F416169

General Info

Members Datasets Scaffolds Average Seq Length
344 247 343 186

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_048650|Ga0500595_048650_270_956
Length 228
Sequence MLNPERLNSDKGTIVWLPPGGHVLRYAASIRSSGAKPMSTTGWVVIGVIAVFVLWIIMIYNGLVAMRQRVGQSFSDIDVQLKQRLDLIPNLVEVVKGYAAHERGTLEAVVQARNAAISARGQGTGSEQQIAAENQLSGALRQLFALSEAYPDLKANQNFQQLQSEISDIENKIAAARRFFNNAVQEYNTGIQQFPAALFAGSLGFREKTFFEAGEERQVLEKAPQVKF

Samples

Sample ID Description Type Environment
1 2891562705 Microbispora tritici MT50 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
121 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
152 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 6.1
Rhizosphere 81.98
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10096829 3300003203 Bacteria 884
2 JGI25404J52841_10011681 3300003659 Bacteria 1896
3 Ga0070658_10214397 3300005327 Bacteria 1627
4 Ga0070677_10278253 3300005333 Bacteria 842
5 Ga0070666_10631268 3300005335 Bacteria 783
6 Ga0070680_100143432 3300005336 Bacteria 2003
7 Ga0070680_100527772 3300005336 Bacteria 1011
8 Ga0070689_100009292 3300005340 Bacteria 6967
9 Ga0070689_100100187 3300005340 Bacteria 2292
10 Ga0070668_100452633 3300005347 Bacteria 1104
11 Ga0070669_100115872 3300005353 Bacteria 2039
12 Ga0070675_100658800 3300005354 Bacteria 952
13 Ga0070671_100035025 3300005355 Bacteria 4158
14 Ga0070673_100194666 3300005364 Bacteria 1743
15 Ga0070673_100263314 3300005364 Bacteria 1507
16 Ga0070714_100090388 3300005435 Bacteria 2681
17 Ga0070714_100195739 3300005435 Bacteria 1847
18 Ga0070713_100063565 3300005436 Bacteria 3095
19 Ga0070713_100082081 3300005436 Bacteria 2752
20 Ga0070713_100318015 3300005436 Bacteria 1437
21 Ga0070710_10268329 3300005437 Bacteria 1103
22 Ga0070705_100241264 3300005440 Bacteria 1263
23 Ga0070700_100248440 3300005441 Bacteria 1275
24 Ga0070694_100096390 3300005444 Bacteria 2085
25 Ga0070678_100323756 3300005456 Bacteria 1317
26 Ga0070681_10015090 3300005458 Bacteria 7685
27 Ga0070679_100004048 3300005530 Bacteria 13502
28 Ga0070679_100451613 3300005530 Bacteria 1230
29 Ga0070697_100000500 3300005536 Bacteria 29734
30 Ga0070672_100703684 3300005543 Bacteria 885
31 Ga0070695_100008297 3300005545 Bacteria 6163
32 Ga0070704_100527189 3300005549 Bacteria 1029
33 Ga0068854_100709859 3300005578 Bacteria 869
34 Ga0068856_100759323 3300005614 Bacteria 990
35 Ga0068856_100919585 3300005614 Bacteria 893
36 Ga0070702_100244069 3300005615 Bacteria 1214
37 Ga0068864_100784165 3300005618 Bacteria 936
38 Ga0068863_100545106 3300005841 Bacteria 1145
39 Ga0068860_100910698 3300005843 Bacteria 896
40 Ga0068862_100489123 3300005844 Bacteria 1166
41 Ga0068862_100536791 3300005844 Bacteria 1115
42 Ga0081455_10556985 3300005937 Bacteria 757
43 Ga0081540_1000027 3300005983 Bacteria 151880
44 Ga0081539_10051532 3300005985 Bacteria 2318
45 Ga0070717_10048242 3300006028 Bacteria 3492
46 Ga0070717_10148800 3300006028 Bacteria 2025
47 Ga0070717_10320483 3300006028 Bacteria 1381
48 Ga0070717_11016626 3300006028 Bacteria 755
49 Ga0070717_11092034 3300006028 Bacteria 727
50 Ga0075363_100062172 3300006048 Bacteria 2013
51 Ga0075364_10282865 3300006051 Bacteria 1128
52 Ga0070715_10073121 3300006163 Bacteria 1536
53 Ga0070716_100425480 3300006173 Bacteria 961
54 Ga0070712_100013856 3300006175 Bacteria 5161
55 Ga0070712_100292814 3300006175 Bacteria 1315
56 Ga0075367_10078230 3300006178 Bacteria 1997
57 Ga0075367_10489995 3300006178 Bacteria 779
58 Ga0075366_10116184 3300006195 Bacteria 1611
59 Ga0075366_10563020 3300006195 Bacteria 706
60 Ga0075428_100292695 3300006844 Bacteria 1751
61 Ga0075430_100058637 3300006846 Bacteria 3236
62 Ga0075431_100082683 3300006847 Bacteria 3315
63 Ga0075431_100111994 3300006847 Bacteria 2816
64 Ga0075434_100467381 3300006871 Bacteria 1283
65 Ga0068865_100209898 3300006881 Bacteria 1517
66 Ga0075436_100007067 3300006914 Bacteria 7683
67 Ga0075436_100012996 3300006914 Bacteria 5708
68 Ga0075435_100086401 3300007076 Bacteria 2583
69 Ga0075435_100126306 3300007076 Bacteria 2138
70 Ga0075435_100345663 3300007076 Bacteria 1275
71 Ga0105240_11413768 3300009093 Bacteria 731
72 Ga0111539_10037831 3300009094 Bacteria 5822
73 Ga0111539_10624604 3300009094 Bacteria 1255
74 Ga0105245_10163073 3300009098 Bacteria 2116
75 Ga0105245_11510066 3300009098 Bacteria 723
76 Ga0105247_10456208 3300009101 Bacteria 923
77 Ga0114129_10176643 3300009147 Bacteria 2909
78 Ga0114129_11573889 3300009147 Bacteria 805
79 Ga0105242_10502954 3300009176 Bacteria 1153
80 Ga0105242_10923447 3300009176 Bacteria 875
81 Ga0105248_10021344 3300009177 Bacteria 7176
82 Ga0105238_10737089 3300009551 Bacteria 999
83 Ga0105249_10014517 3300009553 Bacteria 6963
84 Ga0105239_10022434 3300010375 Bacteria 6959
85 Ga0163162_10254731 3300013306 Bacteria 1887
86 Ga0157375_10389993 3300013308 Bacteria 1559
87 Ga0163163_10119034 3300014325 Bacteria 2674
88 Ga0163163_10853253 3300014325 Bacteria 974
89 Ga0157380_11841391 3300014326 Bacteria 665
