F416209

General Info

Members Datasets Scaffolds Average Seq Length
345 154 690 143

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10031808|JGI24735J21928_100318082
Length 144
Sequence MILKNEDXTAELGARLARVAEPGDVISLSGPLGVGKTALARGFIGALGHQGDVPSPSFAIVQPYEELDPPVWHVDLYRIEQASEIDELGLDSAADAVLIVEWPERAGDNKWPEALALSLDFASEGQRILTAKVPPSWEGRWPPR

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
122 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.61
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10031808 3300002067 Bacteria 1563
2 Ga0070658_10002158 3300005327 Bacteria 16504
3 Ga0070658_10009061 3300005327 Bacteria 8006
4 Ga0070658_10087315 3300005327 Bacteria 2567
5 Ga0070658_10352440 3300005327 Bacteria 1260
6 Ga0070658_10363744 3300005327 Bacteria 1239
7 Ga0070676_10000204 3300005328 Bacteria 25189
8 Ga0070683_100228097 3300005329 Bacteria 1770
9 Ga0070670_100057131 3300005331 Bacteria 3350
10 Ga0070670_100472360 3300005331 Unclassified 1113
11 Ga0070666_10209931 3300005335 Bacteria 1371
12 Ga0070680_100000070 3300005336 Bacteria 54377
13 Ga0068868_101286588 3300005338 Bacteria 679
14 Ga0070660_100000370 3300005339 Bacteria 30017
15 Ga0070660_100054944 3300005339 Bacteria 3076
16 Ga0070660_100081353 3300005339 Bacteria 2543
17 Ga0070660_100089359 3300005339 Bacteria 2427
18 Ga0070660_100163813 3300005339 Bacteria 1793
19 Ga0070660_100182800 3300005339 Bacteria 1697
20 Ga0070660_100542296 3300005339 Bacteria 970
21 Ga0070691_10018197 3300005341 Bacteria 3238
22 Ga0070687_100061417 3300005343 Bacteria 1986
23 Ga0070661_100232020 3300005344 Bacteria 1419
24 Ga0070661_100308985 3300005344 Bacteria 1232
25 Ga0070661_100507878 3300005344 Bacteria 965
26 Ga0070692_10007977 3300005345 Bacteria 4697
27 Ga0070692_10017657 3300005345 Bacteria 3417
28 Ga0070692_10106505 3300005345 Bacteria 1545
29 Ga0070668_100001063 3300005347 Bacteria 19329
30 Ga0070669_100202486 3300005353 Bacteria 1562
31 Ga0070675_100044296 3300005354 Bacteria 3639
32 Ga0070671_100273633 3300005355 Bacteria 1435
33 Ga0070674_100019620 3300005356 Bacteria 4298
34 Ga0070673_100021335 3300005364 Bacteria 4694
35 Ga0070673_100050553 3300005364 Bacteria 3251
36 Ga0070673_101328775 3300005364 Unclassified 675
37 Ga0070659_100037242 3300005366 Bacteria 3792
38 Ga0070659_100092775 3300005366 Bacteria 2422
39 Ga0070659_100171408 3300005366 Bacteria 1778
40 Ga0070659_101583659 3300005366 Bacteria 585
41 Ga0070667_100002310 3300005367 Bacteria 16727
42 Ga0070667_100132767 3300005367 Bacteria 2174
43 Ga0070667_100766189 3300005367 Bacteria 895
44 Ga0070714_100038061 3300005435 Bacteria 4044
45 Ga0070700_100230936 3300005441 Bacteria 1317
46 Ga0070663_100052085 3300005455 Bacteria 2918
47 Ga0070663_100898029 3300005455 Bacteria 765
48 Ga0070678_100037598 3300005456 Bacteria 3401
49 Ga0070662_100068720 3300005457 Bacteria 2605
50 Ga0070662_100699276 3300005457 Bacteria 858
51 Ga0070662_101236827 3300005457 Bacteria 642
52 Ga0070681_10122274 3300005458 Bacteria 2536
53 Ga0070681_10317459 3300005458 Bacteria 1467
54 Ga0070681_10358729 3300005458 Bacteria 1368
55 Ga0070681_10594485 3300005458 Bacteria 1021
56 Ga0068867_100025830 3300005459 Bacteria 4213
57 Ga0068867_100334382 3300005459 Bacteria 1259
58 Ga0070679_100011214 3300005530 Bacteria 8545
59 Ga0070679_100129285 3300005530 Bacteria 2507
