047673 Bacteria 7359
252 Ga0496100_0001797 3300048903 Bacteria 10703
253 Ga0496100_0002313 3300048903 Bacteria 9646
254 Ga0496100_0027631 3300048903 Bacteria 3491
255 Ga0496100_0100537 3300048903 Bacteria 1992
256 Ga0496101_0000932 3300048904 Bacteria 17246
257 Ga0496101_0021583 3300048904 Bacteria 4425
258 Ga0496101_0162119 3300048904 Bacteria 1715
259 Ga0496101_0183346 3300048904 Bacteria 1613
260 Ga0496102_0000509 3300048905 Bacteria 42554
261 Ga0496102_0003648 3300048905 Bacteria 13024
262 Ga0496102_0003845 3300048905 Bacteria 12709
263 Ga0496102_0058031 3300048905 Bacteria 3536
264 Ga0496103_0000215 3300048906 Bacteria 57372
265 Ga0496103_0000639 3300048906 Bacteria 26650
266 Ga0496105_0133047 3300048908 Bacteria 2049
267 Ga0496106_0007447 3300048909 Bacteria 8088
268 Ga0496106_0011138 3300048909 Bacteria 6652
269 Ga0496107_0000775 3300048910 Bacteria 18484
270 Ga0496107_0047118 3300048910 Bacteria 3104
271 Ga0496107_0064158 3300048910 Bacteria 2663
272 Ga0496108_0010275 3300048911 Bacteria 7599
273 Ga0496109_0004623 3300048912 Bacteria 11491
274 Ga0496109_0024147 3300048912 Bacteria 5401
275 Ga0496110_0147504 3300048913 Bacteria 2129
276 Ga0496110_0217812 3300048913 Bacteria 1736
277 Ga0496112_0007118 3300048915 Bacteria 9896
278 Ga0496112_0034862 3300048915 Bacteria 4898
279 Ga0496112_0063556 3300048915 Bacteria 3641
280 Ga0496112_0069718 3300048915 Bacteria 3473
281 Ga0496112_0070862 3300048915 Bacteria 3445
282 Ga0496112_0204480 3300048915 Bacteria 1933
283 Ga0496113_0009205 3300048916 Bacteria 6478
284 Ga0496114_0002904 3300048917 Bacteria 13136
285 Ga0496115_0001024 3300048918 Bacteria 20281
286 Ga0496116_0007190 3300048919 Bacteria 9944
287 Ga0496117_0000874 3300048920 Bacteria 46484
288 Ga0496117_0031792 3300048920 Bacteria 4024
289 Ga0496118_0001040 3300048921 Bacteria 43213
290 Ga0496118_0001451 3300048921 Bacteria 35702
291 Ga0496119_0003818 3300048922 Bacteria 15395
292 Ga0496119_0162668 3300048922 Bacteria 1185
293 Ga0496120_0027229 3300048923 Bacteria 3520
294 Ga0496121_0005689 3300048924 Bacteria 15845
295 Ga0496122_0013811 3300048925 Bacteria 7865
296 Ga0496123_0017289 3300048926 Bacteria 5811
297 Ga0496124_0100574 3300048927 Bacteria 2343
298 Ga0496126_0006984 3300048929 Bacteria 12477
299 Ga0496126_0009192 3300048929 Bacteria 10542
300 Ga0496126_0015050 3300048929 Bacteria 7796
301 Ga0501032_0000516 3300049569 Bacteria 31374
302 Ga0501033_0164265 3300049570 Bacteria 1597
303 Ga0501034_0003109 3300049571 Bacteria 19140
304 Ga0501034_0005269 3300049571 Bacteria 14191
305 Ga0501037_0000165 3300049573 Bacteria 62545
306 Ga0501037_0003789 3300049573 Bacteria 10972
307 Ga0501038_0000292 3300049574 Bacteria 42699
308 Ga0501039_0000485 3300049575 Bacteria 28766
309 Ga0501043_0003108 3300049579 Bacteria 13761
310 Ga0501046_0002821 3300049580 Bacteria 16183
311 Ga0501047_0003048 3300049581 Bacteria 15901
312 Ga0501047_0063619 3300049581 Bacteria 3559
313 Ga0501048_0012870 3300049582 Bacteria 6214
314 Ga0501070_0000573 3300049586 Bacteria 33479
315 Ga0501070_0003192 3300049586 Bacteria 14259
316 Ga0501072_0242046 3300049588 Bacteria 1437