90 Ga0182008_10127987 3300014497 Bacteria 1265
91 Ga0157377_10207290 3300014745 Bacteria 1248
92 Ga0157376_11250562 3300014969 Bacteria 771
93 Ga0182007_10060226 3300015262 Bacteria 1244
94 Ga0224572_1081361 3300024225 Bacteria 598
95 Ga0209758_1000125 3300025297 Bacteria 189869
96 Ga0209758_1075337 3300025297 Bacteria 1043
97 Ga0207426_1036645 3300025302 Bacteria 1557
98 Ga0207692_10020767 3300025898 Bacteria 2994
99 Ga0207692_10285354 3300025898 Bacteria 1000
100 Ga0207688_10612689 3300025901 Bacteria 686
101 Ga0207680_10128347 3300025903 Bacteria 1668
102 Ga0207685_10042188 3300025905 Bacteria 1712
103 Ga0207685_10219906 3300025905 Bacteria 903
104 Ga0207699_10136261 3300025906 Bacteria 1608
105 Ga0207707_10466167 3300025912 Bacteria 1080
106 Ga0207693_10012845 3300025915 Bacteria 6756
107 Ga0207693_10027584 3300025915 Bacteria 4488
108 Ga0207693_10914090 3300025915 Bacteria 673
109 Ga0207663_10227823 3300025916 Bacteria 1360
110 Ga0207663_10287401 3300025916 Bacteria 1224
111 Ga0207662_10241326 3300025918 Bacteria 1183
112 Ga0207657_10218385 3300025919 Bacteria 1528
113 Ga0207652_10138238 3300025921 Bacteria 2177
114 Ga0207652_10487681 3300025921 Bacteria 1110
115 Ga0207681_10047414 3300025923 Bacteria 2895
116 Ga0207681_10463173 3300025923 Bacteria 1033
117 Ga0207694_10847659 3300025924 Bacteria 772
118 Ga0207650_10347098 3300025925 Bacteria 1220
119 Ga0207659_10641283 3300025926 Bacteria 907
120 Ga0207687_10634729 3300025927 Bacteria 903
121 Ga0207700_10107050 3300025928 Bacteria 2243
122 Ga0207700_10116244 3300025928 Bacteria 2161
123 Ga0207700_10189659 3300025928 Bacteria 1727
124 Ga0207700_10500043 3300025928 Bacteria 1076
125 Ga0207700_11170183 3300025928 Bacteria 687
126 Ga0207664_10126604 3300025929 Bacteria 2145
127 Ga0207664_10201007 3300025929 Bacteria 1720
128 Ga0207644_10063066 3300025931 Bacteria 2690
129 Ga0207686_10041274 3300025934 Bacteria 2812
130 Ga0207709_10195202 3300025935 Bacteria 1441
131 Ga0207670_10005717 3300025936 Bacteria 6855
132 Ga0207670_10178483 3300025936 Bacteria 1598
133 Ga0207704_10123658 3300025938 Bacteria 1776
134 Ga0207665_10026561 3300025939 Bacteria 3822
135 Ga0207711_10238212 3300025941 Bacteria 1668
136 Ga0207661_10331590 3300025944 Bacteria 1370
137 Ga0207651_10254325 3300025960 Bacteria 1439
138 Ga0207651_10292888 3300025960 Bacteria 1350
139 Ga0207712_10027116 3300025961 Bacteria 3823
140 Ga0207712_10801335 3300025961 Bacteria 828
141 Ga0207640_10538011 3300025981 Bacteria 979
142 Ga0207639_10831153 3300026041 Bacteria 862
143 Ga0207708_10278637 3300026075 Bacteria 1354
144 Ga0207702_11323393 3300026078 Bacteria 714
145 Ga0207641_10604047 3300026088 Bacteria 1074
146 Ga0207648_10101471 3300026089 Bacteria 2522
147 Ga0207648_10540999 3300026089 Bacteria 1069
148 Ga0207676_10342151 3300026095 Bacteria 1380
149 Ga0207683_10904549 3300026121 Bacteria 819
150 Ga0207698_10580425 3300026142 Bacteria 1103
151 Ga0209179_1048563 3300027512 Bacteria 906
152 Ga0207428_10239365 3300027907 Bacteria 1356
153 Ga0268264_10783246 3300028381 Bacteria 952
154 Ga0265763_1001107 3300030763 Bacteria 1847
155 Ga0265330_10118401 3300031235 Bacteria 1129
156 Ga0265332_10003092 3300031238 Bacteria 8119
157 Ga0265320_10107061 3300031240 Bacteria 1284
158 Ga0265340_10000382 3300031247 Bacteria 23632
159 Ga0265340_10022581 3300031247 Bacteria 3216
160 Ga0265339_10001051 3300031249 Bacteria 20994
161 Ga0265331_10039276 3300031250 Bacteria 2309
162 Ga0265331_10202122 3300031250 Bacteria 895
163 Ga0316575_10023320 3300031665 Bacteria 2392
164 Ga0316579_10037310 3300031691 Bacteria 2245
165 Ga0265342_10000179 3300031712 Bacteria 70615
166 Ga0316578_10092747 3300031728 Bacteria 1805
167 Ga0373938_0026117 3300034957 Bacteria 1220
168 Ga0373929_0073982 3300035085 Bacteria 819
169 Ga0373944_0004999 3300035089 Bacteria 3478
170 Ga0373949_0037103 3300035090 Bacteria 1184
171 Ga0373951_0047826 3300035091 Bacteria 1046
172 Ga0373932_0060254 3300035112 Bacteria 1151
173 Ga0373936_0020457 3300035113 Bacteria 2571
174 Ga0373939_0019598 3300035114 Bacteria 1827
175 Ga0373941_0055356 3300035115 Bacteria 1275
176 Ga0373945_0001643 3300035116 Bacteria 6859
177 Ga0373957_0199137 3300035120 Bacteria 834
178 Ga0373960_0004427 3300035121 Bacteria 3218
179 Ga0373943_0000755 3300035170 Bacteria 14106
180 Ga0373946_0003944 3300035171 Bacteria 5276
181 Ga0373955_0227179 3300035172 Bacteria 1116
182 Ga0373961_0003546 3300035241 Bacteria 3845
183 Ga0373962_0034244 3300035242 Bacteria 1406
184 Ga0316574_0001571 3300035398 Bacteria 10911
185 Ga0373931_0043503 3300035691 Bacteria 2365
186 Ga0373931_0278272 3300035691 Bacteria 1026
187 Ga0373931_0575404 3300035691 Bacteria 734
188 Ga0373931_0581895 3300035691 Bacteria 730
189 Ga0373935_0006842 3300035692 Bacteria 6810
190 Ga0373935_0351605 3300035692 Bacteria 1051
191 Ga0373927_0000113 3300035695 Bacteria 60608
192 Ga0373927_0170794 3300035695 Bacteria 1425
193 Ga0373927_0604085 3300035695 Bacteria 725
194 Ga0373947_0010011 3300035725 Bacteria 5443