60 Ga0070679_100239873 3300005530 Bacteria 1770
61 Ga0070684_100046273 3300005535 Bacteria 3770
62 Ga0070684_100212987 3300005535 Bacteria 1761
63 Ga0070684_100725886 3300005535 Bacteria 927
64 Ga0068853_100011023 3300005539 Bacteria 7331
65 Ga0068853_100256874 3300005539 Bacteria 1605
66 Ga0070672_100183229 3300005543 Bacteria 1746
67 Ga0070672_100324292 3300005543 Bacteria 1309
68 Ga0070696_100008542 3300005546 Bacteria 6855
69 Ga0068855_100000480 3300005563 Bacteria 49187
70 Ga0068855_100030068 3300005563 Bacteria 6496
71 Ga0068855_100241763 3300005563 Bacteria 2017
72 Ga0068855_100492897 3300005563 Bacteria 1332
73 Ga0068855_100561900 3300005563 Bacteria 1234
74 Ga0068855_100710193 3300005563 Bacteria 1075
75 Ga0070664_100002402 3300005564 Bacteria 15042
76 Ga0070664_100006951 3300005564 Bacteria 9120
77 Ga0070664_100205217 3300005564 Bacteria 1760
78 Ga0070664_100421737 3300005564 Bacteria 1222
79 Ga0068857_100047913 3300005577 Bacteria 3795
80 Ga0068857_100127133 3300005577 Bacteria 2297
81 Ga0068857_100145388 3300005577 Bacteria 2145
82 Ga0068854_100012079 3300005578 Bacteria 5647
83 Ga0068856_100259482 3300005614 Bacteria 1753
84 Ga0068856_100795996 3300005614 Bacteria 965
85 Ga0070702_100478858 3300005615 Bacteria 909
86 Ga0068852_100003350 3300005616 Bacteria 11184
87 Ga0068852_101678578 3300005616 Bacteria 658
88 Ga0068859_100017730 3300005617 Bacteria 7158
89 Ga0068859_100045724 3300005617 Bacteria 4398
90 Ga0068859_100585165 3300005617 Bacteria 1210
91 Ga0068864_100008590 3300005618 Bacteria 8429
92 Ga0068864_100017483 3300005618 Bacteria 5979
93 Ga0068861_100083815 3300005719 Bacteria 2501
94 Ga0068861_100375203 3300005719 Bacteria 1255
95 Ga0068851_10128363 3300005834 Bacteria 1369
96 Ga0068863_100030014 3300005841 Bacteria 5193
97 Ga0068858_100012128 3300005842 Bacteria 8124
98 Ga0068858_100055951 3300005842 Bacteria 3646
99 Ga0068860_100056420 3300005843 Bacteria 3734
100 Ga0068860_100484119 3300005843 Bacteria 1233
101 Ga0068862_100007655 3300005844 Bacteria 8944
102 Ga0068862_100017592 3300005844 Bacteria 5952
103 Ga0068862_100117395 3300005844 Bacteria 2342
104 Ga0068862_100132518 3300005844 Bacteria 2206
105 Ga0068865_100015652 3300006881 Bacteria 4839
106 Ga0068865_100530059 3300006881 Bacteria 986
107 Ga0097620_100017729 3300006931 Bacteria 7158
108 Ga0097620_100045718 3300006931 Bacteria 4398
109 Ga0097620_100585199 3300006931 Bacteria 1210
110 Ga0105251_10315096 3300009011 Bacteria 710
111 Ga0105250_10152447 3300009092 Bacteria 962
112 Ga0105240_10067574 3300009093 Bacteria 4430
113 Ga0105243_11270096 3300009148 Bacteria 752
114 Ga0105241_10158119 3300009174 Bacteria 1860
115 Ga0105248_10003809 3300009177 Bacteria 16725
116 Ga0105248_10077606 3300009177 Bacteria 3734
117 Ga0105248_11406118 3300009177 Bacteria 789
118 Ga0105237_10158849 3300009545 Bacteria 2258
119 Ga0105238_10679638 3300009551 Bacteria 1041
120 Ga0105249_10051483 3300009553 Bacteria 3757
121 Ga0105249_10295180 3300009553 Bacteria 1624
122 Ga0105032_117650 3300009979 Bacteria 561
123 Ga0105246_10013856 3300011119 Bacteria 5060
124 Ga0157373_10016146 3300013100 Bacteria 5450
125 Ga0157373_10021334 3300013100 Bacteria 4705
126 Ga0157373_10228098 3300013100 Bacteria 1315
127 Ga0157373_10423534 3300013100 Bacteria 956