317 Ga0501072_0244626 3300049588 Bacteria 1429
318 Ga0501035_0000921 3300049822 Bacteria 31170
319 Ga0501035_0004178 3300049822 Bacteria 13726
320 Ga0501044_0000239 3300049823 Bacteria 69462
321 Ga0501044_0001384 3300049823 Bacteria 28445
322 nmdc:mga03n38_22996_c1 3300050490 Bacteria 2531
323 nmdc:mga03n38_33780_c1 3300050490 Bacteria 2179
324 nmdc:mga03n38_8588_c1 3300050490 Bacteria 3673
325 nmdc:mga00v17_176823_c1 3300050491 Bacteria 1377
326 nmdc:mga0yw44_11902_c1 3300050492 Bacteria 4515
327 nmdc:mga0yw44_18631_c1 3300050492 Bacteria 3808
328 nmdc:mga0yw44_21607_c1 3300050492 Bacteria 3593
329 nmdc:mga0yw44_87553_c1 3300050492 Bacteria 1963
330 nmdc:mga05p37_65054_c1 3300050507 Bacteria 4487
331 nmdc:mga0qj67_18923_c1 3300050509 Bacteria 5255
332 nmdc:mga0sz30_1808_c1 3300050516 Bacteria 6574
333 nmdc:mga0sz30_2732_c1 3300050516 Bacteria 6300
334 nmdc:mga0sz30_30024_c1 3300050516 Bacteria 2244
335 nmdc:mga0sz30_50491_c1 3300050516 Bacteria 1763
336 Ga0500635_0004978 3300053080 Bacteria 3457
337 Ga0495619_0020391 3300053085 Bacteria 4221
338 Ga0500645_000588 3300053730 Bacteria 23471
339 2644486252 2643221687 Bacteria 6500351
340 2738705303 2738541274 Bacteria 6909446
341 2739334592 2738543028 Bacteria 6917070
342 2842138237 2842134933 Bacteria 5847019
343 2902801400 2902799365 Bacteria 5419524
344 2902840339 2902837492 Bacteria 6697721
345 2929215190 2929212328 Bacteria 7708288
346 Ga0068868_100070019
347 JGI24744J21845_10000101
348 Ga0055540_1000871
349 Ga0070658_10000919
350 Ga0070676_10007654
351 Ga0070683_100069741
352 Ga0068869_100011935
353 Ga0070666_10103108
354 Ga0068868_100001581
355 Ga0070689_100057962
356 Ga0070691_10001897
357 Ga0070691_10014196
358 Ga0070692_10046367
359 Ga0070692_10073459
360 Ga0070668_100000513
361 Ga0070669_100002410
362 Ga0070671_100028710
363 Ga0070671_100035114
364 Ga0070671_100036218
365 Ga0070674_100002997
366 Ga0070674_100054209
367 Ga0070688_100016237
368 Ga0070659_100043794
369 Ga0070659_100045829
370 Ga0070667_100000462
371 Ga0070667_100007116
372 Ga0070667_100013809
373 Ga0070667_100014974
374 Ga0070714_100054964
375 Ga0070713_100146499
376 Ga0070710_10000531
377 Ga0070710_10011347
378 Ga0070701_10001115
379 Ga0070701_10081507
380 Ga0070711_100000855
381 Ga0070705_100004295
382 Ga0070700_100003910
383 Ga0070694_100003548
384 Ga0070663_100006392
385 Ga0070678_100000475
386 Ga0070662_100001297
387 Ga0068867_100003106
388 Ga0070685_10028372
389 Ga0070672_100033142
390 Ga0070695_100000632
391 Ga0070696_100183467
392 Ga0070693_100001889
393 Ga0070665_100004564
394 Ga0070665_100006199
395 Ga0070665_100016829
396 Ga0070665_100043027
397 Ga0070704_100000532
398 Ga0070704_100026652
399 Ga0068854_100000639
400 Ga0070702_100000530
401 Ga0068859_100000837
402 Ga0068859_100001567
403 Ga0068859_100035432
404 Ga0068866_10000438
405 Ga0068861_100001027
406 Ga0068863_100000305
407 Ga0068863_100000794
408 Ga0068858_100003465
409 Ga0068858_100044768
410 Ga0068860_100000287
411 Ga0068860_100001844
412 Ga0068862_100000296
413 Ga0068862_100002144
414 Ga0068862_100153311
415 Ga0081455_10061556
416 Ga0081540_1002201
417 Ga0075365_10010625
