F415924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 184 | 344 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10148153|Ga0099794_101481532 |
| Length | 149 |
| Sequence | VGCRAKAIVKFTGESEMAYPKQYRYTKEHEWVDAKGDLATIGITDYAQHELGDVVFVELPKPGAKLETGKTFGTVESVKAVSEIYAPASGEVLEANTELHNTPEELNTDPHGAAWLIKARLTNASELNGLMDAAAYEAYIADKGKEASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 121 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 122 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 123 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 124 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 179 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 0 |
| Rhizoplane | 3.78 |
| Rhizosphere | 94.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10052049 | 3300005327 | Bacteria | 3320 |
| 2 | Ga0068869_100607024 | 3300005334 | Bacteria | 925 |
| 3 | Ga0070680_100188438 | 3300005336 | Bacteria | 1738 |
| 4 | Ga0070682_100395104 | 3300005337 | Bacteria | 1044 |
| 5 | Ga0070675_100091847 | 3300005354 | Bacteria | 2544 |
| 6 | Ga0070671_101811202 | 3300005355 | Bacteria | 542 |
| 7 | Ga0070667_100475349 | 3300005367 | Unclassified | 1144 |
| 8 | Ga0070709_10027330 | 3300005434 | Bacteria | 3391 |
| 9 | Ga0070709_10048382 | 3300005434 | Bacteria | 2653 |
| 10 | Ga0070709_10105289 | 3300005434 | Unclassified | 1886 |
| 11 | Ga0070709_10322108 | 3300005434 | Bacteria | 1135 |
| 12 | Ga0070714_101223190 | 3300005435 | Unclassified | 733 |
| 13 | Ga0070713_100012481 | 3300005436 | Bacteria | 6234 |
| 14 | Ga0070713_100079360 | 3300005436 | Bacteria | 2796 |
| 15 | Ga0070710_10267835 | 3300005437 | Bacteria | 1104 |
| 16 | Ga0070711_100013439 | 3300005439 | Bacteria | 5143 |
| 17 | Ga0070711_100108696 | 3300005439 | Bacteria | 2032 |
| 18 | Ga0070711_100428047 | 3300005439 | Bacteria | 1080 |
| 19 | Ga0070694_100003040 | 3300005444 | Bacteria | 9991 |
| 20 | Ga0070708_100028741 | 3300005445 | Bacteria | 4786 |
| 21 | Ga0070708_100072609 | 3300005445 | Bacteria | 3100 |
| 22 | Ga0070708_100366184 | 3300005445 | Bacteria | 1358 |
| 23 | Ga0070708_100657034 | 3300005445 | Bacteria | 988 |
| 24 | Ga0070681_10468626 | 3300005458 | Bacteria | 1172 |
| 25 | Ga0070685_10281142 | 3300005466 | Bacteria | 1114 |
| 26 | Ga0070706_100024165 | 3300005467 | Bacteria | 5595 |
| 27 | Ga0070706_100181857 | 3300005467 | Bacteria | 1963 |
| 28 | Ga0070706_100262227 | 3300005467 | Bacteria | 1613 |
| 29 | Ga0070706_100285066 | 3300005467 | Bacteria | 1541 |
| 30 | Ga0070706_100619254 | 3300005467 | Bacteria | 1005 |
| 31 | Ga0070706_100820769 | 3300005467 | Bacteria | 860 |
| 32 | Ga0070707_100021238 | 3300005468 | Bacteria | 6136 |
| 33 | Ga0070707_100283963 | 3300005468 | Bacteria | 1608 |
| 34 | Ga0070707_100293727 | 3300005468 | Bacteria | 1579 |
| 35 | Ga0070707_100294572 | 3300005468 | Bacteria | 1577 |
| 36 | Ga0070707_100641132 | 3300005468 | Bacteria | 1025 |
| 37 | Ga0070698_100005912 | 3300005471 | Bacteria | 13345 |
| 38 | Ga0070698_100006749 | 3300005471 | Bacteria | 12442 |
| 39 | Ga0070698_100068473 | 3300005471 | Bacteria | 3567 |
| 40 | Ga0070698_100546341 | 3300005471 | Bacteria | 1098 |
| 41 | Ga0070698_100643937 | 3300005471 | Bacteria | 1001 |
| 42 | Ga0070698_101786320 | 3300005471 | Bacteria | 568 |
| 43 | Ga0070699_100199571 | 3300005518 | Unclassified | 1778 |
| 44 | Ga0070699_100308918 | 3300005518 | Bacteria | 1419 |
| 45 | Ga0070699_100336950 | 3300005518 | Bacteria | 1357 |
| 46 | Ga0070684_100413903 | 3300005535 | Bacteria | 1244 |
| 47 | Ga0070697_100066869 | 3300005536 | Bacteria | 2939 |
| 48 | Ga0070697_100203927 | 3300005536 | Unclassified | 1681 |
| 49 | Ga0070697_100209670 | 3300005536 | Bacteria | 1658 |
| 50 | Ga0070697_100326832 | 3300005536 | Bacteria | 1321 |
| 51 | Ga0068853_100506545 | 3300005539 | Bacteria | 1140 |
| 52 | Ga0070695_100477820 | 3300005545 | Unclassified | 960 |
| 53 | Ga0070696_100231921 | 3300005546 | Bacteria | 1389 |
| 54 | Ga0070696_100897367 | 3300005546 | Bacteria | 735 |
| 55 | Ga0070693_100002281 | 3300005547 | Bacteria | 8788 |
| 56 | Ga0070665_100010354 | 3300005548 | Bacteria | 9434 |
| 57 | Ga0070665_100540986 | 3300005548 | Bacteria | 1177 |
| 58 | Ga0070704_100058399 | 3300005549 | Bacteria | 2748 |
| 59 | Ga0070704_100310011 | 3300005549 | Bacteria | 1318 |
| 60 | Ga0070704_101177274 | 3300005549 | Bacteria | 698 |
| 61 | Ga0068855_100310575 | 3300005563 | Bacteria | 1744 |
| 62 | Ga0068854_101592260 | 3300005578 | Bacteria | 595 |
| 63 | Ga0068852_101088117 | 3300005616 | Bacteria | 819 |
| 64 | Ga0068859_100103413 | 3300005617 | Bacteria | 2906 |
| 65 | Ga0068864_100241391 | 3300005618 | Bacteria | 1674 |
| 66 | Ga0068858_100084909 | 3300005842 | Bacteria | 2945 |
| 67 | Ga0068858_100377965 | 3300005842 | Unclassified | 1359 |
| 68 | Ga0068860_100004674 | 3300005843 | Bacteria | 13980 |
| 69 | Ga0068860_100381820 | 3300005843 | Bacteria | 1391 |
| 70 | Ga0070717_10161644 | 3300006028 | Bacteria | 1943 |
| 71 | Ga0075363_100013813 | 3300006048 | Bacteria | 3929 |
| 72 | Ga0070715_10049944 | 3300006163 | Unclassified | 1794 |
| 73 | Ga0070715_10071179 | 3300006163 | Bacteria | 1554 |
| 74 | Ga0070716_100008916 | 3300006173 | Bacteria | 4988 |