195 Ga0373947_0570972 3300035725 Bacteria 770
196 Ga0373937_0565345 3300036401 Bacteria 1080
197 Ga0316582_0210392 3300036647 Bacteria 1329
198 Ga0316584_0012384 3300036712 Bacteria 6013
199 Ga0373925_0001554 3300037068 Bacteria 19523
200 Ga0436364_0411364 3300037853 Bacteria 19778
201 Ga0436364_1076018 3300037853 Bacteria 802
202 Ga0400486_07971 3300038742 Bacteria 1841
203 Ga0400487_06006 3300039110 Bacteria 2152
204 Ga0436365_0830611 3300039437 Bacteria 1152
205 Ga0436365_1682764 3300039437 Bacteria 1193
206 Ga0436365_1888218 3300039437 Bacteria 801
207 Ga0436362_0581018 3300039453 Bacteria 657
208 Ga0451855_1096739 3300041511 Bacteria 759
209 Ga0439456_080044 3300042013 Bacteria 729
210 Ga0495592_0334110 3300046454 Bacteria 976
211 Ga0495603_0270382 3300046455 Bacteria 978
212 Ga0495629_0062012 3300046459 Bacteria 2613
213 Ga0495639_0309750 3300046475 Unclassified 788
214 Ga0495662_0070675 3300046476 Bacteria 1691
215 Ga0495584_0027317 3300046491 Bacteria 2892
216 Ga0495618_0241810 3300046514 Unclassified 1134
217 Ga0495628_0096263 3300046516 Bacteria 2287
218 Ga0495630_0044290 3300046517 Bacteria 3325
219 Ga0495630_0734678 3300046517 Bacteria 755
220 Ga0495643_0248752 3300046522 Bacteria 831
221 Ga0495665_0185412 3300046531 Bacteria 1080
222 Ga0495640_0021632 3300046533 Bacteria 4715
223 Ga0495634_0015892 3300046642 Bacteria 5392
224 Ga0495634_0226258 3300046642 Bacteria 1152
225 Ga0495635_0029566 3300046663 Bacteria 3811
226 Ga0495613_0014810 3300046689 Bacteria 5788
227 Ga0495613_0411277 3300046689 Bacteria 921
228 Ga0495624_0005096 3300046690 Bacteria 9497
229 Ga0495649_0226221 3300046694 Bacteria 967
230 Ga0495581_0005953 3300047315 Bacteria 7069
231 Ga0495604_0199546 3300047317 Bacteria 1389
232 Ga0495674_0511040 3300047319 Bacteria 960
233 Ga0495672_0078847 3300047320 Bacteria 1841
234 Ga0495676_0013114 3300047321 Bacteria 7456
235 Ga0495684_0000845 3300047471 Bacteria 24740
236 Ga0495684_0181170 3300047471 Bacteria 1561
237 Ga0496100_0001216 3300048903 Bacteria 12519
238 Ga0496101_0004012 3300048904 Bacteria 9205
239 Ga0496102_0369766 3300048905 Bacteria 1349
240 Ga0496103_0077182 3300048906 Bacteria 2091
241 Ga0496104_0087448 3300048907 Bacteria 2976
242 Ga0496105_0017993 3300048908 Bacteria 5671
243 Ga0496106_0006194 3300048909 Bacteria 8849
244 Ga0496107_0045247 3300048910 Bacteria 3166
245 Ga0496108_0010337 3300048911 Bacteria 7579
246 Ga0496108_0145041 3300048911 Bacteria 2046
247 Ga0496109_0019555 3300048912 Bacteria 5975
248 Ga0496110_0012361 3300048913 Bacteria 7020
249 Ga0496110_0396676 3300048913 Bacteria 1258
250 Ga0496110_0466050 3300048913 Bacteria 1151
251 Ga0496111_0019645 3300048914 Bacteria 4698
252 Ga0496112_0596337 3300048915 Bacteria 1037
253 Ga0496113_0641310 3300048916 Bacteria 850
254 Ga0496114_0043380 3300048917 Bacteria 3729
255 Ga0496115_0013352 3300048918 Bacteria 6213
256 Ga0496115_0023162 3300048918 Bacteria 4818
257 Ga0496115_0343870 3300048918 Bacteria 1217
258 Ga0501032_0119760 3300049569 Bacteria 1740
259 Ga0501033_0056115 3300049570 Bacteria 2911
260 Ga0501033_0066962 3300049570 Bacteria 2641
261 Ga0501034_0247971 3300049571 Bacteria 1725
262 Ga0501034_0287620 3300049571 Bacteria 1582
263 Ga0501034_0394623 3300049571 Bacteria 1307
264 Ga0501036_0090330 3300049572 Bacteria 2587
265 Ga0501037_0024269 3300049573 Bacteria 4484
266 Ga0501038_0080857 3300049574 Bacteria 2738
267 Ga0501038_0086091 3300049574 Bacteria 2641
268 Ga0501039_0133264 3300049575 Bacteria 1950
269 Ga0501040_0062309 3300049576 Bacteria 2566
270 Ga0501042_0269332 3300049578 Bacteria 1230
271 Ga0501046_0040944 3300049580 Bacteria 3699
272 Ga0501047_0282301 3300049581 Bacteria 1505
273 Ga0501047_0443002 3300049581 Bacteria 1128
274 Ga0501048_0042810 3300049582 Bacteria 3241
275 Ga0501067_0002830 3300049583 Bacteria 9550
276 Ga0501068_0042557 3300049584 Bacteria 2731
277 Ga0501069_0051918 3300049585 Bacteria 2282
278 Ga0501069_0065083 3300049585 Bacteria 2038
279 Ga0501070_0219988 3300049586 Bacteria 1557
280 Ga0501071_0069182 3300049587 Bacteria 2570
281 Ga0501073_0038009 3300049589 Bacteria 3416
282 Ga0501073_0873890 3300049589 Bacteria 619
283 Ga0501074_0019832 3300049590 Bacteria 4883
284 Ga0501075_0047075 3300049591 Bacteria 3241
285 Ga0501076_0024956 3300049592 Bacteria 4624
286 Ga0501076_0700865 3300049592 Bacteria 836
287 Ga0501079_0049584 3300049741 Bacteria 3241
288 Ga0501081_0100812 3300049743 Bacteria 2041
289 Ga0501081_0255756 3300049743 Bacteria 1279
290 Ga0501083_0069118 3300049744 Bacteria 2350
291 Ga0501083_0110824 3300049744 Bacteria 1805
292 Ga0501035_0126114 3300049822 Bacteria 2234
293 Ga0501044_0000266 3300049823 Bacteria 66205
294 Ga0501044_0050316 3300049823 Bacteria 4300
295 Ga0501044_1040461 3300049823 Bacteria 689
296 Ga0501045_0085057 3300049824 Bacteria 2334
297 Ga0501045_0253694 3300049824 Bacteria 1309
298 nmdc:mga03683_88550_c1 3300050489 Bacteria 1347
299 nmdc:mga03n38_685132_c1 3300050490 Bacteria 590
300 nmdc:mga0yw44_187012_c1 3300050492 Bacteria 1365
