F416174

General Info

Members Datasets Scaffolds Average Seq Length
344 187 688 518

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0021498|Ga0466962_0021498_503_2221
Length 572
Sequence VRLDTPGSTEHPHRLSPGTLAAAAIAVCVAQVALAIPAVLNGLFQQDLGTSSAQLTWISDAFLVPVTLLELTFGVLGDLFGRKRLLVSGTVLLMIGQLVSVLTPGAASSTGTRVLVLWTGQILSGLGAAALFPTTLAMVAAGTHTARDRSRAISIWAAALSSGGFVSPALGGWLARYKFGSDEFASWRWAFVSVIVLAAISTVVSAIWARDSKAPAGRSLDWGGQVTIAIAMFALLYAVIQGPTSGWGSGGVIAGFILAVVFLGLFIAAELRSRAPLLRLDLFANRAFAIAAIATVVGMFAYLGTAYATSIRLSAIQGFTPLKTSIAFLMLNGLALVMVPLTSRVLEHYNPRWTLGIGFTLIAGGDFWLTSLSAGNLSVAPVVAPLVLVGIGFALALSSVTAVAVNTVPNHLAGMASGSTSMLRDFGFTLGPAVVGAIALSRAAAEISNKVSTNPALXXALAAFNGSAAEAPAAQKPQLEAAIGAVNSGPLGANAVPGSITLPNGQTVPFNPLKDTAFHALDHAYSIGYLVCGLCALAAALLAAVGLGGSSHETLISAESLAEEQPTAAVVD

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
61 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
69 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2558860280 Kutzneria sp. 744 Isolate Unclassified
176 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
177 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
178 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
179 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
180 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
181 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
182 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
183 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
184 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
185 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
186 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
187 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.64
Metatranscriptomes 0.58
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 1.74
Rhizosphere 85.76
Stem 0
Stem Tuber 0.29
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0021498 3300061719 Bacteria 3098
2 JGI24737J22298_10025821 3300001990 Bacteria 1856
3 Ga0070658_10033626 3300005327 Bacteria 4126
4 Ga0070668_100022376 3300005347 Bacteria 4778
5 Ga0070667_100012809 3300005367 Bacteria 6931
6 Ga0070714_100022855 3300005435 Bacteria 5131
7 Ga0070710_10015653 3300005437 Bacteria 3843
8 Ga0070711_100044168 3300005439 Bacteria 3023
9 Ga0070663_100026196 3300005455 Bacteria 3946
10 Ga0070706_100002183 3300005467 Bacteria 19910
11 Ga0070698_100022340 3300005471 Bacteria 6618
12 Ga0068855_100001319 3300005563 Bacteria 30718
13 Ga0068855_100051065 3300005563 Bacteria 4871
14 Ga0068855_100053902 3300005563 Bacteria 4730
15 Ga0068854_100000779 3300005578 Bacteria 18928
16 Ga0068856_100047882 3300005614 Bacteria 4212
17 Ga0068852_100004956 3300005616 Bacteria 9459
18 Ga0068852_100075001 3300005616 Bacteria 2982
19 Ga0068858_100044066 3300005842 Bacteria 4137
20 Ga0068860_100008480 3300005843 Bacteria 10241
21 Ga0070717_10002695 3300006028 Bacteria 12515
22 Ga0070717_10190419 3300006028 Bacteria 1792
23 Ga0070716_100021138 3300006173 Bacteria 3426
24 Ga0075367_10012153 3300006178 Bacteria 4580
25 Ga0097621_100033639 3300006237 Bacteria 4084
26 Ga0105240_10008504 3300009093 Bacteria 14680
27 Ga0105245_10026279 3300009098 Bacteria 5123
28 Ga0105237_10045374 3300009545 Bacteria 4424
29 Ga0105237_10171386 3300009545 Bacteria 2170
30 Ga0105238_10006221 3300009551 Bacteria 11858
31 Ga0105238_10044628 3300009551 Bacteria 4481
32 Ga0105239_10009769 3300010375 Bacteria 10785
33 Ga0157374_10173615 3300013296 Bacteria 2103