| 75 | Ga0070716_100112530 | 3300006173 | Bacteria | 1690 |
| 76 | Ga0070716_100223856 | 3300006173 | Unclassified | 1266 |
| 77 | Ga0070716_100721918 | 3300006173 | Unclassified | 763 |
| 78 | Ga0070716_100973415 | 3300006173 | Unclassified | 669 |
| 79 | Ga0070712_100053745 | 3300006175 | Bacteria | 2813 |
| 80 | Ga0070712_100266762 | 3300006175 | Bacteria | 1374 |
| 81 | Ga0070712_100267187 | 3300006175 | Bacteria | 1373 |
| 82 | Ga0070712_100337093 | 3300006175 | Bacteria | 1230 |
| 83 | Ga0070712_100361254 | 3300006175 | Bacteria | 1191 |
| 84 | Ga0097621_100005159 | 3300006237 | Bacteria | 9177 |
| 85 | Ga0097621_100435495 | 3300006237 | Bacteria | 1179 |
| 86 | Ga0068871_100126978 | 3300006358 | Bacteria | 2159 |
| 87 | Ga0068871_101072846 | 3300006358 | Bacteria | 752 |
| 88 | Ga0075428_101332952 | 3300006844 | Unclassified | 754 |
| 89 | Ga0075433_11468636 | 3300006852 | Bacteria | 589 |
| 90 | Ga0075434_100002410 | 3300006871 | Bacteria | 16416 |
| 91 | Ga0068865_101213230 | 3300006881 | Unclassified | 668 |
| 92 | Ga0075436_100003544 | 3300006914 | Bacteria | 10708 |
| 93 | Ga0075436_100042243 | 3300006914 | Bacteria | 3144 |
| 94 | Ga0075436_100100437 | 3300006914 | Bacteria | 2015 |
| 95 | Ga0075436_100102234 | 3300006914 | Bacteria | 1996 |
| 96 | Ga0075436_100276649 | 3300006914 | Bacteria | 1199 |
| 97 | Ga0097620_100103411 | 3300006931 | Bacteria | 2906 |
| 98 | Ga0075435_100196342 | 3300007076 | Bacteria | 1709 |
| 99 | Ga0075435_100258267 | 3300007076 | Bacteria | 1484 |
| 100 | Ga0075435_100497496 | 3300007076 | Bacteria | 1054 |
| 101 | Ga0099794_10006987 | 3300007265 | Unclassified | 4605 |
| 102 | Ga0099794_10009033 | 3300007265 | Bacteria | 4164 |
| 103 | Ga0099794_10037532 | 3300007265 | Bacteria | 2294 |
| 104 | Ga0099794_10038357 | 3300007265 | Bacteria | 2270 |
| 105 | Ga0099794_10070667 | 3300007265 | Bacteria | 1709 |
| 106 | Ga0099794_10075789 | 3300007265 | Bacteria | 1653 |
| 107 | Ga0099794_10076303 | 3300007265 | Bacteria | 1647 |
| 108 | Ga0099794_10076461 | 3300007265 | Bacteria | 1646 |
| 109 | Ga0099794_10090855 | 3300007265 | Bacteria | 1515 |
| 110 | Ga0099794_10113534 | 3300007265 | Bacteria | 1359 |
| 111 | Ga0099794_10128949 | 3300007265 | Bacteria | 1276 |
| 112 | Ga0099794_10148153 | 3300007265 | Bacteria | 1191 |
| 113 | Ga0099794_10209918 | 3300007265 | Bacteria | 999 |
| 114 | Ga0099794_10301711 | 3300007265 | Archaea | 829 |
| 115 | Ga0099795_10006836 | 3300007788 | Bacteria | 3138 |
| 116 | Ga0099795_10562321 | 3300007788 | Bacteria | 539 |
| 117 | Ga0111539_11332000 | 3300009094 | Bacteria | 833 |
| 118 | Ga0105245_10291189 | 3300009098 | Bacteria | 1599 |
| 119 | Ga0105247_10175895 | 3300009101 | Bacteria | 1426 |
| 120 | Ga0105247_10434211 | 3300009101 | Bacteria | 943 |
| 121 | Ga0105241_10380916 | 3300009174 | Bacteria | 1233 |
| 122 | Ga0105242_10127529 | 3300009176 | Bacteria | 2192 |
| 123 | Ga0105248_10055865 | 3300009177 | Bacteria | 4429 |
| 124 | Ga0105248_10131474 | 3300009177 | Bacteria | 2824 |
| 125 | Ga0105248_10458098 | 3300009177 | Bacteria | 1438 |
| 126 | Ga0105248_10841643 | 3300009177 | Unclassified | 1035 |
| 127 | Ga0105237_11416892 | 3300009545 | Bacteria | 701 |
| 128 | Ga0105238_10201344 | 3300009551 | Bacteria | 1966 |
| 129 | Ga0105238_10892404 | 3300009551 | Bacteria | 907 |
| 130 | Ga0105238_11705896 | 3300009551 | Bacteria | 661 |
| 131 | Ga0105238_11857497 | 3300009551 | Bacteria | 635 |
| 132 | Ga0099796_10076594 | 3300010159 | Unclassified | 1218 |
| 133 | Ga0099796_10179390 | 3300010159 | Unclassified | 849 |
| 134 | Ga0105239_10277202 | 3300010375 | Bacteria | 1887 |
| 135 | Ga0157370_10257536 | 3300013104 | Bacteria | 1613 |
| 136 | Ga0157369_10243916 | 3300013105 | Bacteria | 1876 |
| 137 | Ga0157374_11059558 | 3300013296 | Bacteria | 831 |
| 138 | Ga0157378_10000216 | 3300013297 | Bacteria | 55738 |
| 139 | Ga0157378_10000355 | 3300013297 | Bacteria | 45057 |
| 140 | Ga0157378_11160254 | 3300013297 | Unclassified | 811 |
| 141 | Ga0163162_10020314 | 3300013306 | Bacteria | 6524 |
| 142 | Ga0163162_11534571 | 3300013306 | Bacteria | 759 |
| 143 | Ga0163162_12187676 | 3300013306 | Bacteria | 635 |
| 144 | Ga0157372_10448882 | 3300013307 | Bacteria | 1503 |
| 145 | Ga0157375_10159114 | 3300013308 | Bacteria | 2400 |
| 146 | Ga0163163_10136184 | 3300014325 | Bacteria | 2497 |
| 147 | Ga0163163_12580425 | 3300014325 | Bacteria | 566 |
| 148 | Ga0157380_10505135 | 3300014326 | Bacteria | 1175 |
| 149 | Ga0157379_10147487 | 3300014968 | Bacteria | 2122 |
| 150 | Ga0157379_10534757 | 3300014968 | Bacteria | 1089 |
| 151 | Ga0157376_10000065 | 3300014969 | Bacteria | 86390 |
| 152 | Ga0157376_10113300 | 3300014969 | Bacteria | 2391 |
| 153 | Ga0213875_10272603 | 3300021388 | Unclassified | 799 |
| 154 | Ga0207710_10463075 | 3300025900 | Bacteria | 655 |
| 155 | Ga0207685_10092471 | 3300025905 | Unclassified | 1276 |
| 156 | Ga0207685_10274532 | 3300025905 | Bacteria | 825 |
| 157 | Ga0207685_10846353 | 3300025905 | Unclassified | 506 |
| 158 | Ga0207699_10014250 | 3300025906 | Bacteria | 4092 |
| 159 | Ga0207699_10017203 | 3300025906 | Bacteria | 3799 |
| 160 | Ga0207699_10054061 | 3300025906 | Unclassified | 2384 |