128 Ga0157371_10001045 3300013102 Bacteria 30368
129 Ga0157371_10024452 3300013102 Bacteria 4411
130 Ga0157371_10026857 3300013102 Bacteria 4181
131 Ga0157371_10036698 3300013102 Bacteria 3510
132 Ga0157371_10082658 3300013102 Bacteria 2274
133 Ga0157371_10185798 3300013102 Bacteria 1487
134 Ga0157371_10686961 3300013102 Bacteria 766
135 Ga0157370_10030555 3300013104 Bacteria 5278
136 Ga0157370_10034449 3300013104 Bacteria 4931
137 Ga0157370_10039932 3300013104 Bacteria 4533
138 Ga0157369_10004227 3300013105 Bacteria 17007
139 Ga0157369_10019984 3300013105 Bacteria 7489
140 Ga0157369_10270550 3300013105 Bacteria 1770
141 Ga0157369_10480639 3300013105 Bacteria 1286
142 Ga0163162_10091789 3300013306 Bacteria 3120
143 Ga0157372_10003858 3300013307 Bacteria 16114
144 Ga0157375_11143530 3300013308 Bacteria 912
145 Ga0163163_10555355 3300014325 Bacteria 1211
146 Ga0182008_10132711 3300014497 Bacteria 1242
147 Ga0182008_10578026 3300014497 Bacteria 628
148 Ga0157379_10009158 3300014968 Bacteria 8623
149 Ga0157379_10258247 3300014968 Bacteria 1583
150 Ga0206354_11680540 3300020081 Bacteria 1252
151 Ga0206353_10128923 3300020082 Bacteria 3105
152 Ga0206353_11024584 3300020082 Bacteria 1764
153 Ga0207697_10021397 3300025315 Bacteria 2647
154 Ga0207656_10055983 3300025321 Bacteria 1718
155 Ga0207696_1035735 3300025711 Bacteria 1477
156 Ga0207682_10052946 3300025893 Bacteria 1682
157 Ga0207688_10172711 3300025901 Unclassified 1286
158 Ga0207680_10157830 3300025903 Bacteria 1518
159 Ga0207647_10085131 3300025904 Bacteria 1891
160 Ga0207647_10243494 3300025904 Bacteria 1032
161 Ga0207645_10019335 3300025907 Bacteria 4466
162 Ga0207705_10000396 3300025909 Bacteria 38250
163 Ga0207705_10007258 3300025909 Bacteria 8155
164 Ga0207705_10009310 3300025909 Bacteria 7143
165 Ga0207705_10028503 3300025909 Bacteria 3981
166 Ga0207705_10102632 3300025909 Bacteria 2106
167 Ga0207705_11199525 3300025909 Bacteria 582
168 Ga0207654_10596935 3300025911 Bacteria 787
169 Ga0207695_10195262 3300025913 Bacteria 1940
170 Ga0207671_10116987 3300025914 Bacteria 2034
171 Ga0207660_10000062 3300025917 Bacteria 56397
172 Ga0207662_10020066 3300025918 Bacteria 3812
173 Ga0207657_10000439 3300025919 Bacteria 44057
174 Ga0207657_10001011 3300025919 Bacteria 29944
175 Ga0207657_10023257 3300025919 Bacteria 5774
176 Ga0207657_10079920 3300025919 Bacteria 2750
177 Ga0207657_10148500 3300025919 Bacteria 1910
178 Ga0207657_10328713 3300025919 Bacteria 1208
179 Ga0207649_10188661 3300025920 Bacteria 1448
180 Ga0207649_10312080 3300025920 Bacteria 1153
181 Ga0207649_10999954 3300025920 Unclassified 658
182 Ga0207652_10031908 3300025921 Bacteria 4424
183 Ga0207652_10139662 3300025921 Bacteria 2166
184 Ga0207681_10008534 3300025923 Bacteria 6256
185 Ga0207694_10003268 3300025924 Bacteria 12913
186 Ga0207650_10019012 3300025925 Bacteria 4829
187 Ga0207650_10058125 3300025925 Bacteria 2878
188 Ga0207650_10365945 3300025925 Unclassified 1189
189 Ga0207659_10021393 3300025926 Bacteria 4292
190 Ga0207659_10177548 3300025926 Bacteria 1684
191 Ga0207659_10188656 3300025926 Bacteria 1639
192 Ga0207644_10393661 3300025931 Bacteria 1131
193 Ga0207690_10019183 3300025932 Bacteria 4205
194 Ga0207690_10070026 3300025932 Bacteria 2415
195 Ga0207690_10088856 3300025932 Bacteria 2177
196 Ga0207690_10126246 3300025932 Bacteria 1866