34 Ga0163162_10126333 3300013306 Bacteria 2664
35 Ga0157372_10096432 3300013307 Bacteria 3370
36 Ga0157375_10045023 3300013308 Bacteria 4293
37 Ga0157376_10055976 3300014969 Bacteria 3293
38 Ga0206352_10239316 3300020078 Bacteria 1931
39 Ga0206353_11126086 3300020082 Bacteria 2648
40 Ga0213874_10015375 3300021377 Unclassified 2018
41 Ga0213875_10000315 3300021388 Bacteria 46146
42 Ga0213875_10002646 3300021388 Bacteria 10595
43 Ga0207692_10031873 3300025898 Bacteria 2528
44 Ga0207710_10020694 3300025900 Bacteria 2814
45 Ga0207647_10004863 3300025904 Bacteria 9929
46 Ga0207647_10009497 3300025904 Bacteria 6907
47 Ga0207705_10122545 3300025909 Bacteria 1930
48 Ga0207684_10001196 3300025910 Bacteria 29015
49 Ga0207654_10064259 3300025911 Bacteria 2157
50 Ga0207695_10002196 3300025913 Bacteria 29403
51 Ga0207671_10000115 3300025914 Bacteria 123555
52 Ga0207671_10096086 3300025914 Bacteria 2238
53 Ga0207694_10002169 3300025924 Bacteria 16144
54 Ga0207694_10085412 3300025924 Bacteria 2484
55 Ga0207700_10032263 3300025928 Bacteria 3733
56 Ga0207700_10051500 3300025928 Bacteria 3073
57 Ga0207664_10008124 3300025929 Bacteria 7302
58 Ga0207664_10013660 3300025929 Bacteria 5837
59 Ga0207664_10054556 3300025929 Bacteria 3167
60 Ga0207664_10080550 3300025929 Bacteria 2647
61 Ga0207665_10022998 3300025939 Bacteria 4104
62 Ga0207689_10096188 3300025942 Bacteria 2432
63 Ga0207667_10051411 3300025949 Bacteria 4345
64 Ga0207668_10031700 3300025972 Bacteria 3485
65 Ga0207640_10020897 3300025981 Bacteria 3892
66 Ga0207703_10096187 3300026035 Bacteria 2500
67 Ga0207639_10051111 3300026041 Bacteria 3142
68 Ga0207702_10100016 3300026078 Bacteria 2557
69 Ga0207702_10127187 3300026078 Bacteria 2289
70 Ga0207674_10077230 3300026116 Bacteria 3336
71 Ga0207698_10081779 3300026142 Bacteria 2609
72 Ga0268266_10041614 3300028379 Bacteria 3921
73 Ga0307517_10003485 3300028786 Bacteria 24435
74 Ga0307515_10000189 3300028794 Bacteria 150703
75 Ga0307511_10000824 3300030521 Bacteria 33088
76 Ga0307511_10002697 3300030521 Bacteria 18486
77 Ga0307511_10024502 3300030521 Bacteria 5592
78 Ga0307512_10018431 3300030522 Bacteria 6379
79 Ga0307512_10086770 3300030522 Bacteria 2209
80 Ga0307513_10070948 3300031456 Bacteria 3638
81 Ga0307509_10004923 3300031507 Bacteria 18914
82 Ga0307509_10005356 3300031507 Bacteria 17913
83 Ga0307509_10009953 3300031507 Bacteria 11746
84 Ga0307509_10021325 3300031507 Bacteria 7325
85 Ga0307509_10039284 3300031507 Bacteria 5157
86 Ga0307509_10193527 3300031507 Bacteria 1881
87 Ga0307508_10004617 3300031616 Bacteria 13380
88 Ga0307516_10005538 3300031730 Bacteria 15060
89 Ga0307507_10000005 3300033179 Bacteria 281494
90 Ga0307507_10007505 3300033179 Bacteria 15782
91 Ga0307507_10012333 3300033179 Bacteria 10576
92 Ga0307507_10016087 3300033179 Bacteria 8737
93 Ga0307507_10055815 3300033179 Bacteria 3739
94 Ga0307510_10001189 3300033180 Bacteria 28136
95 Ga0307510_10057243 3300033180 Bacteria 4047
96 Ga0373942_0002574 3300035207 Bacteria 4374
97 Ga0373962_0001151 3300035242 Bacteria 6170
98 Ga0373935_0123610 3300035692 Bacteria 1731
99 Ga0373947_0062092 3300035725 Bacteria 2272
100 Ga0395900_0009985 3300037418 Bacteria 9716
101 Ga0395898_0006694 3300037466 Bacteria 12283
102 Ga0395898_0006800 3300037466 Bacteria 12165
103 Ga0395898_0041705 3300037466 Bacteria 4532
104 Ga0436364_0036306 3300037853 Bacteria 8345