| 161 | Ga0207699_10122917 | 3300025906 | Bacteria | 1681 |
| 162 | Ga0207699_10333496 | 3300025906 | Bacteria | 1067 |
| 163 | Ga0207699_10363973 | 3300025906 | Bacteria | 1023 |
| 164 | Ga0207699_10592381 | 3300025906 | Bacteria | 807 |
| 165 | Ga0207699_10873097 | 3300025906 | Bacteria | 663 |
| 166 | Ga0207705_10046285 | 3300025909 | Bacteria | 3126 |
| 167 | Ga0207684_10015454 | 3300025910 | Bacteria | 6567 |
| 168 | Ga0207684_10041274 | 3300025910 | Bacteria | 3913 |
| 169 | Ga0207684_10691447 | 3300025910 | Unclassified | 867 |
| 170 | Ga0207707_10329795 | 3300025912 | Bacteria | 1317 |
| 171 | Ga0207695_10234044 | 3300025913 | Bacteria | 1740 |
| 172 | Ga0207671_10821861 | 3300025914 | Bacteria | 736 |
| 173 | Ga0207693_10091088 | 3300025915 | Bacteria | 2391 |
| 174 | Ga0207693_10114455 | 3300025915 | Unclassified | 2117 |
| 175 | Ga0207693_10283301 | 3300025915 | Bacteria | 1299 |
| 176 | Ga0207693_10290260 | 3300025915 | Bacteria | 1282 |
| 177 | Ga0207693_10650107 | 3300025915 | Bacteria | 819 |
| 178 | Ga0207693_10962438 | 3300025915 | Unclassified | 653 |
| 179 | Ga0207663_10031828 | 3300025916 | Unclassified | 3126 |
| 180 | Ga0207663_10626460 | 3300025916 | Unclassified | 847 |
| 181 | Ga0207660_10195560 | 3300025917 | Bacteria | 1577 |
| 182 | Ga0207657_10781380 | 3300025919 | Bacteria | 739 |
| 183 | Ga0207657_11262396 | 3300025919 | Bacteria | 559 |
| 184 | Ga0207646_10002210 | 3300025922 | Bacteria | 23166 |
| 185 | Ga0207646_10061649 | 3300025922 | Bacteria | 3347 |
| 186 | Ga0207646_10251032 | 3300025922 | Bacteria | 1598 |
| 187 | Ga0207646_10780115 | 3300025922 | Bacteria | 852 |
| 188 | Ga0207659_10360635 | 3300025926 | Bacteria | 1208 |
| 189 | Ga0207687_10057694 | 3300025927 | Bacteria | 2728 |
| 190 | Ga0207700_10071261 | 3300025928 | Bacteria | 2676 |
| 191 | Ga0207700_10118009 | 3300025928 | Bacteria | 2146 |
| 192 | Ga0207700_10149850 | 3300025928 | Bacteria | 1926 |
| 193 | Ga0207700_10264549 | 3300025928 | Bacteria | 1474 |
| 194 | Ga0207664_10764230 | 3300025929 | Unclassified | 869 |
| 195 | Ga0207686_10236801 | 3300025934 | Bacteria | 1326 |
| 196 | Ga0207709_11199348 | 3300025935 | Unclassified | 625 |
| 197 | Ga0207704_10293239 | 3300025938 | Bacteria | 1242 |
| 198 | Ga0207704_10760455 | 3300025938 | Bacteria | 807 |
| 199 | Ga0207665_10000185 | 3300025939 | Bacteria | 41706 |
| 200 | Ga0207665_10025317 | 3300025939 | Bacteria | 3915 |
| 201 | Ga0207665_10028620 | 3300025939 | Bacteria | 3681 |
| 202 | Ga0207665_10032645 | 3300025939 | Bacteria | 3448 |
| 203 | Ga0207665_10299693 | 3300025939 | Bacteria | 1201 |
| 204 | Ga0207665_10671698 | 3300025939 | Unclassified | 813 |
| 205 | Ga0207711_10254284 | 3300025941 | Bacteria | 1614 |
| 206 | Ga0207711_10328195 | 3300025941 | Bacteria | 1415 |
| 207 | Ga0207711_10680417 | 3300025941 | Unclassified | 960 |
| 208 | Ga0207711_10864297 | 3300025941 | Bacteria | 841 |
| 209 | Ga0207667_10407844 | 3300025949 | Bacteria | 1383 |
| 210 | Ga0207712_10524526 | 3300025961 | Unclassified | 1015 |
| 211 | Ga0207658_11077874 | 3300025986 | Bacteria | 734 |
| 212 | Ga0207703_10269660 | 3300026035 | Bacteria | 1541 |
| 213 | Ga0207639_11172387 | 3300026041 | Bacteria | 721 |
| 214 | Ga0207641_10005018 | 3300026088 | Bacteria | 11347 |
| 215 | Ga0207676_10216735 | 3300026095 | Bacteria | 1702 |
| 216 | Ga0207676_11122471 | 3300026095 | Bacteria | 778 |
| 217 | Ga0209179_1008926 | 3300027512 | Bacteria | 1704 |
| 218 | Ga0209588_1003071 | 3300027671 | Unclassified | 4603 |
| 219 | Ga0209588_1021275 | 3300027671 | Bacteria | 2036 |
| 220 | Ga0209588_1071253 | 3300027671 | Bacteria | 1122 |
| 221 | Ga0209588_1072546 | 3300027671 | Unclassified | 1112 |
| 222 | Ga0209588_1103247 | 3300027671 | Unclassified | 917 |
| 223 | Ga0209588_1123156 | 3300027671 | Unclassified | 829 |
| 224 | Ga0209588_1195296 | 3300027671 | Unclassified | 632 |
| 225 | Ga0209588_1209572 | 3300027671 | Bacteria | 605 |
| 226 | Ga0268266_10000785 | 3300028379 | Bacteria | 42401 |
| 227 | Ga0268266_10408482 | 3300028379 | Bacteria | 1285 |
| 228 | Ga0268265_11012407 | 3300028380 | Bacteria | 821 |
| 229 | Ga0268264_10175849 | 3300028381 | Bacteria | 1940 |
| 230 | Ga0268264_10183839 | 3300028381 | Bacteria | 1900 |
| 231 | Ga0268264_10271090 | 3300028381 | Bacteria | 1586 |
| 232 | Ga0265326_10062877 | 3300028558 | Bacteria | 1050 |
| 233 | Ga0265336_10005747 | 3300028666 | Bacteria | 4540 |
| 234 | Ga0265338_10013197 | 3300028800 | Bacteria | 9350 |
| 235 | Ga0265338_10155054 | 3300028800 | Bacteria | 1775 |
| 236 | Ga0265338_10455448 | 3300028800 | Bacteria | 905 |
| 237 | Ga0265324_10031067 | 3300029957 | Bacteria | 1872 |
| 238 | Ga0265332_10035891 | 3300031238 | Bacteria | 2153 |
| 239 | Ga0265320_10002658 | 3300031240 | Bacteria | 12368 |
| 240 | Ga0265325_10024249 | 3300031241 | Bacteria | 3302 |
| 241 | Ga0265325_10046806 | 3300031241 | Bacteria | 2242 |
| 242 | Ga0265329_10052909 | 3300031242 | Archaea | 1291 |
| 243 | Ga0265331_10002345 | 3300031250 | Bacteria | 12866 |
| 244 | Ga0265316_10049355 | 3300031344 | Bacteria | 3316 |
| 245 | Ga0265316_10207791 | 3300031344 | Bacteria | 1449 |
| 246 | Ga0265316_10334925 | 3300031344 | Bacteria | 1097 |
| 247 | Ga0265314_10016361 | 3300031711 | Bacteria | 5858 |