418 Ga0075363_100001085
419 Ga0075363_100023836
420 Ga0075363_100047320
421 Ga0070715_10004094
422 Ga0070715_10027928
423 Ga0070716_100004791
424 Ga0070712_100001875
425 Ga0070712_100007056
426 Ga0075362_10080355
427 Ga0075367_10046367
428 Ga0075369_10001004
429 Ga0075369_10010174
430 Ga0075369_10016133
431 Ga0075369_10064639
432 Ga0075370_10005827
433 Ga0075370_10118344
434 Ga0068871_100014057
435 Ga0075428_100021611
436 Ga0075430_100035186
437 Ga0075431_100017919
438 Ga0068865_100000794
439 Ga0097620_100000837
440 Ga0097620_100001567
441 Ga0097620_100035432
442 Ga0099795_10005348
443 Ga0111539_10334911
444 Ga0105245_10001575
445 Ga0105247_10000134
446 Ga0105247_10000857
447 Ga0105247_10052469
448 Ga0114129_10021612
449 Ga0105243_10001317
450 Ga0105243_10102156
451 Ga0105241_10233159
452 Ga0105248_10000181
453 Ga0105248_10008680
454 Ga0105248_10094174
455 Ga0105249_10000189
456 Ga0099796_10011705
457 Ga0105239_10009252
458 Ga0105239_10222303
459 Ga0105246_10050383
460 Ga0157369_10012856
461 Ga0157369_10267916
462 Ga0157378_10003249
463 Ga0163162_10005695
464 Ga0163162_10263997
465 Ga0157372_10004231
466 Ga0157375_10003624
467 Ga0157380_10001153
468 Ga0157379_10032020
469 Ga0163161_10001096
470 Ga0206353_10023591
471 Ga0213876_10008212
472 Ga0213876_10020629
473 Ga0209051_1000612
474 Ga0209051_1000905
475 Ga0209051_1000965
476 Ga0207692_10000243
477 Ga0207642_10000860
478 Ga0207710_10000163
479 Ga0207710_10007335
480 Ga0207688_10002517
481 Ga0207688_10016717
482 Ga0207680_10011183
483 Ga0207685_10001870
484 Ga0207685_10021862
485 Ga0207699_10008831
486 Ga0207645_10019221
487 Ga0207693_10002644
488 Ga0207693_10004566
489 Ga0207663_10015045
490 Ga0207681_10004973
491 Ga0207681_10009709
492 Ga0207687_10000807
493 Ga0207700_10172036
494 Ga0207644_10185707
495 Ga0207690_10016440
496 Ga0207706_10007547
497 Ga0207706_10097413
498 Ga0207709_10001513
499 Ga0207670_10074144
500 Ga0207669_10000307
501 Ga0207704_10001745
502 Ga0207665_10008439
503 Ga0207665_10009064
504 Ga0207665_10091815
505 Ga0207665_10189511
506 Ga0207691_10122392
507 Ga0207711_10000214
508 Ga0207711_10098414
509 Ga0207689_10010078
510 Ga0207689_10023491
511 Ga0207661_10052374
512 Ga0207667_10267895
513 Ga0207712_10000006
514 Ga0207712_10004854
515 Ga0207668_10000927
516 Ga0207668_10071605
517 Ga0207640_10001968
518 Ga0207640_10094295
519 Ga0207658_10000477
520 Ga0207658_10028500
521 Ga0207658_10083865
522 Ga0207658_10114164
523 Ga0207658_10217768
524 Ga0207658_10336778
525 Ga0207677_10005730
526 Ga0207703_10004346
527 Ga0207639_10066175
528 Ga0207678_10006701
529 Ga0207708_10003793
530 Ga0207708_10007338
531 Ga0207641_10006734
532 Ga0207641_10020838
533 Ga0207641_10037520
534 Ga0207641_10052202
535 Ga0207648_10010674
536 Ga0207648_10021557
537 Ga0207675_100005908
538 Ga0207683_10003572
539 Ga0207683_10060897
540 Ga0207698_10445702
541 Ga0268266_10005210
542 Ga0268266_10023677
543 Ga0268265_10000192
544 Ga0268265_10044891
545 Ga0268264_10000339
546 Ga0268264_10002354
547 Ga0307409_100222572
548 Ga0373931_0016757
549 Ga0373947_0032430
550 Ga0316584_0150385
551 Ga0436364_1132689
552 Ga0436365_0863130