301 nmdc:mga0yw44_206222_c1 3300050492 Bacteria 1299
302 nmdc:mga0k408_466664_c1 3300050493 Bacteria 749
303 nmdc:mga0k408_517576_c1 3300050493 Bacteria 706
304 nmdc:mga06z11_10302_c1 3300050494 Bacteria 3977
305 nmdc:mga06z11_123143_c1 3300050494 Bacteria 1449
306 nmdc:mga06z11_235136_c1 3300050494 Bacteria 1075
307 nmdc:mga06z11_361389_c1 3300050494 Bacteria 870
308 nmdc:mga07m45_382459_c1 3300050496 Bacteria 817
309 nmdc:mga07m45_83764_c1 3300050496 Bacteria 1823
310 nmdc:mga05p37_931948_c1 3300050507 Bacteria 932
311 nmdc:mga0qj67_75381_c1 3300050509 Bacteria 2696
312 nmdc:mga06r32_139502_c1 3300050510 Bacteria 2400
313 nmdc:mga06r32_479653_c1 3300050510 Bacteria 1222
314 nmdc:mga06r32_49419_c1 3300050510 Bacteria 4021
315 nmdc:mga08y16_1203364_c1 3300050511 Bacteria 728
316 nmdc:mga08y16_29111_c1 3300050511 Bacteria 5821
317 nmdc:mga0n895_215859_c1 3300050512 Bacteria 1948
318 nmdc:mga0n895_480451_c1 3300050512 Bacteria 1253
319 nmdc:mga0rr50_16097_c1 3300050513 Bacteria 4956
320 nmdc:mga0rr50_167651_c1 3300050513 Bacteria 1787
321 nmdc:mga08x19_182606_c1 3300050514 Bacteria 1432
322 nmdc:mga08x19_21067_c1 3300050514 Bacteria 4021
323 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
324 nmdc:mga0sz30_46531_c1 3300050516 Bacteria 1832
325 nmdc:mga0sz30_97623_c1 3300050516 Bacteria 1282
326 Ga0495595_0024231 3300053084 Bacteria 2680
327 Ga0495619_0095056 3300053085 Bacteria 2022
328 Ga0495619_0212677 3300053085 Bacteria 1339
329 Ga0495619_0406141 3300053085 Bacteria 940
330 Ga0500646_0095836 3300053090 Bacteria 925
331 Ga0500641_0047385 3300053096 Bacteria 1757
332 Ga0500562_083391 3300053108 Bacteria 866
333 Ga0500593_004821 3300053117 Bacteria 5258
334 Ga0500595_048650 3300053119 Bacteria 1324
335 Ga0500577_0194288 3300053142 Bacteria 874
336 Ga0500616_0091581 3300053153 Bacteria 1504
337 Ga0500616_0188600 3300053153 Bacteria 922
338 Ga0500616_0211042 3300053153 Bacteria 853
339 Ga0501084_0247704 3300054114 Bacteria 1504
340 Ga0501082_0273769 3300060353 Bacteria 1469
341 Ga0501082_0391133 3300060353 Bacteria 1213
342 Ga0501082_0759227 3300060353 Bacteria 849
343 Ga0501082_1189313 3300060353 Bacteria 666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0287620 Ga0501034_0287620_1091_1570 159
2 3300049578 Ga0501042_0269332 Ga0501042_0269332_738_1217 159
3 3300049586 Ga0501070_0219988 Ga0501070_0219988_13_492 159
4 3300050494 nmdc:mga06z11_10302_c1 nmdc:mga06z11_10302_c1_3479_3958 159
5 3300050512 nmdc:mga0n895_215859_c1 nmdc:mga0n895_215859_c1_16_495 159
6 3300053142 Ga0500577_0194288 Ga0500577_0194288_267_815 159
7 3300025928 Ga0207700_11170183 Ga0207700_111701831 166
8 3300050490 nmdc:mga03n38_685132_c1 nmdc:mga03n38_685132_c1_38_553 167
9 3300046491 Ga0495584_0027317 Ga0495584_0027317_2281_2847 175
10 3300046694 Ga0495649_0226221 Ga0495649_0226221_175_738 175
11 3300005436 Ga0070713_100063565 Ga0070713_1000635652 176
12 3300005437 Ga0070710_10268329 Ga0070710_102683292 176
13 3300006175 Ga0070712_100013856 Ga0070712_1000138562 176
14 3300024225 Ga0224572_1081361 Ga0224572_10813611 176
15 3300025898 Ga0207692_10285354 Ga0207692_102853542 176
16 3300025915 Ga0207693_10012845 Ga0207693_100128457 176
17 3300025916 Ga0207663_10227823 Ga0207663_102278232 176
18 3300025928 Ga0207700_10107050 Ga0207700_101070502 176
19 3300025944 Ga0207661_10331590 Ga0207661_103315903 176
20 3300031238 Ga0265332_10003092 Ga0265332_100030923 176
21 3300031247 Ga0265340_10000382 Ga0265340_100003824 176
22 3300031249 Ga0265339_10001051 Ga0265339_100010513 176
23 3300031250 Ga0265331_10039276 Ga0265331_100392761 176
24 3300031712 Ga0265342_10000179 Ga0265342_1000017921 176
25 3300005436 Ga0070713_100082081 Ga0070713_1000820812 177
26 3300035691 Ga0373931_0278272 Ga0373931_0278272_474_1007 177
27 3300049823 Ga0501044_1040461 Ga0501044_1040461_144_677 177
28 3300006028 Ga0070717_10148800 Ga0070717_101488003 178
29 iso_pu_bacteria 2891562705 2891567778 178
30 3300006175 Ga0070712_100292814 Ga0070712_1002928141 179
31 3300025915 Ga0207693_10914090 Ga0207693_109140901 179
32 3300030763 Ga0265763_1001107 Ga0265763_10011072 179
33 3300038742 Ga0400486_07971 Ga0400486_07971_1004_1567 179
34 3300039110 Ga0400487_06006 Ga0400487_06006_797_1360 179
35 3300046455 Ga0495603_0270382 Ga0495603_0270382_29_607 179
36 3300047320 Ga0495672_0078847 Ga0495672_0078847_26_604 180
37 3300053090 Ga0500646_0095836 Ga0500646_0095836_12_554 180
38 3300050514 nmdc:mga08x19_21067_c1 nmdc:mga08x19_21067_c1_2905_3474 181
39 3300009551 Ga0105238_10737089 Ga0105238_107370892 182
40 3300046514 Ga0495618_0241810 Ga0495618_0241810_464_1012 182
41 3300046531 Ga0495665_0185412 Ga0495665_0185412_32_580 182
42 3300046642 Ga0495634_0015892 Ga0495634_0015892_2286_2834 182
43 3300046689 Ga0495613_0411277 Ga0495613_0411277_154_702 182
44 3300047471 Ga0495684_0000845 Ga0495684_0000845_6651_7199 182
45 3300047471 Ga0495684_0181170 Ga0495684_0181170_490_1038 182
46 3300049589 Ga0501073_0873890 Ga0501073_0873890_29_577 182