| 248 | Ga0265314_10069570 | 3300031711 | Bacteria | 2362 |
| 249 | Ga0265342_10194828 | 3300031712 | Bacteria | 1104 |
| 250 | Ga0265342_10469419 | 3300031712 | Archaea | 644 |
| 251 | Ga0316580_10110075 | 3300032139 | Bacteria | 843 |
| 252 | Ga0316212_1001970 | 3300033547 | Unclassified | 2886 |
| 253 | Ga0373926_0002697 | 3300035083 | Bacteria | 5659 |
| 254 | Ga0373929_0118726 | 3300035085 | Bacteria | 683 |
| 255 | Ga0373936_0255246 | 3300035113 | Bacteria | 784 |
| 256 | Ga0373946_0029261 | 3300035171 | Unclassified | 2191 |
| 257 | Ga0373931_0064405 | 3300035691 | Bacteria | 1984 |
| 258 | Ga0373931_0197376 | 3300035691 | Bacteria | 1200 |
| 259 | Ga0373931_0211562 | 3300035691 | Bacteria | 1163 |
| 260 | Ga0373935_0295162 | 3300035692 | Bacteria | 1144 |
| 261 | Ga0373927_0000078 | 3300035695 | Bacteria | 71963 |
| 262 | Ga0373933_0798664 | 3300035724 | Unclassified | 621 |
| 263 | Ga0373947_0041314 | 3300035725 | Unclassified | 2749 |
| 264 | Ga0373947_1084526 | 3300035725 | Unclassified | 546 |
| 265 | Ga0373937_1068886 | 3300036401 | Bacteria | 756 |
| 266 | Ga0373937_1214170 | 3300036401 | Unclassified | 702 |
| 267 | Ga0373925_0000127 | 3300037068 | Bacteria | 82229 |
| 268 | Ga0373925_0227305 | 3300037068 | Bacteria | 1491 |
| 269 | Ga0395905_0837095 | 3300037471 | Bacteria | 823 |
| 270 | Ga0436364_1546721 | 3300037853 | Unclassified | 799 |
| 271 | Ga0451800_1135808 | 3300041459 | Unclassified | 549 |
| 272 | Ga0466959_0560576 | 3300045049 | Unclassified | 770 |
| 273 | Ga0451576_1678026 | 3300045051 | Bacteria | 658 |
| 274 | Ga0466958_0277382 | 3300045836 | Bacteria | 1074 |
| 275 | Ga0495592_0060038 | 3300046454 | Bacteria | 2798 |
| 276 | Ga0495603_0049325 | 3300046455 | Bacteria | 2506 |
| 277 | Ga0495638_0013177 | 3300046460 | Bacteria | 5642 |
| 278 | Ga0495641_0055299 | 3300046461 | Bacteria | 1802 |
| 279 | Ga0495651_0017095 | 3300046462 | Bacteria | 5621 |
| 280 | Ga0495653_0250209 | 3300046463 | Bacteria | 1176 |
| 281 | Ga0495580_0003307 | 3300046472 | Bacteria | 13780 |
| 282 | Ga0495580_0445215 | 3300046472 | Bacteria | 869 |
| 283 | Ga0495580_0686475 | 3300046472 | Unclassified | 671 |
| 284 | Ga0495582_0047833 | 3300046473 | Bacteria | 2356 |
| 285 | Ga0495664_0104203 | 3300046477 | Unclassified | 1710 |
| 286 | Ga0495584_0277962 | 3300046491 | Bacteria | 851 |
| 287 | Ga0495608_0155994 | 3300046511 | Bacteria | 1453 |
| 288 | Ga0495618_0024609 | 3300046514 | Bacteria | 3730 |
| 289 | Ga0495628_0286015 | 3300046516 | Bacteria | 1223 |
| 290 | Ga0495630_0009426 | 3300046517 | Bacteria | 7019 |
| 291 | Ga0495652_1048642 | 3300046529 | Unclassified | 531 |
| 292 | Ga0495640_0191526 | 3300046533 | Unclassified | 1300 |
| 293 | Ga0495645_0009870 | 3300046543 | Bacteria | 6682 |
| 294 | Ga0495645_0115037 | 3300046543 | Bacteria | 1900 |
| 295 | Ga0495667_0052487 | 3300046559 | Bacteria | 2686 |
| 296 | Ga0495635_0301376 | 3300046663 | Bacteria | 1075 |
| 297 | Ga0495599_0264857 | 3300046678 | Unclassified | 1044 |
| 298 | Ga0495623_0011585 | 3300046679 | Bacteria | 5711 |
| 299 | Ga0495623_0191222 | 3300046679 | Bacteria | 1182 |
| 300 | Ga0495658_0452535 | 3300046683 | Bacteria | 820 |
| 301 | Ga0495600_0096711 | 3300046809 | Bacteria | 1925 |
| 302 | Ga0495604_0119561 | 3300047317 | Bacteria | 1909 |
| 303 | Ga0495604_0129986 | 3300047317 | Bacteria | 1811 |
| 304 | Ga0495604_0219289 | 3300047317 | Bacteria | 1310 |
| 305 | Ga0495604_0673569 | 3300047317 | Bacteria | 658 |
| 306 | Ga0495674_0016271 | 3300047319 | Bacteria | 6939 |
| 307 | Ga0495674_0109266 | 3300047319 | Bacteria | 2346 |
| 308 | Ga0495674_0846415 | 3300047319 | Bacteria | 709 |
| 309 | Ga0495676_0097324 | 3300047321 | Bacteria | 2186 |
| 310 | Ga0495680_0166911 | 3300047322 | Bacteria | 1595 |
| 311 | Ga0495675_0088817 | 3300047444 | Bacteria | 1941 |
| 312 | Ga0495675_0646336 | 3300047444 | Bacteria | 596 |
| 313 | Ga0495684_0016081 | 3300047471 | Bacteria | 5760 |
| 314 | Ga0495684_0022536 | 3300047471 | Bacteria | 4844 |
| 315 | Ga0495602_0004066 | 3300048088 | Bacteria | 15231 |
| 316 | Ga0495614_0156465 | 3300048089 | Bacteria | 1018 |
| 317 | Ga0496101_0107597 | 3300048904 | Bacteria | 2095 |
| 318 | Ga0496101_1476037 | 3300048904 | Unclassified | 530 |
| 319 | Ga0496102_0005886 | 3300048905 | Bacteria | 10437 |
| 320 | Ga0496103_0287101 | 3300048906 | Bacteria | 1058 |
| 321 | Ga0496104_0894879 | 3300048907 | Bacteria | 793 |
| 322 | Ga0496108_0458260 | 3300048911 | Unclassified | 1114 |
| 323 | Ga0496109_1282145 | 3300048912 | Bacteria | 669 |
| 324 | Ga0496114_0006808 | 3300048917 | Bacteria | 9005 |
| 325 | Ga0496114_0395542 | 3300048917 | Bacteria | 1224 |
| 326 | Ga0496115_0008926 | 3300048918 | Bacteria | 7435 |
| 327 | Ga0496115_0030200 | 3300048918 | Bacteria | 4262 |
| 328 | Ga0496115_0850096 | 3300048918 | Bacteria | 707 |
| 329 | nmdc:mga03n38_8027_c1 | 3300050490 | Bacteria | 3766 |
| 330 | nmdc:mga0n895_2071561_c1 | 3300050512 | Bacteria | 526 |
| 331 | nmdc:mga0n895_9170_c1 | 3300050512 | Bacteria | 8640 |
| 332 | nmdc:mga0rr50_239380_c1 | 3300050513 | Bacteria | 1504 |
| 333 | nmdc:mga0rr50_314335_c1 | 3300050513 | Bacteria | 1312 |
| 334 | nmdc:mga0rr50_453794_c1 | 3300050513 | Bacteria | 1087 |