105 Ga0436364_0085858 3300037853 Bacteria 16249
106 Ga0436364_1481155 3300037853 Bacteria 87951
107 Ga0436363_1430109 3300039450 Unclassified 2334
108 Ga0439448_0024751 3300042005 Bacteria 1879
109 Ga0466969_0008076 3300044656 Bacteria 5589
110 Ga0466969_0010285 3300044656 Bacteria 4963
111 Ga0466969_0029166 3300044656 Bacteria 2819
112 Ga0466969_0031488 3300044656 Bacteria 2699
113 Ga0466969_0040169 3300044656 Bacteria 2345
114 Ga0466965_0000394 3300044683 Bacteria 14974
115 Ga0466966_0001612 3300044684 Bacteria 14529
116 Ga0466966_0002460 3300044684 Bacteria 12112
117 Ga0466966_0005179 3300044684 Bacteria 8567
118 Ga0466966_0021708 3300044684 Bacteria 4214
119 Ga0466966_0074373 3300044684 Bacteria 2123
120 Ga0466961_0000237 3300044693 Bacteria 37109
121 Ga0466961_0003287 3300044693 Bacteria 10071
122 Ga0466961_0007824 3300044693 Bacteria 6805
123 Ga0466961_0019920 3300044693 Bacteria 4318
124 Ga0466961_0022582 3300044693 Bacteria 4047
125 Ga0466961_0032453 3300044693 Bacteria 3356
126 Ga0466961_0075077 3300044693 Bacteria 2143
127 Ga0466961_0087525 3300044693 Bacteria 1968
128 Ga0466963_0003868 3300044694 Bacteria 8644
129 Ga0466964_0000486 3300044706 Bacteria 12274
130 Ga0466971_0000909 3300044719 Bacteria 12117
131 Ga0466971_0002794 3300044719 Bacteria 7380
132 Ga0466971_0003297 3300044719 Bacteria 6893
133 Ga0466971_0016076 3300044719 Bacteria 3297
134 Ga0466970_0000192 3300044765 Bacteria 29653
135 Ga0466957_0000488 3300044842 Bacteria 19749
136 Ga0466957_0031672 3300044842 Bacteria 3162
137 Ga0466960_0038733 3300044901 Bacteria 2244
138 Ga0466959_0002536 3300045049 Bacteria 11711
139 Ga0466959_0004856 3300045049 Bacteria 9090
140 Ga0466959_0008560 3300045049 Bacteria 7240
141 Ga0466959_0042990 3300045049 Bacteria 3332
142 Ga0466958_0001773 3300045836 Bacteria 10456
143 Ga0466958_0018494 3300045836 Bacteria 4045
144 Ga0466958_0104896 3300045836 Bacteria 1761
145 Ga0466967_0000611 3300045976 Bacteria 17839
146 Ga0466967_0005392 3300045976 Bacteria 8855
147 Ga0466967_0010479 3300045976 Bacteria 6957
148 Ga0466967_0080253 3300045976 Bacteria 2943
149 Ga0495592_0001644 3300046454 Bacteria 15660
150 Ga0495592_0003501 3300046454 Bacteria 11267
151 Ga0495592_0023384 3300046454 Bacteria 4699
152 Ga0495592_0066276 3300046454 Bacteria 2642
153 Ga0495629_0014605 3300046459 Bacteria 5650
154 Ga0495651_0000244 3300046462 Bacteria 42021
155 Ga0495651_0001665 3300046462 Bacteria 17182
156 Ga0495651_0002920 3300046462 Bacteria 13234
157 Ga0495651_0017542 3300046462 Bacteria 5544
158 Ga0495653_0010168 3300046463 Bacteria 7699
159 Ga0495653_0038508 3300046463 Bacteria 3753
160 Ga0495653_0096430 3300046463 Bacteria 2150
161 Ga0495580_0027679 3300046472 Bacteria 4124
162 Ga0495582_0087456 3300046473 Bacteria 1735
163 Ga0495605_0024068 3300046474 Bacteria 3191
164 Ga0495662_0002093 3300046476 Bacteria 10009
165 Ga0495664_0000181 3300046477 Bacteria 31122
166 Ga0495664_0065537 3300046477 Bacteria 2165
167 Ga0495585_0023862 3300046492 Bacteria 3509
168 Ga0495583_0005562 3300046506 Bacteria 8513
169 Ga0495608_0004747 3300046511 Bacteria 9728
170 Ga0495608_0032805 3300046511 Bacteria 3510
171 Ga0495618_0049263 3300046514 Bacteria 2660
172 Ga0495628_0004711 3300046516 Bacteria 12029
173 Ga0495628_0009818 3300046516 Bacteria 8153
174 Ga0495628_0023562 3300046516 Bacteria 5051
175 Ga0495628_0025628 3300046516 Bacteria 4817
176 Ga0495666_0016739 3300046526 Bacteria 3650