553 Ga0436365_1167796
554 Ga0436365_1499581
555 Ga0436363_0089200
556 Ga0439465_0008089
557 Ga0439465_0048443
558 Ga0451793_1479983
559 Ga0451795_0421307
560 Ga0439442_013355
561 Ga0466969_0009873
562 Ga0466972_0007542
563 Ga0466965_0002331
564 Ga0466965_0097907
565 Ga0466966_0011500
566 Ga0466961_0050282
567 Ga0466963_0001518
568 Ga0466963_0014160
569 Ga0466963_0162065
570 Ga0466968_0015440
571 Ga0466968_0020435
572 Ga0466957_0013352
573 Ga0466957_0083853
574 Ga0466957_0090626
575 Ga0466960_0000301
576 Ga0466959_0002707
577 Ga0466959_0061389
578 Ga0466959_0107411
579 Ga0466958_0003337
580 Ga0466958_0023957
581 Ga0466967_0002204
582 Ga0466967_0022970
583 Ga0466967_0040038
584 Ga0466967_0098783
585 Ga0466967_0168974
586 Ga0466967_0309411
587 Ga0495629_0003916
588 Ga0495638_0007001
589 Ga0495582_0011120
590 Ga0495648_0000665
591 Ga0495640_0012764
592 Ga0495613_0132999
593 Ga0495672_0014454
594 Ga0495673_0009311
595 Ga0495686_0001716
596 Ga0495593_0005683
597 Ga0496100_0001797
598 Ga0496100_0002313
599 Ga0496100_0027631
600 Ga0496100_0100537
601 Ga0496101_0000932
602 Ga0496101_0021583
603 Ga0496101_0162119
604 Ga0496101_0183346
605 Ga0496102_0000509
606 Ga0496102_0003648
607 Ga0496102_0003845
608 Ga0496102_0058031
609 Ga0496103_0000215
610 Ga0496103_0000639
611 Ga0496105_0133047
612 Ga0496106_0007447
613 Ga0496106_0011138
614 Ga0496107_0000775
615 Ga0496107_0047118
616 Ga0496107_0064158
617 Ga0496108_0010275
618 Ga0496109_0004623
619 Ga0496109_0024147
620 Ga0496110_0147504
621 Ga0496110_0217812
622 Ga0496112_0007118
623 Ga0496112_0034862
624 Ga0496112_0063556
625 Ga0496112_0069718
626 Ga0496112_0070862
627 Ga0496112_0204480
628 Ga0496113_0009205
629 Ga0496114_0002904
630 Ga0496115_0001024
631 Ga0496116_0007190
632 Ga0496117_0000874
633 Ga0496117_0031792
634 Ga0496118_0001040
635 Ga0496118_0001451
636 Ga0496119_0003818
637 Ga0496119_0162668
638 Ga0496120_0027229
639 Ga0496121_0005689
640 Ga0496122_0013811
641 Ga0496123_0017289
642 Ga0496124_0100574
643 Ga0496126_0006984
644 Ga0496126_0009192
645 Ga0496126_0015050
646 Ga0501032_0000516
647 Ga0501033_0164265
648 Ga0501034_0003109
649 Ga0501034_0005269
650 Ga0501037_0000165
651 Ga0501037_0003789
652 Ga0501038_0000292
653 Ga0501039_0000485
654 Ga0501043_0003108
655 Ga0501046_0002821
656 Ga0501047_0003048
657 Ga0501047_0063619
658 Ga0501048_0012870
659 Ga0501070_0000573
660 Ga0501070_0003192
661 Ga0501072_0242046
662 Ga0501072_0244626
663 Ga0501035_0000921
664 Ga0501035_0004178
665 Ga0501044_0000239
666 Ga0501044_0001384
667 nmdc:mga03n38_22996_c1
668 nmdc:mga03n38_33780_c1
669 nmdc:mga03n38_8588_c1
670 nmdc:mga00v17_176823_c1
671 nmdc:mga0yw44_11902_c1
672 nmdc:mga0yw44_18631_c1
673 nmdc:mga0yw44_21607_c1
674 nmdc:mga0yw44_87553_c1
675 nmdc:mga05p37_65054_c1
676 nmdc:mga0qj67_18923_c1
677 nmdc:mga0sz30_1808_c1
678 nmdc:mga0sz30_2732_c1
679 nmdc:mga0sz30_30024_c1
680 nmdc:mga0sz30_50491_c1
681 Ga0500635_0004978
682 Ga0495619_0020391
683 Ga0500645_000588
684 2644486252
685 2738705303
686 2739334592
687 2842138237
688 2902801400
689 2902840339
690 2929215190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