| 335 | nmdc:mga08x19_146638_c1 | 3300050514 | Bacteria | 1596 |
| 336 | nmdc:mga08x19_21309_c1 | 3300050514 | Bacteria | 3999 |
| 337 | nmdc:mga08x19_250_c1 | 3300050514 | Bacteria | 40812 |
| 338 | nmdc:mga08x19_41521_c1 | 3300050514 | Bacteria | 2930 |
| 339 | nmdc:mga08x19_47958_c1 | 3300050514 | Bacteria | 2735 |
| 340 | nmdc:mga08x19_566017_c1 | 3300050514 | Bacteria | 805 |
| 341 | nmdc:mga0a205_37172_c1 | 3300050515 | Bacteria | 4681 |
| 342 | nmdc:mga0a205_422357_c1 | 3300050515 | Bacteria | 1195 |
| 343 | Ga0495601_0004463 | 3300053077 | Bacteria | 8085 |
| 344 | Ga0495619_0087573 | 3300053085 | Unclassified | 2106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100091847 | Ga0070675_1000918473 | 124 |
| 2 | 3300025926 | Ga0207659_10360635 | Ga0207659_103606352 | 124 |
| 3 | 3300045049 | Ga0466959_0560576 | Ga0466959_0560576_61_435 | 124 |
| 4 | 3300045836 | Ga0466958_0277382 | Ga0466958_0277382_57_431 | 124 |
| 5 | 3300032139 | Ga0316580_10110075 | Ga0316580_101100751 | 125 |
| 6 | 3300041459 | Ga0451800_1135808 | Ga0451800_1135808_101_478 | 125 |
| 7 | 3300006844 | Ga0075428_101332952 | Ga0075428_1013329522 | 126 |
| 8 | 3300005434 | Ga0070709_10027330 | Ga0070709_100273302 | 127 |
| 9 | 3300005434 | Ga0070709_10048382 | Ga0070709_100483822 | 127 |
| 10 | 3300005435 | Ga0070714_101223190 | Ga0070714_1012231901 | 127 |
| 11 | 3300005436 | Ga0070713_100079360 | Ga0070713_1000793603 | 127 |
| 12 | 3300005444 | Ga0070694_100003040 | Ga0070694_10000304010 | 127 |
| 13 | 3300005458 | Ga0070681_10468626 | Ga0070681_104686261 | 127 |
| 14 | 3300005467 | Ga0070706_100024165 | Ga0070706_1000241652 | 127 |
| 15 | 3300005471 | Ga0070698_100068473 | Ga0070698_1000684733 | 127 |
| 16 | 3300005471 | Ga0070698_100643937 | Ga0070698_1006439372 | 127 |
| 17 | 3300005535 | Ga0070684_100413903 | Ga0070684_1004139032 | 127 |
| 18 | 3300005536 | Ga0070697_100066869 | Ga0070697_1000668692 | 127 |
| 19 | 3300005536 | Ga0070697_100203927 | Ga0070697_1002039272 | 127 |
| 20 | 3300005546 | Ga0070696_100231921 | Ga0070696_1002319212 | 127 |
| 21 | 3300005578 | Ga0068854_101592260 | Ga0068854_1015922602 | 127 |
| 22 | 3300006048 | Ga0075363_100013813 | Ga0075363_1000138132 | 127 |
| 23 | 3300006173 | Ga0070716_100973415 | Ga0070716_1009734152 | 127 |
| 24 | 3300006175 | Ga0070712_100267187 | Ga0070712_1002671872 | 127 |
| 25 | 3300006237 | Ga0097621_100435495 | Ga0097621_1004354952 | 127 |
| 26 | 3300007265 | Ga0099794_10090855 | Ga0099794_100908552 | 127 |
| 27 | 3300009094 | Ga0111539_11332000 | Ga0111539_113320002 | 127 |
| 28 | 3300009177 | Ga0105248_10841643 | Ga0105248_108416432 | 127 |
| 29 | 3300009551 | Ga0105238_10892404 | Ga0105238_108924043 | 127 |
| 30 | 3300013105 | Ga0157369_10243916 | Ga0157369_102439162 | 127 |
| 31 | 3300013297 | Ga0157378_11160254 | Ga0157378_111602542 | 127 |
| 32 | 3300013307 | Ga0157372_10448882 | Ga0157372_104488822 | 127 |
| 33 | 3300014326 | Ga0157380_10505135 | Ga0157380_105051352 | 127 |
| 34 | 3300014968 | Ga0157379_10534757 | Ga0157379_105347572 | 127 |
| 35 | 3300014969 | Ga0157376_10113300 | Ga0157376_101133002 | 127 |
| 36 | 3300021388 | Ga0213875_10272603 | Ga0213875_102726032 | 127 |
| 37 | 3300025905 | Ga0207685_10846353 | Ga0207685_108463532 | 127 |
| 38 | 3300025906 | Ga0207699_10014250 | Ga0207699_100142502 | 127 |
| 39 | 3300025906 | Ga0207699_10017203 | Ga0207699_100172032 | 127 |
| 40 | 3300025906 | Ga0207699_10333496 | Ga0207699_103334962 | 127 |
| 41 | 3300025906 | Ga0207699_10592381 | Ga0207699_105923812 | 127 |
| 42 | 3300025910 | Ga0207684_10015454 | Ga0207684_100154542 | 127 |
| 43 | 3300025912 | Ga0207707_10329795 | Ga0207707_103297952 | 127 |
| 44 | 3300025915 | Ga0207693_10114455 | Ga0207693_101144552 | 127 |
| 45 | 3300025916 | Ga0207663_10626460 | Ga0207663_106264602 | 127 |
| 46 | 3300025917 | Ga0207660_10195560 | Ga0207660_101955602 | 127 |
| 47 | 3300025928 | Ga0207700_10149850 | Ga0207700_101498501 | 127 |
| 48 | 3300025929 | Ga0207664_10764230 | Ga0207664_107642301 | 127 |
| 49 | 3300025935 | Ga0207709_11199348 | Ga0207709_111993481 | 127 |
| 50 | 3300025941 | Ga0207711_10254284 | Ga0207711_102542842 | 127 |
| 51 | 3300027671 | Ga0209588_1123156 | Ga0209588_11231562 | 127 |
| 52 | 3300028380 | Ga0268265_11012407 | Ga0268265_110124071 | 127 |
| 53 | 3300028558 | Ga0265326_10062877 | Ga0265326_100628772 | 127 |
| 54 | 3300028666 | Ga0265336_10005747 | Ga0265336_100057473 | 127 |
| 55 | 3300028800 | Ga0265338_10013197 | Ga0265338_100131972 | 127 |
| 56 | 3300028800 | Ga0265338_10455448 | Ga0265338_104554482 | 127 |
| 57 | 3300029957 | Ga0265324_10031067 | Ga0265324_100310672 | 127 |
| 58 | 3300031238 | Ga0265332_10035891 | Ga0265332_100358914 | 127 |
| 59 | 3300031240 | Ga0265320_10002658 | Ga0265320_100026586 | 127 |
| 60 | 3300031241 | Ga0265325_10024249 | Ga0265325_100242492 | 127 |
| 61 | 3300031241 | Ga0265325_10046806 | Ga0265325_100468062 | 127 |
| 62 | 3300031242 | Ga0265329_10052909 | Ga0265329_100529092 | 127 |
| 63 | 3300031250 | Ga0265331_10002345 | Ga0265331_100023454 | 127 |
| 64 | 3300031344 | Ga0265316_10049355 | Ga0265316_100493552 | 127 |
| 65 | 3300031344 | Ga0265316_10207791 | Ga0265316_102077912 | 127 |