197 Ga0207690_10156540 3300025932 Bacteria 1694
198 Ga0207706_10033862 3300025933 Bacteria 4547
199 Ga0207706_10812134 3300025933 Bacteria 794
200 Ga0207706_10878671 3300025933 Unclassified 758
201 Ga0207669_11157626 3300025937 Bacteria 654
202 Ga0207691_10131358 3300025940 Bacteria 2212
203 Ga0207691_10439152 3300025940 Bacteria 1111
204 Ga0207711_10000281 3300025941 Bacteria 54787
205 Ga0207711_10002810 3300025941 Bacteria 15304
206 Ga0207711_10229358 3300025941 Bacteria 1700
207 Ga0207689_10093385 3300025942 Bacteria 2471
208 Ga0207689_10433363 3300025942 Bacteria 1098
209 Ga0207661_10091203 3300025944 Bacteria 2539
210 Ga0207661_10128454 3300025944 Bacteria 2167
211 Ga0207661_11014512 3300025944 Bacteria 764
212 Ga0207679_10000961 3300025945 Bacteria 18512
213 Ga0207679_10205190 3300025945 Bacteria 1649
214 Ga0207679_10351286 3300025945 Bacteria 1285
215 Ga0207679_10666436 3300025945 Bacteria 942
216 Ga0207667_10000237 3300025949 Bacteria 77017
217 Ga0207667_10031414 3300025949 Bacteria 5733
218 Ga0207667_10232344 3300025949 Bacteria 1888
219 Ga0207667_10243124 3300025949 Bacteria 1842
220 Ga0207667_10251271 3300025949 Bacteria 1809
221 Ga0207667_10745386 3300025949 Bacteria 979
222 Ga0207667_10763385 3300025949 Bacteria 965
223 Ga0207651_10120218 3300025960 Bacteria 1991
224 Ga0207651_10406553 3300025960 Unclassified 1159
225 Ga0207712_10027673 3300025961 Bacteria 3787
226 Ga0207640_10082722 3300025981 Bacteria 2199
227 Ga0207658_10000603 3300025986 Bacteria 32015
228 Ga0207658_10021644 3300025986 Bacteria 4466
229 Ga0207658_10353219 3300025986 Bacteria 1281
230 Ga0207677_10563380 3300026023 Bacteria 995
231 Ga0207639_10000144 3300026041 Bacteria 53312
232 Ga0207639_10206296 3300026041 Bacteria 1689
233 Ga0207639_10353512 3300026041 Bacteria 1313
234 Ga0207678_10001397 3300026067 Bacteria 22209
235 Ga0207708_10294422 3300026075 Bacteria 1318
236 Ga0207702_10110405 3300026078 Bacteria 2444
237 Ga0207702_10113232 3300026078 Bacteria 2416
238 Ga0207641_10002635 3300026088 Bacteria 16432
239 Ga0207676_10021643 3300026095 Bacteria 4720
240 Ga0207674_10004058 3300026116 Bacteria 17751
241 Ga0207674_10011199 3300026116 Bacteria 10082
242 Ga0207674_10059044 3300026116 Bacteria 3884
243 Ga0207675_100158309 3300026118 Bacteria 2159
244 Ga0207698_10003057 3300026142 Bacteria 10027
245 Ga0207698_10045763 3300026142 Bacteria 3299
246 Ga0268265_10022275 3300028380 Bacteria 4449
247 Ga0268265_10022483 3300028380 Bacteria 4431
248 Ga0268265_10087148 3300028380 Bacteria 2483
249 Ga0268265_10102636 3300028380 Bacteria 2314
250 Ga0268264_10046453 3300028381 Bacteria 3606
251 Ga0268264_10047216 3300028381 Bacteria 3579
252 Ga0316176_1193895 3300030732 Bacteria 707
253 Ga0316180_1023441 3300030736 Bacteria 1898
254 Ga0316182_1135087 3300030745 Bacteria 2349
255 Ga0307405_10071028 3300031731 Bacteria 2239
256 Ga0307410_10834170 3300031852 Bacteria 786
257 Ga0307416_101113293 3300032002 Bacteria 894
258 Ga0307415_100346065 3300032126 Bacteria 1249
259 Ga0373948_0077357 3300034817 Bacteria 755
260 Ga0395899_0000261 3300037312 Bacteria 69173
261 Ga0395899_0009749 3300037312 Bacteria 7370
262 Ga0395899_0041192 3300037312 Bacteria 3451
263 Ga0395899_0155154 3300037312 Bacteria 1620
264 Ga0395899_0230970 3300037312 Bacteria 1277