177 Ga0495652_0000887 3300046529 Bacteria 34411
178 Ga0495652_0001091 3300046529 Bacteria 30685
179 Ga0495652_0001951 3300046529 Bacteria 21899
180 Ga0495652_0016679 3300046529 Bacteria 6565
181 Ga0495652_0027889 3300046529 Bacteria 4973
182 Ga0495652_0053851 3300046529 Bacteria 3428
183 Ga0495665_0009727 3300046531 Bacteria 5204
184 Ga0495665_0055717 3300046531 Bacteria 2087
185 Ga0495640_0002947 3300046533 Bacteria 13710
186 Ga0495640_0016813 3300046533 Bacteria 5469
187 Ga0495640_0079954 3300046533 Bacteria 2175
188 Ga0495586_0008557 3300046535 Bacteria 5448
189 Ga0495586_0042580 3300046535 Bacteria 2445
190 Ga0495587_0002677 3300046536 Bacteria 11900
191 Ga0495597_0030585 3300046542 Bacteria 2454
192 Ga0495645_0013651 3300046543 Bacteria 5754
193 Ga0495645_0109434 3300046543 Bacteria 1956
194 Ga0495667_0003487 3300046559 Bacteria 10543
195 Ga0495667_0010739 3300046559 Bacteria 6193
196 Ga0495668_0006090 3300046616 Bacteria 7986
197 Ga0495634_0014120 3300046642 Bacteria 5766
198 Ga0495625_0032240 3300046660 Bacteria 3889
199 Ga0495635_0000197 3300046663 Bacteria 38170
200 Ga0495588_0003151 3300046674 Bacteria 7138
201 Ga0495588_0045724 3300046674 Bacteria 2245
202 Ga0495657_0000206 3300046675 Bacteria 52948
203 Ga0495657_0017789 3300046675 Bacteria 5154
204 Ga0495657_0031196 3300046675 Bacteria 3726
205 Ga0495599_0003561 3300046678 Bacteria 9124
206 Ga0495623_0069620 3300046679 Bacteria 2192
207 Ga0495646_0001776 3300046680 Bacteria 12960
208 Ga0495646_0011687 3300046680 Bacteria 5581
209 Ga0495613_0000367 3300046689 Bacteria 39278
210 Ga0495613_0005246 3300046689 Bacteria 9738
211 Ga0495613_0006973 3300046689 Bacteria 8421
212 Ga0495613_0022304 3300046689 Bacteria 4718
213 Ga0495613_0023225 3300046689 Bacteria 4620
214 Ga0495589_0011126 3300046794 Bacteria 4670
215 Ga0495589_0047141 3300046794 Bacteria 2136
216 Ga0495600_0008852 3300046809 Bacteria 6199
217 Ga0495600_0026193 3300046809 Bacteria 3761
218 Ga0495600_0027439 3300046809 Bacteria 3679
219 Ga0495600_0041802 3300046809 Bacteria 2988
220 Ga0495600_0042006 3300046809 Bacteria 2980
221 Ga0495600_0055544 3300046809 Bacteria 2586
222 Ga0495600_0071901 3300046809 Bacteria 2260
223 Ga0495581_0007434 3300047315 Bacteria 6334
224 Ga0495604_0000428 3300047317 Bacteria 37860
225 Ga0495604_0001082 3300047317 Bacteria 22602
226 Ga0495604_0044767 3300047317 Bacteria 3456
227 Ga0495604_0054803 3300047317 Bacteria 3075
228 Ga0495636_0003938 3300047318 Bacteria 5796
229 Ga0495674_0005594 3300047319 Bacteria 12047
230 Ga0495674_0057885 3300047319 Bacteria 3390
231 Ga0495674_0074339 3300047319 Bacteria 2927
232 Ga0495676_0004931 3300047321 Bacteria 12240
233 Ga0495676_0083018 3300047321 Bacteria 2423
234 Ga0495676_0130791 3300047321 Bacteria 1812
235 Ga0495680_0000811 3300047322 Bacteria 34912
236 Ga0495687_001247 3300047443 Bacteria 24230
237 Ga0495687_007072 3300047443 Bacteria 6703
238 Ga0495687_012096 3300047443 Bacteria 4585
239 Ga0495675_0012312 3300047444 Bacteria 5385
240 Ga0495675_0044601 3300047444 Bacteria 2824
241 Ga0495675_0048797 3300047444 Bacteria 2692
242 Ga0495675_0096761 3300047444 Bacteria 1850
243 Ga0495685_018972 3300047447 Bacteria 2361
244 Ga0495681_0000253 3300047470 Bacteria 43616
245 Ga0495684_0002654 3300047471 Bacteria 14184
246 Ga0495593_0003435 3300047673 Bacteria 9481
247 Ga0495602_0003038 3300048088 Bacteria 17223
248 Ga0495602_0035798 3300048088 Bacteria 4626