| 66 | 3300031344 | Ga0265316_10334925 | Ga0265316_103349252 | 127 |
| 67 | 3300031711 | Ga0265314_10016361 | Ga0265314_100163612 | 127 |
| 68 | 3300031711 | Ga0265314_10069570 | Ga0265314_100695703 | 127 |
| 69 | 3300031712 | Ga0265342_10194828 | Ga0265342_101948282 | 127 |
| 70 | 3300031712 | Ga0265342_10469419 | Ga0265342_104694191 | 127 |
| 71 | 3300036401 | Ga0373937_1068886 | Ga0373937_1068886_266_649 | 127 |
| 72 | 3300037471 | Ga0395905_0837095 | Ga0395905_0837095_329_712 | 127 |
| 73 | 3300037853 | Ga0436364_1546721 | Ga0436364_1546721_287_673 | 127 |
| 74 | 3300046460 | Ga0495638_0013177 | Ga0495638_0013177_2136_2522 | 127 |
| 75 | 3300046462 | Ga0495651_0017095 | Ga0495651_0017095_5183_5566 | 127 |
| 76 | 3300046472 | Ga0495580_0445215 | Ga0495580_0445215_121_504 | 127 |
| 77 | 3300046472 | Ga0495580_0686475 | Ga0495580_0686475_195_578 | 127 |
| 78 | 3300046511 | Ga0495608_0155994 | Ga0495608_0155994_928_1311 | 127 |
| 79 | 3300046516 | Ga0495628_0286015 | Ga0495628_0286015_614_997 | 127 |
| 80 | 3300046529 | Ga0495652_1048642 | Ga0495652_1048642_114_497 | 127 |
| 81 | 3300046543 | Ga0495645_0115037 | Ga0495645_0115037_214_597 | 127 |
| 82 | 3300046559 | Ga0495667_0052487 | Ga0495667_0052487_1165_1548 | 127 |
| 83 | 3300046663 | Ga0495635_0301376 | Ga0495635_0301376_390_773 | 127 |
| 84 | 3300046679 | Ga0495623_0011585 | Ga0495623_0011585_933_1316 | 127 |
| 85 | 3300046679 | Ga0495623_0191222 | Ga0495623_0191222_469_852 | 127 |
| 86 | 3300046809 | Ga0495600_0096711 | Ga0495600_0096711_1429_1812 | 127 |
| 87 | 3300047317 | Ga0495604_0119561 | Ga0495604_0119561_216_599 | 127 |
| 88 | 3300047317 | Ga0495604_0129986 | Ga0495604_0129986_1294_1677 | 127 |
| 89 | 3300047317 | Ga0495604_0673569 | Ga0495604_0673569_63_446 | 127 |
| 90 | 3300047319 | Ga0495674_0016271 | Ga0495674_0016271_2430_2813 | 127 |
| 91 | 3300047319 | Ga0495674_0846415 | Ga0495674_0846415_315_698 | 127 |
| 92 | 3300047322 | Ga0495680_0166911 | Ga0495680_0166911_122_505 | 127 |
| 93 | 3300047444 | Ga0495675_0088817 | Ga0495675_0088817_1459_1842 | 127 |
| 94 | 3300047471 | Ga0495684_0016081 | Ga0495684_0016081_1164_1547 | 127 |
| 95 | 3300047471 | Ga0495684_0022536 | Ga0495684_0022536_1169_1552 | 127 |
| 96 | 3300048088 | Ga0495602_0004066 | Ga0495602_0004066_6688_7071 | 127 |
| 97 | 3300048904 | Ga0496101_1476037 | Ga0496101_1476037_77_460 | 127 |
| 98 | 3300048912 | Ga0496109_1282145 | Ga0496109_1282145_113_496 | 127 |
| 99 | 3300050490 | nmdc:mga03n38_8027_c1 | nmdc:mga03n38_8027_c1_1295_1681 | 127 |
| 100 | 3300050512 | nmdc:mga0n895_2071561_c1 | nmdc:mga0n895_2071561_c1_35_421 | 127 |
| 101 | 3300005327 | Ga0070658_10052049 | Ga0070658_100520493 | 128 |
| 102 | 3300005334 | Ga0068869_100607024 | Ga0068869_1006070241 | 128 |
| 103 | 3300005336 | Ga0070680_100188438 | Ga0070680_1001884382 | 128 |
| 104 | 3300005337 | Ga0070682_100395104 | Ga0070682_1003951042 | 128 |
| 105 | 3300005355 | Ga0070671_101811202 | Ga0070671_1018112022 | 128 |
| 106 | 3300005367 | Ga0070667_100475349 | Ga0070667_1004753492 | 128 |
| 107 | 3300005434 | Ga0070709_10105289 | Ga0070709_101052891 | 128 |
| 108 | 3300005434 | Ga0070709_10322108 | Ga0070709_103221082 | 128 |
| 109 | 3300005436 | Ga0070713_100012481 | Ga0070713_1000124816 | 128 |
| 110 | 3300005437 | Ga0070710_10267835 | Ga0070710_102678352 | 128 |
| 111 | 3300005439 | Ga0070711_100013439 | Ga0070711_1000134393 | 128 |
| 112 | 3300005439 | Ga0070711_100108696 | Ga0070711_1001086962 | 128 |
| 113 | 3300005439 | Ga0070711_100428047 | Ga0070711_1004280472 | 128 |
| 114 | 3300005445 | Ga0070708_100028741 | Ga0070708_1000287413 | 128 |
| 115 | 3300005445 | Ga0070708_100072609 | Ga0070708_1000726093 | 128 |
| 116 | 3300005445 | Ga0070708_100366184 | Ga0070708_1003661842 | 128 |
| 117 | 3300005445 | Ga0070708_100657034 | Ga0070708_1006570342 | 128 |
| 118 | 3300005466 | Ga0070685_10281142 | Ga0070685_102811422 | 128 |
| 119 | 3300005467 | Ga0070706_100181857 | Ga0070706_1001818572 | 128 |
| 120 | 3300005467 | Ga0070706_100262227 | Ga0070706_1002622272 | 128 |
| 121 | 3300005467 | Ga0070706_100285066 | Ga0070706_1002850661 | 128 |
| 122 | 3300005467 | Ga0070706_100619254 | Ga0070706_1006192541 | 128 |
| 123 | 3300005467 | Ga0070706_100820769 | Ga0070706_1008207691 | 128 |
| 124 | 3300005468 | Ga0070707_100021238 | Ga0070707_1000212383 | 128 |
| 125 | 3300005468 | Ga0070707_100283963 | Ga0070707_1002839632 | 128 |
| 126 | 3300005468 | Ga0070707_100293727 | Ga0070707_1002937271 | 128 |
| 127 | 3300005468 | Ga0070707_100294572 | Ga0070707_1002945722 | 128 |
| 128 | 3300005468 | Ga0070707_100641132 | Ga0070707_1006411322 | 128 |
| 129 | 3300005471 | Ga0070698_100005912 | Ga0070698_1000059128 | 128 |
| 130 | 3300005471 | Ga0070698_100006749 | Ga0070698_1000067495 | 128 |
| 131 | 3300005471 | Ga0070698_100546341 | Ga0070698_1005463412 | 128 |
| 132 | 3300005471 | Ga0070698_101786320 | Ga0070698_1017863201 | 128 |
| 133 | 3300005518 | Ga0070699_100199571 | Ga0070699_1001995712 | 128 |
| 134 | 3300005518 | Ga0070699_100308918 | Ga0070699_1003089182 | 128 |
| 135 | 3300005518 | Ga0070699_100336950 | Ga0070699_1003369502 | 128 |
| 136 | 3300005536 | Ga0070697_100209670 | Ga0070697_1002096702 | 128 |