265 Ga0395899_0483996 3300037312 Bacteria 805
266 Ga0395899_0787848 3300037312 Bacteria 588
267 Ga0395899_0911118 3300037312 Bacteria 535
268 Ga0395900_0000036 3300037418 Bacteria 250619
269 Ga0395900_0006519 3300037418 Bacteria 12163
270 Ga0395900_0024798 3300037418 Bacteria 6139
271 Ga0395900_0091250 3300037418 Bacteria 3130
272 Ga0395900_0104119 3300037418 Bacteria 2915
273 Ga0395900_0185693 3300037418 Bacteria 2110
274 Ga0395900_0256838 3300037418 Bacteria 1746
275 Ga0395900_0268902 3300037418 Bacteria 1700
276 Ga0395900_0329800 3300037418 Bacteria 1504
277 Ga0395900_0830745 3300037418 Bacteria 850
278 Ga0395900_1402835 3300037418 Bacteria 611
279 Ga0395898_0049321 3300037466 Bacteria 4125
280 Ga0395898_0050842 3300037466 Bacteria 4054
281 Ga0395898_0443807 3300037466 Bacteria 1236
282 Ga0395898_0731855 3300037466 Bacteria 931
283 Ga0395898_0834111 3300037466 Bacteria 861
284 Ga0395898_1529644 3300037466 Unclassified 593
285 Ga0395905_0040358 3300037471 Bacteria 4378
286 Ga0395905_0063450 3300037471 Bacteria 3456
287 Ga0395905_0110255 3300037471 Bacteria 2584
288 Ga0395905_0113672 3300037471 Bacteria 2544
289 Ga0395905_0144094 3300037471 Bacteria 2241
290 Ga0395905_0231626 3300037471 Bacteria 1727
291 Ga0395905_0321664 3300037471 Bacteria 1437
292 Ga0395905_0407829 3300037471 Bacteria 1254
293 Ga0395905_0488156 3300037471 Bacteria 1131
294 Ga0395905_1397799 3300037471 Bacteria 604
295 Ga0395901_0000036 3300038443 Bacteria 214274
296 Ga0395901_0002156 3300038443 Bacteria 20101
297 Ga0395901_0031928 3300038443 Bacteria 5431
298 Ga0395901_0088491 3300038443 Bacteria 3239
299 Ga0395901_0241060 3300038443 Bacteria 1886
300 Ga0395901_0370721 3300038443 Bacteria 1475
301 Ga0395901_0478960 3300038443 Bacteria 1270
302 Ga0395901_0626304 3300038443 Bacteria 1082
303 Ga0395901_0994444 3300038443 Unclassified 815
304 Ga0439464_0000410 3300042439 Bacteria 8448
305 Ga0439460_0150426 3300042461 Bacteria 776
306 Ga0466966_0372390 3300044684 Bacteria 858
307 Ga0466961_0314134 3300044693 Bacteria 956
308 Ga0466961_0559058 3300044693 Bacteria 689
309 Ga0466963_0001288 3300044694 Bacteria 13315
310 Ga0466963_0007248 3300044694 Bacteria 6614
311 Ga0466963_0014722 3300044694 Bacteria 4826
312 Ga0466963_0024537 3300044694 Bacteria 3839
313 Ga0466963_0183944 3300044694 Bacteria 1459
314 Ga0466964_0097687 3300044706 Bacteria 1289
315 Ga0466964_0466693 3300044706 Bacteria 672
316 Ga0466964_0567510 3300044706 Unclassified 618
317 Ga0466971_0087910 3300044719 Bacteria 1421
318 Ga0466971_0579350 3300044719 Bacteria 558
319 Ga0466960_0304543 3300044901 Bacteria 899
320 Ga0466958_1179099 3300045836 Bacteria 500
321 Ga0466967_0000376 3300045976 Bacteria 20722
322 Ga0466967_0015249 3300045976 Bacteria 6020
323 Ga0466967_0093291 3300045976 Bacteria 2739
324 Ga0466967_0149576 3300045976 Bacteria 2181
325 Ga0466967_0158709 3300045976 Bacteria 2121
326 Ga0466967_0185181 3300045976 Bacteria 1966
327 Ga0466967_0265048 3300045976 Bacteria 1644
328 Ga0466967_0404014 3300045976 Bacteria 1329
329 Ga0466967_0538330 3300045976 Bacteria 1149
330 Ga0466967_1716079 3300045976 Bacteria 625
331 Ga0495642_0471491 3300046528 Bacteria 555
332 Ga0495669_0013238 3300046684 Bacteria 3513
333 Ga0495669_0028566 3300046684 Bacteria 2443
334 Ga0495669_0088624 3300046684 Bacteria 1427