249 Ga0495602_0088295 3300048088 Bacteria 2581
250 Ga0495602_0115988 3300048088 Bacteria 2165
251 Ga0495614_0001738 3300048089 Bacteria 9517
252 Ga0495614_0005965 3300048089 Bacteria 5488
253 Ga0495614_0029422 3300048089 Bacteria 2364
254 Ga0496104_0084457 3300048907 Bacteria 3030
255 Ga0496104_0173774 3300048907 Bacteria 2065
256 Ga0496110_0055837 3300048913 Bacteria 3475
257 Ga0496111_0061768 3300048914 Bacteria 2716
258 Ga0496114_0012870 3300048917 Bacteria 6701
259 Ga0501031_0014493 3300049568 Bacteria 5125
260 Ga0501032_0001170 3300049569 Bacteria 21022
261 Ga0501032_0026894 3300049569 Bacteria 3955
262 Ga0501032_0065452 3300049569 Bacteria 2431
263 Ga0501033_0001906 3300049570 Bacteria 18150
264 Ga0501033_0004567 3300049570 Bacteria 11089
265 Ga0501034_0001465 3300049571 Bacteria 31253
266 Ga0501034_0003291 3300049571 Bacteria 18453
267 Ga0501034_0020532 3300049571 Bacteria 6746
268 Ga0501034_0145650 3300049571 Bacteria 2346
269 Ga0501034_0221957 3300049571 Bacteria 1842
270 Ga0501036_0001650 3300049572 Bacteria 17283
271 Ga0501036_0002061 3300049572 Bacteria 15657
272 Ga0501036_0005155 3300049572 Bacteria 10563
273 Ga0501036_0008912 3300049572 Bacteria 8245
274 Ga0501037_0001112 3300049573 Bacteria 19950
275 Ga0501037_0002848 3300049573 Bacteria 12540
276 Ga0501037_0006769 3300049573 Bacteria 8379
277 Ga0501037_0034553 3300049573 Bacteria 3731
278 Ga0501037_0058667 3300049573 Bacteria 2808
279 Ga0501038_0001599 3300049574 Bacteria 21000
280 Ga0501038_0005159 3300049574 Bacteria 12143
281 Ga0501038_0016414 3300049574 Bacteria 6711
282 Ga0501038_0018506 3300049574 Bacteria 6290
283 Ga0501039_0063483 3300049575 Bacteria 2862
284 Ga0501041_0000412 3300049577 Bacteria 21610
285 Ga0501042_0003816 3300049578 Bacteria 9525
286 Ga0501043_0000363 3300049579 Bacteria 41190
287 Ga0501043_0006372 3300049579 Bacteria 9481
288 Ga0501043_0081776 3300049579 Bacteria 2538
289 Ga0501046_0004137 3300049580 Bacteria 13220
290 Ga0501047_0000720 3300049581 Bacteria 34413
291 Ga0501047_0005651 3300049581 Bacteria 11774
292 Ga0501047_0011591 3300049581 Bacteria 8342
293 Ga0501047_0028833 3300049581 Bacteria 5354
294 Ga0501047_0031258 3300049581 Bacteria 5135
295 Ga0501047_0063551 3300049581 Bacteria 3561
296 Ga0501047_0086627 3300049581 Bacteria 3009
297 Ga0501048_0001147 3300049582 Bacteria 19890
298 Ga0501074_0002246 3300049590 Bacteria 13412
299 Ga0501080_0051357 3300049742 Bacteria 3837
300 Ga0501083_0009071 3300049744 Bacteria 7022
301 Ga0501035_0000875 3300049822 Bacteria 32012
302 Ga0501035_0020863 3300049822 Bacteria 6020
303 Ga0501035_0024439 3300049822 Bacteria 5541
304 Ga0501044_0000958 3300049823 Bacteria 34677
305 Ga0501044_0027315 3300049823 Bacteria 6033
306 Ga0501044_0079016 3300049823 Bacteria 3334
307 Ga0501044_0079039 3300049823 Bacteria 3333
308 nmdc:mga0yw44_13199_c1 3300050492 Bacteria 4340
309 nmdc:mga06z11_51876_c1 3300050494 Bacteria 2102
310 Ga0495601_0000562 3300053077 Bacteria 19691
311 Ga0495601_0003364 3300053077 Bacteria 9156
312 Ga0495601_0024601 3300053077 Bacteria 3710
313 Ga0495601_0035183 3300053077 Bacteria 3125
314 Ga0495601_0035668 3300053077 Bacteria 3105
315 Ga0495612_0006609 3300053078 Bacteria 4759
316 Ga0495612_0007469 3300053078 Bacteria 4467
317 Ga0495595_0003691 3300053084 Bacteria 6090
318 Ga0495619_0026415 3300053085 Bacteria 3735
319 Ga0495619_0043679 3300053085 Bacteria 2939
320 Ga0495619_0123868 3300053085 Bacteria 1773