257

335

0.89

PF01938

TRAM

TRAM domain

25

77

0.89

PF05958

tRNA_U5-meth_tr

tRNA (Uracil-5-)-methyltransferase

337

420

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvc-assembly1.cif.gz_A solution structure of the conserved protein from the gene locus mmp0076 of methanococcus maripaludis. northeast structural genomics target mrr5. 0.8953 16 67
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.8531 16 410
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8445 255 342
3e05-assembly1.cif.gz_A crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15 0.8432 252 410
5zq8-assembly1.cif.gz_B crystal structure of sprlmcd with u747 stemloop rna 0.8222 16 410
ID Description Score Start End Superfamily
af_O07191_4_80_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 1.003 16 86 2.40.50.140
af_O07191_202_403_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.972 209 410 3.40.50.150
af_O07191_202_403_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9673 209 410 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9377 252 317 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9177 254 322 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7L5MG88-F1-model_v4 deleted 0.968 7 358
AF-A0A1H0ILN2-F1-model_v4 tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family 0.965 16 410 GO:0070041
GO:0070475
AF-A0A7W0G4V5-F1-model_v4 23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD 0.9608 322 410 GO:0070041
GO:0070475
AF-A0A6B3I6T0-F1-model_v4 RNA methyltransferase 0.9594 294 409 GO:0070041
GO:0070475
AF-A0A2W4IRH0-F1-model_v4 tRNA/tmRNA/rRNA uracil-C5-methylase 0.9542 282 409 GO:0070041
GO:0070475

Map