| 137 | 3300005536 | Ga0070697_100326832 | Ga0070697_1003268321 | 128 |
| 138 | 3300005539 | Ga0068853_100506545 | Ga0068853_1005065452 | 128 |
| 139 | 3300005545 | Ga0070695_100477820 | Ga0070695_1004778202 | 128 |
| 140 | 3300005546 | Ga0070696_100897367 | Ga0070696_1008973672 | 128 |
| 141 | 3300005547 | Ga0070693_100002281 | Ga0070693_1000022816 | 128 |
| 142 | 3300005548 | Ga0070665_100010354 | Ga0070665_1000103544 | 128 |
| 143 | 3300005548 | Ga0070665_100540986 | Ga0070665_1005409862 | 128 |
| 144 | 3300005549 | Ga0070704_100058399 | Ga0070704_1000583992 | 128 |
| 145 | 3300005549 | Ga0070704_100310011 | Ga0070704_1003100112 | 128 |
| 146 | 3300005549 | Ga0070704_101177274 | Ga0070704_1011772742 | 128 |
| 147 | 3300005563 | Ga0068855_100310575 | Ga0068855_1003105752 | 128 |
| 148 | 3300005616 | Ga0068852_101088117 | Ga0068852_1010881172 | 128 |
| 149 | 3300005617 | Ga0068859_100103413 | Ga0068859_1001034132 | 128 |
| 150 | 3300005618 | Ga0068864_100241391 | Ga0068864_1002413912 | 128 |
| 151 | 3300005842 | Ga0068858_100084909 | Ga0068858_1000849093 | 128 |
| 152 | 3300005842 | Ga0068858_100377965 | Ga0068858_1003779652 | 128 |
| 153 | 3300005843 | Ga0068860_100004674 | Ga0068860_1000046742 | 128 |
| 154 | 3300005843 | Ga0068860_100381820 | Ga0068860_1003818202 | 128 |
| 155 | 3300006028 | Ga0070717_10161644 | Ga0070717_101616442 | 128 |
| 156 | 3300006163 | Ga0070715_10049944 | Ga0070715_100499441 | 128 |
| 157 | 3300006163 | Ga0070715_10071179 | Ga0070715_100711792 | 128 |
| 158 | 3300006173 | Ga0070716_100008916 | Ga0070716_1000089162 | 128 |
| 159 | 3300006173 | Ga0070716_100112530 | Ga0070716_1001125302 | 128 |
| 160 | 3300006173 | Ga0070716_100223856 | Ga0070716_1002238562 | 128 |
| 161 | 3300006173 | Ga0070716_100721918 | Ga0070716_1007219182 | 128 |
| 162 | 3300006175 | Ga0070712_100053745 | Ga0070712_1000537452 | 128 |
| 163 | 3300006175 | Ga0070712_100266762 | Ga0070712_1002667622 | 128 |
| 164 | 3300006175 | Ga0070712_100337093 | Ga0070712_1003370932 | 128 |
| 165 | 3300006175 | Ga0070712_100361254 | Ga0070712_1003612542 | 128 |
| 166 | 3300006237 | Ga0097621_100005159 | Ga0097621_1000051598 | 128 |
| 167 | 3300006358 | Ga0068871_100126978 | Ga0068871_1001269782 | 128 |
| 168 | 3300006358 | Ga0068871_101072846 | Ga0068871_1010728461 | 128 |
| 169 | 3300006852 | Ga0075433_11468636 | Ga0075433_114686361 | 128 |
| 170 | 3300006871 | Ga0075434_100002410 | Ga0075434_1000024104 | 128 |
| 171 | 3300006881 | Ga0068865_101213230 | Ga0068865_1012132302 | 128 |
| 172 | 3300006914 | Ga0075436_100003544 | Ga0075436_1000035444 | 128 |
| 173 | 3300006914 | Ga0075436_100042243 | Ga0075436_1000422433 | 128 |
| 174 | 3300006914 | Ga0075436_100100437 | Ga0075436_1001004372 | 128 |
| 175 | 3300006914 | Ga0075436_100102234 | Ga0075436_1001022342 | 128 |
| 176 | 3300006914 | Ga0075436_100276649 | Ga0075436_1002766491 | 128 |
| 177 | 3300006931 | Ga0097620_100103411 | Ga0097620_1001034114 | 128 |
| 178 | 3300007076 | Ga0075435_100196342 | Ga0075435_1001963422 | 128 |
| 179 | 3300007076 | Ga0075435_100258267 | Ga0075435_1002582672 | 128 |
| 180 | 3300007076 | Ga0075435_100497496 | Ga0075435_1004974962 | 128 |
| 181 | 3300007265 | Ga0099794_10006987 | Ga0099794_100069874 | 128 |
| 182 | 3300007265 | Ga0099794_10009033 | Ga0099794_100090332 | 128 |
| 183 | 3300007265 | Ga0099794_10037532 | Ga0099794_100375323 | 128 |
| 184 | 3300007265 | Ga0099794_10038357 | Ga0099794_100383573 | 128 |
| 185 | 3300007265 | Ga0099794_10070667 | Ga0099794_100706672 | 128 |
| 186 | 3300007265 | Ga0099794_10075789 | Ga0099794_100757892 | 128 |
| 187 | 3300007265 | Ga0099794_10076303 | Ga0099794_100763032 | 128 |
| 188 | 3300007265 | Ga0099794_10076461 | Ga0099794_100764611 | 128 |
| 189 | 3300007265 | Ga0099794_10113534 | Ga0099794_101135341 | 128 |
| 190 | 3300007265 | Ga0099794_10128949 | Ga0099794_101289492 | 128 |
| 191 | 3300007265 | Ga0099794_10148153 | Ga0099794_101481532 | 128 |
| 192 | 3300007265 | Ga0099794_10209918 | Ga0099794_102099182 | 128 |
| 193 | 3300007265 | Ga0099794_10301711 | Ga0099794_103017112 | 128 |
| 194 | 3300007788 | Ga0099795_10006836 | Ga0099795_100068362 | 128 |
| 195 | 3300007788 | Ga0099795_10562321 | Ga0099795_105623211 | 128 |
| 196 | 3300009098 | Ga0105245_10291189 | Ga0105245_102911892 | 128 |
| 197 | 3300009101 | Ga0105247_10175895 | Ga0105247_101758952 | 128 |
| 198 | 3300009101 | Ga0105247_10434211 | Ga0105247_104342112 | 128 |
| 199 | 3300009174 | Ga0105241_10380916 | Ga0105241_103809162 | 128 |
| 200 | 3300009176 | Ga0105242_10127529 | Ga0105242_101275292 | 128 |
| 201 | 3300009177 | Ga0105248_10055865 | Ga0105248_100558652 | 128 |
| 202 | 3300009177 | Ga0105248_10131474 | Ga0105248_101314741 | 128 |
| 203 | 3300009177 | Ga0105248_10458098 | Ga0105248_104580982 | 128 |
| 204 | 3300009545 | Ga0105237_11416892 | Ga0105237_114168922 | 128 |
| 205 | 3300009551 | Ga0105238_10201344 | Ga0105238_102013441 | 128 |
| 206 | 3300009551 | Ga0105238_11705896 | Ga0105238_117058961 | 128 |
| 207 | 3300009551 | Ga0105238_11857497 | Ga0105238_118574972 | 128 |
| 208 | 3300010159 | Ga0099796_10076594 | Ga0099796_100765941 | 128 |
| 209 | 3300010159 | Ga0099796_10179390 | Ga0099796_101793902 | 128 |