47 3300053085 Ga0495619_0406141 Ga0495619_0406141_337_885 182
48 3300035691 Ga0373931_0575404 Ga0373931_0575404_51_620 183
49 3300041511 Ga0451855_1096739 Ga0451855_1096739_153_740 184
50 3300049583 Ga0501067_0002830 Ga0501067_0002830_7576_8145 184
51 3300049585 Ga0501069_0065083 Ga0501069_0065083_216_785 184
52 3300006178 Ga0075367_10489995 Ga0075367_104899952 186
53 3300031665 Ga0316575_10023320 Ga0316575_100233203 186
54 3300031691 Ga0316579_10037310 Ga0316579_100373101 186
55 3300031728 Ga0316578_10092747 Ga0316578_100927472 186
56 3300035398 Ga0316574_0001571 Ga0316574_0001571_775_1338 186
57 3300036647 Ga0316582_0210392 Ga0316582_0210392_126_689 186
58 3300036712 Ga0316584_0012384 Ga0316584_0012384_3353_3916 186
59 3300048906 Ga0496103_0077182 Ga0496103_0077182_1161_1721 186
60 3300049743 Ga0501081_0255756 Ga0501081_0255756_524_1084 186
61 3300053153 Ga0500616_0091581 Ga0500616_0091581_542_1102 186
62 3300053153 Ga0500616_0188600 Ga0500616_0188600_141_701 186
63 3300060353 Ga0501082_0759227 Ga0501082_0759227_185_745 186
64 3300003203 JGI25406J46586_10096829 JGI25406J46586_100968292 187
65 3300003659 JGI25404J52841_10011681 JGI25404J52841_100116812 187
66 3300005327 Ga0070658_10214397 Ga0070658_102143972 187
67 3300005333 Ga0070677_10278253 Ga0070677_102782531 187
68 3300005335 Ga0070666_10631268 Ga0070666_106312681 187
69 3300005336 Ga0070680_100143432 Ga0070680_1001434321 187
70 3300005336 Ga0070680_100527772 Ga0070680_1005277721 187
71 3300005340 Ga0070689_100009292 Ga0070689_1000092926 187
72 3300005340 Ga0070689_100100187 Ga0070689_1001001872 187
73 3300005347 Ga0070668_100452633 Ga0070668_1004526332 187
74 3300005353 Ga0070669_100115872 Ga0070669_1001158722 187
75 3300005354 Ga0070675_100658800 Ga0070675_1006588002 187
76 3300005355 Ga0070671_100035025 Ga0070671_1000350253 187
77 3300005364 Ga0070673_100194666 Ga0070673_1001946662 187
78 3300005364 Ga0070673_100263314 Ga0070673_1002633142 187
79 3300005435 Ga0070714_100090388 Ga0070714_1000903881 187
80 3300005435 Ga0070714_100195739 Ga0070714_1001957392 187
81 3300005436 Ga0070713_100318015 Ga0070713_1003180152 187
82 3300005440 Ga0070705_100241264 Ga0070705_1002412642 187
83 3300005441 Ga0070700_100248440 Ga0070700_1002484401 187
84 3300005444 Ga0070694_100096390 Ga0070694_1000963902 187
85 3300005456 Ga0070678_100323756 Ga0070678_1003237562 187
86 3300005458 Ga0070681_10015090 Ga0070681_100150903 187
87 3300005530 Ga0070679_100004048 Ga0070679_10000404813 187
88 3300005530 Ga0070679_100451613 Ga0070679_1004516132 187
89 3300005536 Ga0070697_100000500 Ga0070697_10000050018 187
90 3300005543 Ga0070672_100703684 Ga0070672_1007036842 187
91 3300005545 Ga0070695_100008297 Ga0070695_1000082973 187
92 3300005549 Ga0070704_100527189 Ga0070704_1005271891 187
93 3300005578 Ga0068854_100709859 Ga0068854_1007098592 187
94 3300005614 Ga0068856_100759323 Ga0068856_1007593231 187
95 3300005614 Ga0068856_100919585 Ga0068856_1009195852 187
96 3300005615 Ga0070702_100244069 Ga0070702_1002440692 187
97 3300005618 Ga0068864_100784165 Ga0068864_1007841652 187
98 3300005841 Ga0068863_100545106 Ga0068863_1005451061 187
99 3300005843 Ga0068860_100910698 Ga0068860_1009106982 187
100 3300005844 Ga0068862_100489123 Ga0068862_1004891232 187
101 3300005844 Ga0068862_100536791 Ga0068862_1005367911 187
102 3300005937 Ga0081455_10556985 Ga0081455_105569851 187
103 3300005983 Ga0081540_1000027 Ga0081540_100002718 187
104 3300005985 Ga0081539_10051532 Ga0081539_100515322 187
105 3300006028 Ga0070717_10048242 Ga0070717_100482422 187
106 3300006028 Ga0070717_10320483 Ga0070717_103204832 187
107 3300006028 Ga0070717_11016626 Ga0070717_110166262 187
108 3300006028 Ga0070717_11092034 Ga0070717_110920341 187
109 3300006048 Ga0075363_100062172 Ga0075363_1000621722 187
110 3300006051 Ga0075364_10282865 Ga0075364_102828651 187
111 3300006163 Ga0070715_10073121 Ga0070715_100731212 187
112 3300006173 Ga0070716_100425480 Ga0070716_1004254802 187
113 3300006178 Ga0075367_10078230 Ga0075367_100782302 187
114 3300006195 Ga0075366_10116184 Ga0075366_101161843 187
115 3300006195 Ga0075366_10563020 Ga0075366_105630202 187
116 3300006844 Ga0075428_100292695 Ga0075428_1002926952 187
117 3300006846 Ga0075430_100058637 Ga0075430_1000586372 187
118 3300006847 Ga0075431_100082683 Ga0075431_1000826832 187
119 3300006847 Ga0075431_100111994 Ga0075431_1001119942 187
120 3300006871 Ga0075434_100467381 Ga0075434_1004673812 187
121 3300006881 Ga0068865_100209898 Ga0068865_1002098983 187
122 3300006914 Ga0075436_100007067 Ga0075436_1000070676 187
123 3300006914 Ga0075436_100012996 Ga0075436_1000129966 187
124 3300007076 Ga0075435_100086401 Ga0075435_1000864012 187
125 3300007076 Ga0075435_100126306 Ga0075435_1001263061 187
126 3300007076 Ga0075435_100345663 Ga0075435_1003456632 187
127 3300009093 Ga0105240_11413768 Ga0105240_114137681 187
128 3300009094 Ga0111539_10037831 Ga0111539_100378312 187
129 3300009094 Ga0111539_10624604 Ga0111539_106246042 187
130 3300009098 Ga0105245_10163073 Ga0105245_101630732 187