335 Ga0495669_0211144 3300046684 Bacteria 929
336 Ga0496101_0405882 3300048904 Bacteria 1073
337 Ga0496106_0133474 3300048909 Bacteria 1948
338 Ga0496107_0009551 3300048910 Bacteria 6729
339 Ga0496107_0181254 3300048910 Bacteria 1564
340 Ga0496108_0041659 3300048911 Bacteria 3834
341 Ga0496109_0752961 3300048912 Bacteria 912
342 Ga0496110_0195819 3300048913 Bacteria 1835
343 Ga0496111_0002239 3300048914 Bacteria 11617
344 Ga0496112_0002228 3300048915 Bacteria 15476
345 Ga0495655_0028784 3300053083 Bacteria 1330
346 JGI24735J21928_10031808
347 Ga0070658_10002158
348 Ga0070658_10009061
349 Ga0070658_10087315
350 Ga0070658_10352440
351 Ga0070658_10363744
352 Ga0070676_10000204
353 Ga0070683_100228097
354 Ga0070670_100057131
355 Ga0070670_100472360
356 Ga0070666_10209931
357 Ga0070680_100000070
358 Ga0068868_101286588
359 Ga0070660_100000370
360 Ga0070660_100054944
361 Ga0070660_100081353
362 Ga0070660_100089359
363 Ga0070660_100163813
364 Ga0070660_100182800
365 Ga0070660_100542296
366 Ga0070691_10018197
367 Ga0070687_100061417
368 Ga0070661_100232020
369 Ga0070661_100308985
370 Ga0070661_100507878
371 Ga0070692_10007977
372 Ga0070692_10017657
373 Ga0070692_10106505
374 Ga0070668_100001063
375 Ga0070669_100202486
376 Ga0070675_100044296
377 Ga0070671_100273633
378 Ga0070674_100019620
379 Ga0070673_100021335
380 Ga0070673_100050553
381 Ga0070673_101328775
382 Ga0070659_100037242
383 Ga0070659_100092775
384 Ga0070659_100171408
385 Ga0070659_101583659
386 Ga0070667_100002310
387 Ga0070667_100132767
388 Ga0070667_100766189
389 Ga0070714_100038061
390 Ga0070700_100230936
391 Ga0070663_100052085
392 Ga0070663_100898029
393 Ga0070678_100037598
394 Ga0070662_100068720
395 Ga0070662_100699276
396 Ga0070662_101236827
397 Ga0070681_10122274
398 Ga0070681_10317459
399 Ga0070681_10358729
400 Ga0070681_10594485
401 Ga0068867_100025830
402 Ga0068867_100334382
403 Ga0070679_100011214
404 Ga0070679_100129285
405 Ga0070679_100239873
406 Ga0070684_100046273
407 Ga0070684_100212987
408 Ga0070684_100725886
409 Ga0068853_100011023
410 Ga0068853_100256874
411 Ga0070672_100183229
412 Ga0070672_100324292
413 Ga0070696_100008542
414 Ga0068855_100000480
415 Ga0068855_100030068
416 Ga0068855_100241763
417 Ga0068855_100492897
418 Ga0068855_100561900
419 Ga0068855_100710193
420 Ga0070664_100002402
421 Ga0070664_100006951
422 Ga0070664_100205217
423 Ga0070664_100421737
424 Ga0068857_100047913
425 Ga0068857_100127133
426 Ga0068857_100145388
427 Ga0068854_100012079
428 Ga0068856_100259482
429 Ga0068856_100795996
430 Ga0070702_100478858
431 Ga0068852_100003350
432 Ga0068852_101678578
433 Ga0068859_100017730
434 Ga0068859_100045724
435 Ga0068859_100585165
436 Ga0068864_100008590
437 Ga0068864_100017483
438 Ga0068861_100083815
439 Ga0068861_100375203
440 Ga0068851_10128363
441 Ga0068863_100030014
442 Ga0068858_100012128
443 Ga0068858_100055951
444 Ga0068860_100056420
445 Ga0068860_100484119
446 Ga0068862_100007655
447 Ga0068862_100017592
448 Ga0068862_100117395
449 Ga0068862_100132518
450 Ga0068865_100015652
451 Ga0068865_100530059
452 Ga0097620_100017729
453 Ga0097620_100045718
454 Ga0097620_100585199
455 Ga0105251_10315096
456 Ga0105250_10152447
457 Ga0105240_10067574
458 Ga0105243_11270096
459 Ga0105241_10158119
460 Ga0105248_10003809
461 Ga0105248_10077606
462 Ga0105248_11406118