321 Ga0500560_002159 3300053107 Bacteria 3684
322 Ga0500559_0020831 3300053136 Bacteria 2775
323 Ga0500573_0001352 3300053140 Bacteria 11652
324 Ga0500616_0000570 3300053153 Bacteria 45118
325 Ga0501084_0002172 3300054114 Bacteria 15721
326 Ga0501082_0003880 3300060353 Bacteria 13057
327 Ga0466962_0000340 3300061719 Bacteria 20024
328 Ga0466962_0002032 3300061719 Bacteria 9556
329 Ga0466962_0015524 3300061719 Bacteria 3673
330 Ga0466962_0019046 3300061719 Bacteria 3297
331 Ga0530510_0048242 3300061734 Bacteria 3078
332 2559422772 2558860280 Bacteria 11429938
333 2585317997 2582581314 Bacteria 11452267
334 2616703317 2616644814 Bacteria 11555299
335 2753270707 2751185782 Bacteria 11227053
336 2793977311 2791355406 Bacteria 11364898
337 2808919361 2808606375 Bacteria 9466072
338 2899372103 2899370129 Bacteria 6781179
339 2997603783 2997600082 Bacteria 9896405
340 3003002077 3002998708 Bacteria 11715108
341 8047903479 8047893842 Bacteria 11723082
342 8048356737 8048356638 Bacteria 11044339
343 8048379083 8048369669 Bacteria 11666822
344 8048388188 8048379754 Bacteria 11877923
345 Ga0466962_0021498
346 JGI24737J22298_10025821
347 Ga0070658_10033626
348 Ga0070668_100022376
349 Ga0070667_100012809
350 Ga0070714_100022855
351 Ga0070710_10015653
352 Ga0070711_100044168
353 Ga0070663_100026196
354 Ga0070706_100002183
355 Ga0070698_100022340
356 Ga0068855_100001319
357 Ga0068855_100051065
358 Ga0068855_100053902
359 Ga0068854_100000779
360 Ga0068856_100047882
361 Ga0068852_100004956
362 Ga0068852_100075001
363 Ga0068858_100044066
364 Ga0068860_100008480
365 Ga0070717_10002695
366 Ga0070717_10190419
367 Ga0070716_100021138
368 Ga0075367_10012153
369 Ga0097621_100033639
370 Ga0105240_10008504
371 Ga0105245_10026279
372 Ga0105237_10045374
373 Ga0105237_10171386
374 Ga0105238_10006221
375 Ga0105238_10044628
376 Ga0105239_10009769
377 Ga0157374_10173615
378 Ga0163162_10126333
379 Ga0157372_10096432
380 Ga0157375_10045023
381 Ga0157376_10055976
382 Ga0206352_10239316
383 Ga0206353_11126086
384 Ga0213874_10015375
385 Ga0213875_10000315
386 Ga0213875_10002646
387 Ga0207692_10031873
388 Ga0207710_10020694
389 Ga0207647_10004863
390 Ga0207647_10009497
391 Ga0207705_10122545
392 Ga0207684_10001196
393 Ga0207654_10064259
394 Ga0207695_10002196
395 Ga0207671_10000115
396 Ga0207671_10096086
397 Ga0207694_10002169
398 Ga0207694_10085412
399 Ga0207700_10032263
400 Ga0207700_10051500
401 Ga0207664_10008124
402 Ga0207664_10013660
403 Ga0207664_10054556
404 Ga0207664_10080550
405 Ga0207665_10022998
406 Ga0207689_10096188
407 Ga0207667_10051411
408 Ga0207668_10031700
409 Ga0207640_10020897
410 Ga0207703_10096187
411 Ga0207639_10051111
412 Ga0207702_10100016
413 Ga0207702_10127187
414 Ga0207674_10077230
415 Ga0207698_10081779
416 Ga0268266_10041614
417 Ga0307517_10003485
418 Ga0307515_10000189
419 Ga0307511_10000824
420 Ga0307511_10002697
421 Ga0307511_10024502
422 Ga0307512_10018431
423 Ga0307512_10086770
424 Ga0307513_10070948
425 Ga0307509_10004923
426 Ga0307509_10005356
427 Ga0307509_10009953
428 Ga0307509_10021325
429 Ga0307509_10039284
430 Ga0307509_10193527
431 Ga0307508_10004617
432 Ga0307516_10005538
433 Ga0307507_10000005
434 Ga0307507_10007505
435 Ga0307507_10012333
436 Ga0307507_10016087
437 Ga0307507_10055815
438 Ga0307510_10001189
439 Ga0307510_10057243
440 Ga0373942_0002574
441 Ga0373962_0001151
442 Ga0373935_0123610
443 Ga0373947_0062092