131 3300009098 Ga0105245_11510066 Ga0105245_115100662 187
132 3300009101 Ga0105247_10456208 Ga0105247_104562081 187
133 3300009147 Ga0114129_10176643 Ga0114129_101766432 187
134 3300009147 Ga0114129_11573889 Ga0114129_115738892 187
135 3300009176 Ga0105242_10502954 Ga0105242_105029541 187
136 3300009176 Ga0105242_10923447 Ga0105242_109234471 187
137 3300009177 Ga0105248_10021344 Ga0105248_100213445 187
138 3300009553 Ga0105249_10014517 Ga0105249_100145175 187
139 3300010375 Ga0105239_10022434 Ga0105239_100224345 187
140 3300013306 Ga0163162_10254731 Ga0163162_102547311 187
141 3300013308 Ga0157375_10389993 Ga0157375_103899931 187
142 3300014325 Ga0163163_10119034 Ga0163163_101190342 187
143 3300014325 Ga0163163_10853253 Ga0163163_108532532 187
144 3300014326 Ga0157380_11841391 Ga0157380_118413911 187
145 3300014497 Ga0182008_10127987 Ga0182008_101279871 187
146 3300014745 Ga0157377_10207290 Ga0157377_102072902 187
147 3300014969 Ga0157376_11250562 Ga0157376_112505621 187
148 3300015262 Ga0182007_10060226 Ga0182007_100602262 187
149 3300025297 Ga0209758_1000125 Ga0209758_1000125107 187
150 3300025297 Ga0209758_1075337 Ga0209758_10753372 187
151 3300025302 Ga0207426_1036645 Ga0207426_10366452 187
152 3300025898 Ga0207692_10020767 Ga0207692_100207673 187
153 3300025901 Ga0207688_10612689 Ga0207688_106126891 187
154 3300025903 Ga0207680_10128347 Ga0207680_101283472 187
155 3300025905 Ga0207685_10042188 Ga0207685_100421883 187
156 3300025905 Ga0207685_10219906 Ga0207685_102199061 187
157 3300025906 Ga0207699_10136261 Ga0207699_101362612 187
158 3300025912 Ga0207707_10466167 Ga0207707_104661672 187
159 3300025915 Ga0207693_10027584 Ga0207693_100275845 187
160 3300025916 Ga0207663_10287401 Ga0207663_102874012 187
161 3300025918 Ga0207662_10241326 Ga0207662_102413261 187
162 3300025919 Ga0207657_10218385 Ga0207657_102183852 187
163 3300025921 Ga0207652_10138238 Ga0207652_101382382 187
164 3300025921 Ga0207652_10487681 Ga0207652_104876811 187
165 3300025923 Ga0207681_10047414 Ga0207681_100474142 187
166 3300025923 Ga0207681_10463173 Ga0207681_104631731 187
167 3300025924 Ga0207694_10847659 Ga0207694_108476591 187
168 3300025925 Ga0207650_10347098 Ga0207650_103470982 187
169 3300025926 Ga0207659_10641283 Ga0207659_106412831 187
170 3300025927 Ga0207687_10634729 Ga0207687_106347292 187
171 3300025928 Ga0207700_10116244 Ga0207700_101162441 187
172 3300025928 Ga0207700_10189659 Ga0207700_101896592 187
173 3300025928 Ga0207700_10500043 Ga0207700_105000431 187
174 3300025929 Ga0207664_10126604 Ga0207664_101266043 187
175 3300025929 Ga0207664_10201007 Ga0207664_102010072 187
176 3300025931 Ga0207644_10063066 Ga0207644_100630661 187
177 3300025934 Ga0207686_10041274 Ga0207686_100412742 187
178 3300025935 Ga0207709_10195202 Ga0207709_101952022 187
179 3300025936 Ga0207670_10005717 Ga0207670_100057176 187
180 3300025936 Ga0207670_10178483 Ga0207670_101784833 187
181 3300025938 Ga0207704_10123658 Ga0207704_101236582 187
182 3300025939 Ga0207665_10026561 Ga0207665_100265613 187
183 3300025941 Ga0207711_10238212 Ga0207711_102382122 187
184 3300025960 Ga0207651_10254325 Ga0207651_102543252 187
185 3300025960 Ga0207651_10292888 Ga0207651_102928882 187
186 3300025961 Ga0207712_10027116 Ga0207712_100271165 187
187 3300025961 Ga0207712_10801335 Ga0207712_108013352 187
188 3300025981 Ga0207640_10538011 Ga0207640_105380111 187
189 3300026041 Ga0207639_10831153 Ga0207639_108311531 187
190 3300026075 Ga0207708_10278637 Ga0207708_102786373 187
191 3300026078 Ga0207702_11323393 Ga0207702_113233931 187
192 3300026088 Ga0207641_10604047 Ga0207641_106040472 187
193 3300026089 Ga0207648_10101471 Ga0207648_101014714 187
194 3300026089 Ga0207648_10540999 Ga0207648_105409992 187
195 3300026095 Ga0207676_10342151 Ga0207676_103421511 187
196 3300026121 Ga0207683_10904549 Ga0207683_109045491 187
197 3300026142 Ga0207698_10580425 Ga0207698_105804252 187
198 3300027512 Ga0209179_1048563 Ga0209179_10485631 187
199 3300027907 Ga0207428_10239365 Ga0207428_102393651 187
200 3300028381 Ga0268264_10783246 Ga0268264_107832462 187
201 3300031235 Ga0265330_10118401 Ga0265330_101184012 187
202 3300031240 Ga0265320_10107061 Ga0265320_101070611 187
203 3300031247 Ga0265340_10022581 Ga0265340_100225813 187
204 3300031250 Ga0265331_10202122 Ga0265331_102021221 187
205 3300034957 Ga0373938_0026117 Ga0373938_0026117_589_1152 187
206 3300035085 Ga0373929_0073982 Ga0373929_0073982_115_678 187
207 3300035089 Ga0373944_0004999 Ga0373944_0004999_1382_1945 187
208 3300035090 Ga0373949_0037103 Ga0373949_0037103_309_872 187
209 3300035091 Ga0373951_0047826 Ga0373951_0047826_87_650 187
210 3300035112 Ga0373932_0060254 Ga0373932_0060254_559_1122 187
211 3300035113 Ga0373936_0020457 Ga0373936_0020457_877_1440 187
212 3300035114 Ga0373939_0019598 Ga0373939_0019598_181_744 187
213 3300035115 Ga0373941_0055356 Ga0373941_0055356_506_1069 187
214 3300035116 Ga0373945_0001643 Ga0373945_0001643_1562_2125 187
215 3300035120 Ga0373957_0199137 Ga0373957_0199137_259_822 187