463 Ga0105237_10158849
464 Ga0105238_10679638
465 Ga0105249_10051483
466 Ga0105249_10295180
467 Ga0105032_117650
468 Ga0105246_10013856
469 Ga0157373_10016146
470 Ga0157373_10021334
471 Ga0157373_10228098
472 Ga0157373_10423534
473 Ga0157371_10001045
474 Ga0157371_10024452
475 Ga0157371_10026857
476 Ga0157371_10036698
477 Ga0157371_10082658
478 Ga0157371_10185798
479 Ga0157371_10686961
480 Ga0157370_10030555
481 Ga0157370_10034449
482 Ga0157370_10039932
483 Ga0157369_10004227
484 Ga0157369_10019984
485 Ga0157369_10270550
486 Ga0157369_10480639
487 Ga0163162_10091789
488 Ga0157372_10003858
489 Ga0157375_11143530
490 Ga0163163_10555355
491 Ga0182008_10132711
492 Ga0182008_10578026
493 Ga0157379_10009158
494 Ga0157379_10258247
495 Ga0206354_11680540
496 Ga0206353_10128923
497 Ga0206353_11024584
498 Ga0207697_10021397
499 Ga0207656_10055983
500 Ga0207696_1035735
501 Ga0207682_10052946
502 Ga0207688_10172711
503 Ga0207680_10157830
504 Ga0207647_10085131
505 Ga0207647_10243494
506 Ga0207645_10019335
507 Ga0207705_10000396
508 Ga0207705_10007258
509 Ga0207705_10009310
510 Ga0207705_10028503
511 Ga0207705_10102632
512 Ga0207705_11199525
513 Ga0207654_10596935
514 Ga0207695_10195262
515 Ga0207671_10116987
516 Ga0207660_10000062
517 Ga0207662_10020066
518 Ga0207657_10000439
519 Ga0207657_10001011
520 Ga0207657_10023257
521 Ga0207657_10079920
522 Ga0207657_10148500
523 Ga0207657_10328713
524 Ga0207649_10188661
525 Ga0207649_10312080
526 Ga0207649_10999954
527 Ga0207652_10031908
528 Ga0207652_10139662
529 Ga0207681_10008534
530 Ga0207694_10003268
531 Ga0207650_10019012
532 Ga0207650_10058125
533 Ga0207650_10365945
534 Ga0207659_10021393
535 Ga0207659_10177548
536 Ga0207659_10188656
537 Ga0207644_10393661
538 Ga0207690_10019183
539 Ga0207690_10070026
540 Ga0207690_10088856
541 Ga0207690_10126246
542 Ga0207690_10156540
543 Ga0207706_10033862
544 Ga0207706_10812134
545 Ga0207706_10878671
546 Ga0207669_11157626
547 Ga0207691_10131358
548 Ga0207691_10439152
549 Ga0207711_10000281
550 Ga0207711_10002810
551 Ga0207711_10229358
552 Ga0207689_10093385
553 Ga0207689_10433363
554 Ga0207661_10091203
555 Ga0207661_10128454
556 Ga0207661_11014512
557 Ga0207679_10000961
558 Ga0207679_10205190
559 Ga0207679_10351286
560 Ga0207679_10666436
561 Ga0207667_10000237
562 Ga0207667_10031414
563 Ga0207667_10232344
564 Ga0207667_10243124
565 Ga0207667_10251271
566 Ga0207667_10745386
567 Ga0207667_10763385
568 Ga0207651_10120218
569 Ga0207651_10406553
570 Ga0207712_10027673
571 Ga0207640_10082722
572 Ga0207658_10000603
573 Ga0207658_10021644
574 Ga0207658_10353219
575 Ga0207677_10563380
576 Ga0207639_10000144
577 Ga0207639_10206296
578 Ga0207639_10353512
579 Ga0207678_10001397
580 Ga0207708_10294422
581 Ga0207702_10110405
582 Ga0207702_10113232
583 Ga0207641_10002635
584 Ga0207676_10021643
585 Ga0207674_10004058
586 Ga0207674_10011199
587 Ga0207674_10059044
588 Ga0207675_100158309
589 Ga0207698_10003057
590 Ga0207698_10045763
591 Ga0268265_10022275
592 Ga0268265_10022483
593 Ga0268265_10087148
594 Ga0268265_10102636
595 Ga0268264_10046453
596 Ga0268264_10047216
597 Ga0316176_1193895
598 Ga0316180_1023441
599 Ga0316182_1135087
600 Ga0307405_10071028
601 Ga0307410_10834170
602 Ga0307416_101113293
603 Ga0307415_100346065
604 Ga0373948_0077357
605 Ga0395899_0000261