444 Ga0395900_0009985
445 Ga0395898_0006694
446 Ga0395898_0006800
447 Ga0395898_0041705
448 Ga0436364_0036306
449 Ga0436364_0085858
450 Ga0436364_1481155
451 Ga0436363_1430109
452 Ga0439448_0024751
453 Ga0466969_0008076
454 Ga0466969_0010285
455 Ga0466969_0029166
456 Ga0466969_0031488
457 Ga0466969_0040169
458 Ga0466965_0000394
459 Ga0466966_0001612
460 Ga0466966_0002460
461 Ga0466966_0005179
462 Ga0466966_0021708
463 Ga0466966_0074373
464 Ga0466961_0000237
465 Ga0466961_0003287
466 Ga0466961_0007824
467 Ga0466961_0019920
468 Ga0466961_0022582
469 Ga0466961_0032453
470 Ga0466961_0075077
471 Ga0466961_0087525
472 Ga0466963_0003868
473 Ga0466964_0000486
474 Ga0466971_0000909
475 Ga0466971_0002794
476 Ga0466971_0003297
477 Ga0466971_0016076
478 Ga0466970_0000192
479 Ga0466957_0000488
480 Ga0466957_0031672
481 Ga0466960_0038733
482 Ga0466959_0002536
483 Ga0466959_0004856
484 Ga0466959_0008560
485 Ga0466959_0042990
486 Ga0466958_0001773
487 Ga0466958_0018494
488 Ga0466958_0104896
489 Ga0466967_0000611
490 Ga0466967_0005392
491 Ga0466967_0010479
492 Ga0466967_0080253
493 Ga0495592_0001644
494 Ga0495592_0003501
495 Ga0495592_0023384
496 Ga0495592_0066276
497 Ga0495629_0014605
498 Ga0495651_0000244
499 Ga0495651_0001665
500 Ga0495651_0002920
501 Ga0495651_0017542
502 Ga0495653_0010168
503 Ga0495653_0038508
504 Ga0495653_0096430
505 Ga0495580_0027679
506 Ga0495582_0087456
507 Ga0495605_0024068
508 Ga0495662_0002093
509 Ga0495664_0000181
510 Ga0495664_0065537
511 Ga0495585_0023862
512 Ga0495583_0005562
513 Ga0495608_0004747
514 Ga0495608_0032805
515 Ga0495618_0049263
516 Ga0495628_0004711
517 Ga0495628_0009818
518 Ga0495628_0023562
519 Ga0495628_0025628
520 Ga0495666_0016739
521 Ga0495652_0000887
522 Ga0495652_0001091
523 Ga0495652_0001951
524 Ga0495652_0016679
525 Ga0495652_0027889
526 Ga0495652_0053851
527 Ga0495665_0009727
528 Ga0495665_0055717
529 Ga0495640_0002947
530 Ga0495640_0016813
531 Ga0495640_0079954
532 Ga0495586_0008557
533 Ga0495586_0042580
534 Ga0495587_0002677
535 Ga0495597_0030585
536 Ga0495645_0013651
537 Ga0495645_0109434
538 Ga0495667_0003487
539 Ga0495667_0010739
540 Ga0495668_0006090
541 Ga0495634_0014120
542 Ga0495625_0032240
543 Ga0495635_0000197
544 Ga0495588_0003151
545 Ga0495588_0045724
546 Ga0495657_0000206
547 Ga0495657_0017789
548 Ga0495657_0031196
549 Ga0495599_0003561
550 Ga0495623_0069620
551 Ga0495646_0001776
552 Ga0495646_0011687
553 Ga0495613_0000367
554 Ga0495613_0005246
555 Ga0495613_0006973
556 Ga0495613_0022304
557 Ga0495613_0023225
558 Ga0495589_0011126
559 Ga0495589_0047141
560 Ga0495600_0008852
561 Ga0495600_0026193
562 Ga0495600_0027439
563 Ga0495600_0041802
564 Ga0495600_0042006
565 Ga0495600_0055544
566 Ga0495600_0071901
567 Ga0495581_0007434
568 Ga0495604_0000428
569 Ga0495604_0001082
570 Ga0495604_0044767
571 Ga0495604_0054803
572 Ga0495636_0003938
573 Ga0495674_0005594
574 Ga0495674_0057885
575 Ga0495674_0074339
576 Ga0495676_0004931
577 Ga0495676_0083018
578 Ga0495676_0130791
579 Ga0495680_0000811
580 Ga0495687_001247
581 Ga0495687_007072
582 Ga0495687_012096
583 Ga0495675_0012312
584 Ga0495675_0044601
585 Ga0495675_0048797
586 Ga0495675_0096761
587 Ga0495685_018972
588 Ga0495681_0000253
589 Ga0495684_0002654
590 Ga0495593_0003435
591 Ga0495602_0003038
592 Ga0495602_0035798
593 Ga0495602_0088295
594 Ga0495602_0115988
595 Ga0495614_0001738
596 Ga0495614_0005965
597 Ga0495614_0029422