216 3300035121 Ga0373960_0004427 Ga0373960_0004427_2250_2813 187
217 3300035170 Ga0373943_0000755 Ga0373943_0000755_364_927 187
218 3300035171 Ga0373946_0003944 Ga0373946_0003944_4240_4803 187
219 3300035172 Ga0373955_0227179 Ga0373955_0227179_45_608 187
220 3300035241 Ga0373961_0003546 Ga0373961_0003546_2123_2686 187
221 3300035242 Ga0373962_0034244 Ga0373962_0034244_428_991 187
222 3300035691 Ga0373931_0043503 Ga0373931_0043503_1252_1815 187
223 3300035691 Ga0373931_0581895 Ga0373931_0581895_114_677 187
224 3300035692 Ga0373935_0006842 Ga0373935_0006842_3148_3711 187
225 3300035692 Ga0373935_0351605 Ga0373935_0351605_259_822 187
226 3300035695 Ga0373927_0000113 Ga0373927_0000113_19018_19581 187
227 3300035695 Ga0373927_0170794 Ga0373927_0170794_762_1325 187
228 3300035695 Ga0373927_0604085 Ga0373927_0604085_78_641 187
229 3300035725 Ga0373947_0010011 Ga0373947_0010011_1956_2519 187
230 3300035725 Ga0373947_0570972 Ga0373947_0570972_175_738 187
231 3300036401 Ga0373937_0565345 Ga0373937_0565345_77_640 187
232 3300037068 Ga0373925_0001554 Ga0373925_0001554_17018_17581 187
233 3300037853 Ga0436364_0411364 Ga0436364_0411364_7215_7778 187
234 3300037853 Ga0436364_1076018 Ga0436364_1076018_109_672 187
235 3300039437 Ga0436365_0830611 Ga0436365_0830611_68_631 187
236 3300039437 Ga0436365_1682764 Ga0436365_1682764_567_1130 187
237 3300039437 Ga0436365_1888218 Ga0436365_1888218_158_721 187
238 3300039453 Ga0436362_0581018 Ga0436362_0581018_46_609 187
239 3300042013 Ga0439456_080044 Ga0439456_080044_74_637 187
240 3300046454 Ga0495592_0334110 Ga0495592_0334110_87_650 187
241 3300046459 Ga0495629_0062012 Ga0495629_0062012_853_1416 187
242 3300046475 Ga0495639_0309750 Ga0495639_0309750_173_736 187
243 3300046476 Ga0495662_0070675 Ga0495662_0070675_402_965 187
244 3300046516 Ga0495628_0096263 Ga0495628_0096263_1155_1718 187
245 3300046517 Ga0495630_0044290 Ga0495630_0044290_1873_2436 187
246 3300046517 Ga0495630_0734678 Ga0495630_0734678_21_584 187
247 3300046522 Ga0495643_0248752 Ga0495643_0248752_182_745 187
248 3300046533 Ga0495640_0021632 Ga0495640_0021632_3003_3566 187
249 3300046642 Ga0495634_0226258 Ga0495634_0226258_456_1019 187
250 3300046663 Ga0495635_0029566 Ga0495635_0029566_1530_2093 187
251 3300046689 Ga0495613_0014810 Ga0495613_0014810_3983_4546 187
252 3300046690 Ga0495624_0005096 Ga0495624_0005096_5073_5636 187
253 3300047315 Ga0495581_0005953 Ga0495581_0005953_5044_5607 187
254 3300047317 Ga0495604_0199546 Ga0495604_0199546_709_1272 187
255 3300047319 Ga0495674_0511040 Ga0495674_0511040_309_872 187
256 3300047321 Ga0495676_0013114 Ga0495676_0013114_2706_3269 187
257 3300048903 Ga0496100_0001216 Ga0496100_0001216_6926_7489 187
258 3300048904 Ga0496101_0004012 Ga0496101_0004012_8446_9009 187
259 3300048905 Ga0496102_0369766 Ga0496102_0369766_162_725 187
260 3300048907 Ga0496104_0087448 Ga0496104_0087448_499_1062 187
261 3300048908 Ga0496105_0017993 Ga0496105_0017993_383_946 187
262 3300048909 Ga0496106_0006194 Ga0496106_0006194_4621_5184 187
263 3300048910 Ga0496107_0045247 Ga0496107_0045247_1910_2473 187
264 3300048911 Ga0496108_0010337 Ga0496108_0010337_5967_6530 187
265 3300048911 Ga0496108_0145041 Ga0496108_0145041_630_1193 187
266 3300048912 Ga0496109_0019555 Ga0496109_0019555_4773_5336 187
267 3300048913 Ga0496110_0012361 Ga0496110_0012361_1493_2056 187
268 3300048913 Ga0496110_0396676 Ga0496110_0396676_345_908 187
269 3300048913 Ga0496110_0466050 Ga0496110_0466050_55_618 187
270 3300048914 Ga0496111_0019645 Ga0496111_0019645_3885_4448 187
271 3300048915 Ga0496112_0596337 Ga0496112_0596337_253_816 187
272 3300048916 Ga0496113_0641310 Ga0496113_0641310_266_829 187
273 3300048917 Ga0496114_0043380 Ga0496114_0043380_2788_3351 187
274 3300048918 Ga0496115_0013352 Ga0496115_0013352_4552_5205 187
275 3300048918 Ga0496115_0023162 Ga0496115_0023162_3292_3855 187
276 3300048918 Ga0496115_0343870 Ga0496115_0343870_199_762 187
277 3300049569 Ga0501032_0119760 Ga0501032_0119760_989_1552 187
278 3300049570 Ga0501033_0056115 Ga0501033_0056115_2167_2730 187
279 3300049570 Ga0501033_0066962 Ga0501033_0066962_1753_2316 187
280 3300049571 Ga0501034_0247971 Ga0501034_0247971_18_581 187
281 3300049571 Ga0501034_0394623 Ga0501034_0394623_399_962 187
282 3300049572 Ga0501036_0090330 Ga0501036_0090330_1915_2478 187
283 3300049573 Ga0501037_0024269 Ga0501037_0024269_3442_4005 187
284 3300049574 Ga0501038_0080857 Ga0501038_0080857_977_1540 187
285 3300049574 Ga0501038_0086091 Ga0501038_0086091_726_1289 187
286 3300049575 Ga0501039_0133264 Ga0501039_0133264_40_603 187
287 3300049576 Ga0501040_0062309 Ga0501040_0062309_415_978 187
288 3300049580 Ga0501046_0040944 Ga0501046_0040944_1927_2490 187
289 3300049581 Ga0501047_0282301 Ga0501047_0282301_847_1410 187
290 3300049581 Ga0501047_0443002 Ga0501047_0443002_480_1043 187
291 3300049582 Ga0501048_0042810 Ga0501048_0042810_1389_1952 187
292 3300049584 Ga0501068_0042557 Ga0501068_0042557_138_701 187