606 Ga0395899_0009749
607 Ga0395899_0041192
608 Ga0395899_0155154
609 Ga0395899_0230970
610 Ga0395899_0483996
611 Ga0395899_0787848
612 Ga0395899_0911118
613 Ga0395900_0000036
614 Ga0395900_0006519
615 Ga0395900_0024798
616 Ga0395900_0091250
617 Ga0395900_0104119
618 Ga0395900_0185693
619 Ga0395900_0256838
620 Ga0395900_0268902
621 Ga0395900_0329800
622 Ga0395900_0830745
623 Ga0395900_1402835
624 Ga0395898_0049321
625 Ga0395898_0050842
626 Ga0395898_0443807
627 Ga0395898_0731855
628 Ga0395898_0834111
629 Ga0395898_1529644
630 Ga0395905_0040358
631 Ga0395905_0063450
632 Ga0395905_0110255
633 Ga0395905_0113672
634 Ga0395905_0144094
635 Ga0395905_0231626
636 Ga0395905_0321664
637 Ga0395905_0407829
638 Ga0395905_0488156
639 Ga0395905_1397799
640 Ga0395901_0000036
641 Ga0395901_0002156
642 Ga0395901_0031928
643 Ga0395901_0088491
644 Ga0395901_0241060
645 Ga0395901_0370721
646 Ga0395901_0478960
647 Ga0395901_0626304
648 Ga0395901_0994444
649 Ga0439464_0000410
650 Ga0439460_0150426
651 Ga0466966_0372390
652 Ga0466961_0314134
653 Ga0466961_0559058
654 Ga0466963_0001288
655 Ga0466963_0007248
656 Ga0466963_0014722
657 Ga0466963_0024537
658 Ga0466963_0183944
659 Ga0466964_0097687
660 Ga0466964_0466693
661 Ga0466964_0567510
662 Ga0466971_0087910
663 Ga0466971_0579350
664 Ga0466960_0304543
665 Ga0466958_1179099
666 Ga0466967_0000376
667 Ga0466967_0015249
668 Ga0466967_0093291
669 Ga0466967_0149576
670 Ga0466967_0158709
671 Ga0466967_0185181
672 Ga0466967_0265048
673 Ga0466967_0404014
674 Ga0466967_0538330
675 Ga0466967_1716079
676 Ga0495642_0471491
677 Ga0495669_0013238
678 Ga0495669_0028566
679 Ga0495669_0088624
680 Ga0495669_0211144
681 Ga0496101_0405882
682 Ga0496106_0133474
683 Ga0496107_0009551
684 Ga0496107_0181254
685 Ga0496108_0041659
686 Ga0496109_0752961
687 Ga0496110_0195819
688 Ga0496111_0002239
689 Ga0496112_0002228
690 Ga0495655_0028784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

3

129

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8741 1 140
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.8719 1 135
6n9a-assembly1.cif.gz_E-2 crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp 0.866 1 135
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8577 1 134
1fl9-assembly3.cif.gz_C the yjee protein 0.8492 1 132
ID Description Score Start End Superfamily
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.854 9 133 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8499 1 131 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8491 1 131 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7793 1 131 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7791 1 131 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P6FSB6-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9577 1 143 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A537MGH8-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9523 1 143 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A4P6FSB6-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9512 1 143 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A537MGH8-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9458 1 143 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A2A2KJI1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9456 7 141 GO:0000155
GO:0002949

Map