598 Ga0496104_0084457
599 Ga0496104_0173774
600 Ga0496110_0055837
601 Ga0496111_0061768
602 Ga0496114_0012870
603 Ga0501031_0014493
604 Ga0501032_0001170
605 Ga0501032_0026894
606 Ga0501032_0065452
607 Ga0501033_0001906
608 Ga0501033_0004567
609 Ga0501034_0001465
610 Ga0501034_0003291
611 Ga0501034_0020532
612 Ga0501034_0145650
613 Ga0501034_0221957
614 Ga0501036_0001650
615 Ga0501036_0002061
616 Ga0501036_0005155
617 Ga0501036_0008912
618 Ga0501037_0001112
619 Ga0501037_0002848
620 Ga0501037_0006769
621 Ga0501037_0034553
622 Ga0501037_0058667
623 Ga0501038_0001599
624 Ga0501038_0005159
625 Ga0501038_0016414
626 Ga0501038_0018506
627 Ga0501039_0063483
628 Ga0501041_0000412
629 Ga0501042_0003816
630 Ga0501043_0000363
631 Ga0501043_0006372
632 Ga0501043_0081776
633 Ga0501046_0004137
634 Ga0501047_0000720
635 Ga0501047_0005651
636 Ga0501047_0011591
637 Ga0501047_0028833
638 Ga0501047_0031258
639 Ga0501047_0063551
640 Ga0501047_0086627
641 Ga0501048_0001147
642 Ga0501074_0002246
643 Ga0501080_0051357
644 Ga0501083_0009071
645 Ga0501035_0000875
646 Ga0501035_0020863
647 Ga0501035_0024439
648 Ga0501044_0000958
649 Ga0501044_0027315
650 Ga0501044_0079016
651 Ga0501044_0079039
652 nmdc:mga0yw44_13199_c1
653 nmdc:mga06z11_51876_c1
654 Ga0495601_0000562
655 Ga0495601_0003364
656 Ga0495601_0024601
657 Ga0495601_0035183
658 Ga0495601_0035668
659 Ga0495612_0006609
660 Ga0495612_0007469
661 Ga0495595_0003691
662 Ga0495619_0026415
663 Ga0495619_0043679
664 Ga0495619_0123868
665 Ga0500560_002159
666 Ga0500559_0020831
667 Ga0500573_0001352
668 Ga0500616_0000570
669 Ga0501084_0002172
670 Ga0501082_0003880
671 Ga0466962_0000340
672 Ga0466962_0002032
673 Ga0466962_0015524
674 Ga0466962_0019046
675 Ga0530510_0048242
676 2559422772
677 2585317997
678 2616703317
679 2753270707
680 2793977311
681 2808919361
682 2899372103
683 2997603783
684 3003002077
685 8047903479
686 8048356737
687 8048379083
688 8048388188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

23

214

0.85

PF07690

MFS_1

Major Facilitator Superfamily

21

432

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7556 32 496
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.691 24 495
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.6845 24 495
6vs2-assembly1.cif.gz_A protein d 0.6812 24 488
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.6785 24 487
ID Description Score Start End Superfamily
af_P9WG91_255_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9148 252 407 1.20.1250.20
af_P13090_265_521_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8558 191 487 1.20.1250.20
af_Q2FW85_259_476_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8519 250 501 1.20.1250.20
af_Q2G226_196_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8488 190 488 1.20.1250.20
af_P76269_265_456_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8485 254 492 1.20.1250.20
ID Description Score Start End GO Terms
AF-D5ZRQ1-F1-model_v4 Integral membrane efflux protein 0.948 138 510 GO:0005886
GO:0022857
GO:0046677
AF-D5ZRQ1-F1-model_v4 Integral membrane efflux protein 0.9124 138 510 GO:0005886
GO:0022857
GO:0046677
AF-A0A4P0Y955-F1-model_v4 Tripartite multidrug resistance system inner membrane protein 0.8943 85 406 GO:0005886
GO:0022857
AF-A0A7W1HZL5-F1-model_v4 MFS transporter 0.8863 133 496 GO:0016020
GO:0022857
AF-A0A3C1KFG0-F1-model_v4 MFS transporter 0.8844 24 444 GO:0005886
GO:0022857

Map