293 3300049585 Ga0501069_0051918 Ga0501069_0051918_1000_1563 187
294 3300049587 Ga0501071_0069182 Ga0501071_0069182_918_1481 187
295 3300049589 Ga0501073_0038009 Ga0501073_0038009_1464_2027 187
296 3300049590 Ga0501074_0019832 Ga0501074_0019832_218_781 187
297 3300049591 Ga0501075_0047075 Ga0501075_0047075_236_799 187
298 3300049592 Ga0501076_0024956 Ga0501076_0024956_2136_2699 187
299 3300049592 Ga0501076_0700865 Ga0501076_0700865_164_727 187
300 3300049741 Ga0501079_0049584 Ga0501079_0049584_867_1430 187
301 3300049743 Ga0501081_0100812 Ga0501081_0100812_379_942 187
302 3300049744 Ga0501083_0069118 Ga0501083_0069118_1600_2163 187
303 3300049744 Ga0501083_0110824 Ga0501083_0110824_962_1525 187
304 3300049822 Ga0501035_0126114 Ga0501035_0126114_1372_1935 187
305 3300049823 Ga0501044_0000266 Ga0501044_0000266_64731_65294 187
306 3300049823 Ga0501044_0050316 Ga0501044_0050316_480_1043 187
307 3300049824 Ga0501045_0085057 Ga0501045_0085057_33_596 187
308 3300049824 Ga0501045_0253694 Ga0501045_0253694_457_1020 187
309 3300050489 nmdc:mga03683_88550_c1 nmdc:mga03683_88550_c1_112_690 187
310 3300050492 nmdc:mga0yw44_187012_c1 nmdc:mga0yw44_187012_c1_389_967 187
311 3300050492 nmdc:mga0yw44_206222_c1 nmdc:mga0yw44_206222_c1_150_713 187
312 3300050493 nmdc:mga0k408_466664_c1 nmdc:mga0k408_466664_c1_75_638 187
313 3300050493 nmdc:mga0k408_517576_c1 nmdc:mga0k408_517576_c1_97_660 187
314 3300050494 nmdc:mga06z11_123143_c1 nmdc:mga06z11_123143_c1_386_1060 187
315 3300050494 nmdc:mga06z11_235136_c1 nmdc:mga06z11_235136_c1_92_667 187
316 3300050494 nmdc:mga06z11_361389_c1 nmdc:mga06z11_361389_c1_45_608 187
317 3300050496 nmdc:mga07m45_382459_c1 nmdc:mga07m45_382459_c1_125_688 187
318 3300050496 nmdc:mga07m45_83764_c1 nmdc:mga07m45_83764_c1_544_1218 187
319 3300050507 nmdc:mga05p37_931948_c1 nmdc:mga05p37_931948_c1_52_615 187
320 3300050509 nmdc:mga0qj67_75381_c1 nmdc:mga0qj67_75381_c1_1984_2547 187
321 3300050510 nmdc:mga06r32_139502_c1 nmdc:mga06r32_139502_c1_18_581 187
322 3300050510 nmdc:mga06r32_479653_c1 nmdc:mga06r32_479653_c1_432_995 187
323 3300050510 nmdc:mga06r32_49419_c1 nmdc:mga06r32_49419_c1_2231_2794 187
324 3300050511 nmdc:mga08y16_1203364_c1 nmdc:mga08y16_1203364_c1_98_661 187
325 3300050511 nmdc:mga08y16_29111_c1 nmdc:mga08y16_29111_c1_4360_4926 187
326 3300050512 nmdc:mga0n895_480451_c1 nmdc:mga0n895_480451_c1_676_1239 187
327 3300050513 nmdc:mga0rr50_16097_c1 nmdc:mga0rr50_16097_c1_3831_4394 187
328 3300050513 nmdc:mga0rr50_167651_c1 nmdc:mga0rr50_167651_c1_107_676 187
329 3300050514 nmdc:mga08x19_182606_c1 nmdc:mga08x19_182606_c1_33_596 187
330 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_249127_249690 187
331 3300050516 nmdc:mga0sz30_46531_c1 nmdc:mga0sz30_46531_c1_575_1249 187
332 3300050516 nmdc:mga0sz30_97623_c1 nmdc:mga0sz30_97623_c1_473_1048 187
333 3300053084 Ga0495595_0024231 Ga0495595_0024231_1096_1659 187
334 3300053085 Ga0495619_0095056 Ga0495619_0095056_1117_1680 187
335 3300053085 Ga0495619_0212677 Ga0495619_0212677_543_1106 187
336 3300053096 Ga0500641_0047385 Ga0500641_0047385_661_1236 187
337 3300053108 Ga0500562_083391 Ga0500562_083391_20_595 187
338 3300053117 Ga0500593_004821 Ga0500593_004821_100_663 187
339 3300053119 Ga0500595_048650 Ga0500595_048650_270_956 187
340 3300053153 Ga0500616_0211042 Ga0500616_0211042_20_595 187
341 3300054114 Ga0501084_0247704 Ga0501084_0247704_691_1254 187
342 3300060353 Ga0501082_0273769 Ga0501082_0273769_600_1163 187
343 3300060353 Ga0501082_0391133 Ga0501082_0391133_500_1063 187
344 3300060353 Ga0501082_1189313 Ga0501082_1189313_14_577 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

73

228

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.955 25 171
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9221 25 171
4mh6-assembly1.cif.gz_A 2.8 angstrom crystal structure of type iii secretion protein ysco from vibrio parahaemolyticus 0.5855 21 162
3ajw-assembly1.cif.gz_A structure of flij, a soluble component of flagellar type iii export apparatus 0.584 22 162
1wpa-assembly1.cif.gz_A 1.5 angstrom crystal structure of human occludin fragment 413-522 0.5661 31 145
ID Description Score Start End Superfamily
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8273 17 187 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8185 17 187 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7797 3 177 1.10.287.1490
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7461 3 177 1.10.287.1490
af_Q9SKH8_48_194_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7368 40 135 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A1A3TAW2-F1-model_v4 LemA family protein 0.9889 32 171 GO:0016020
AF-A0A2G9Y108-F1-model_v4 LemA family protein 0.9841 5 172 GO:0016020
AF-X0X1M8-F1-model_v4 LemA family protein 0.9825 1 159 GO:0016020
AF-A0A6I3DXV3-F1-model_v4 deleted 0.9786 1 145
AF-X0X1M8-F1-model_v4 LemA family protein 0.9765 1 159 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.16 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map