| 210 | 3300010375 | Ga0105239_10277202 | Ga0105239_102772022 | 128 |
| 211 | 3300013104 | Ga0157370_10257536 | Ga0157370_102575362 | 128 |
| 212 | 3300013296 | Ga0157374_11059558 | Ga0157374_110595582 | 128 |
| 213 | 3300013297 | Ga0157378_10000216 | Ga0157378_1000021613 | 128 |
| 214 | 3300013297 | Ga0157378_10000355 | Ga0157378_1000035524 | 128 |
| 215 | 3300013306 | Ga0163162_10020314 | Ga0163162_100203146 | 128 |
| 216 | 3300013306 | Ga0163162_11534571 | Ga0163162_115345712 | 128 |
| 217 | 3300013306 | Ga0163162_12187676 | Ga0163162_121876762 | 128 |
| 218 | 3300013308 | Ga0157375_10159114 | Ga0157375_101591142 | 128 |
| 219 | 3300014325 | Ga0163163_10136184 | Ga0163163_101361843 | 128 |
| 220 | 3300014325 | Ga0163163_12580425 | Ga0163163_125804251 | 128 |
| 221 | 3300014968 | Ga0157379_10147487 | Ga0157379_101474872 | 128 |
| 222 | 3300014969 | Ga0157376_10000065 | Ga0157376_1000006570 | 128 |
| 223 | 3300025900 | Ga0207710_10463075 | Ga0207710_104630752 | 128 |
| 224 | 3300025905 | Ga0207685_10092471 | Ga0207685_100924712 | 128 |
| 225 | 3300025905 | Ga0207685_10274532 | Ga0207685_102745322 | 128 |
| 226 | 3300025906 | Ga0207699_10054061 | Ga0207699_100540613 | 128 |
| 227 | 3300025906 | Ga0207699_10122917 | Ga0207699_101229172 | 128 |
| 228 | 3300025906 | Ga0207699_10363973 | Ga0207699_103639732 | 128 |
| 229 | 3300025906 | Ga0207699_10873097 | Ga0207699_108730971 | 128 |
| 230 | 3300025909 | Ga0207705_10046285 | Ga0207705_100462852 | 128 |
| 231 | 3300025910 | Ga0207684_10041274 | Ga0207684_100412742 | 128 |
| 232 | 3300025910 | Ga0207684_10691447 | Ga0207684_106914471 | 128 |
| 233 | 3300025913 | Ga0207695_10234044 | Ga0207695_102340442 | 128 |
| 234 | 3300025914 | Ga0207671_10821861 | Ga0207671_108218612 | 128 |
| 235 | 3300025915 | Ga0207693_10091088 | Ga0207693_100910882 | 128 |
| 236 | 3300025915 | Ga0207693_10283301 | Ga0207693_102833012 | 128 |
| 237 | 3300025915 | Ga0207693_10290260 | Ga0207693_102902602 | 128 |
| 238 | 3300025915 | Ga0207693_10650107 | Ga0207693_106501071 | 128 |
| 239 | 3300025915 | Ga0207693_10962438 | Ga0207693_109624381 | 128 |
| 240 | 3300025916 | Ga0207663_10031828 | Ga0207663_100318283 | 128 |
| 241 | 3300025919 | Ga0207657_10781380 | Ga0207657_107813802 | 128 |
| 242 | 3300025919 | Ga0207657_11262396 | Ga0207657_112623961 | 128 |
| 243 | 3300025922 | Ga0207646_10002210 | Ga0207646_1000221013 | 128 |
| 244 | 3300025922 | Ga0207646_10061649 | Ga0207646_100616493 | 128 |
| 245 | 3300025922 | Ga0207646_10251032 | Ga0207646_102510322 | 128 |
| 246 | 3300025922 | Ga0207646_10780115 | Ga0207646_107801151 | 128 |
| 247 | 3300025927 | Ga0207687_10057694 | Ga0207687_100576942 | 128 |
| 248 | 3300025928 | Ga0207700_10071261 | Ga0207700_100712612 | 128 |
| 249 | 3300025928 | Ga0207700_10118009 | Ga0207700_101180092 | 128 |
| 250 | 3300025928 | Ga0207700_10264549 | Ga0207700_102645492 | 128 |
| 251 | 3300025934 | Ga0207686_10236801 | Ga0207686_102368012 | 128 |
| 252 | 3300025938 | Ga0207704_10293239 | Ga0207704_102932392 | 128 |
| 253 | 3300025938 | Ga0207704_10760455 | Ga0207704_107604552 | 128 |
| 254 | 3300025939 | Ga0207665_10000185 | Ga0207665_1000018522 | 128 |
| 255 | 3300025939 | Ga0207665_10025317 | Ga0207665_100253173 | 128 |
| 256 | 3300025939 | Ga0207665_10028620 | Ga0207665_100286202 | 128 |
| 257 | 3300025939 | Ga0207665_10032645 | Ga0207665_100326453 | 128 |
| 258 | 3300025939 | Ga0207665_10299693 | Ga0207665_102996932 | 128 |
| 259 | 3300025939 | Ga0207665_10671698 | Ga0207665_106716982 | 128 |
| 260 | 3300025941 | Ga0207711_10328195 | Ga0207711_103281952 | 128 |
| 261 | 3300025941 | Ga0207711_10680417 | Ga0207711_106804172 | 128 |
| 262 | 3300025941 | Ga0207711_10864297 | Ga0207711_108642972 | 128 |
| 263 | 3300025949 | Ga0207667_10407844 | Ga0207667_104078442 | 128 |
| 264 | 3300025961 | Ga0207712_10524526 | Ga0207712_105245262 | 128 |
| 265 | 3300025986 | Ga0207658_11077874 | Ga0207658_110778742 | 128 |
| 266 | 3300026035 | Ga0207703_10269660 | Ga0207703_102696602 | 128 |
| 267 | 3300026041 | Ga0207639_11172387 | Ga0207639_111723872 | 128 |
| 268 | 3300026088 | Ga0207641_10005018 | Ga0207641_100050187 | 128 |
| 269 | 3300026095 | Ga0207676_10216735 | Ga0207676_102167351 | 128 |
| 270 | 3300026095 | Ga0207676_11122471 | Ga0207676_111224712 | 128 |
| 271 | 3300027512 | Ga0209179_1008926 | Ga0209179_10089262 | 128 |
| 272 | 3300027671 | Ga0209588_1003071 | Ga0209588_10030714 | 128 |
| 273 | 3300027671 | Ga0209588_1021275 | Ga0209588_10212752 | 128 |
| 274 | 3300027671 | Ga0209588_1071253 | Ga0209588_10712532 | 128 |
| 275 | 3300027671 | Ga0209588_1072546 | Ga0209588_10725462 | 128 |
| 276 | 3300027671 | Ga0209588_1103247 | Ga0209588_11032471 | 128 |
| 277 | 3300027671 | Ga0209588_1195296 | Ga0209588_11952961 | 128 |
| 278 | 3300027671 | Ga0209588_1209572 | Ga0209588_12095722 | 128 |
| 279 | 3300028379 | Ga0268266_10000785 | Ga0268266_100007855 | 128 |
| 280 | 3300028379 | Ga0268266_10408482 | Ga0268266_104084822 | 128 |
| 281 | 3300028381 | Ga0268264_10175849 | Ga0268264_101758492 | 128 |
| 282 | 3300028381 | Ga0268264_10183839 | Ga0268264_101838392 | 128 |
| 283 | 3300028381 | Ga0268264_10271090 | Ga0268264_102710901 | 128 |
| 284 | 3300028800 | Ga0265338_10155054 | Ga0265338_101550542 | 128 |
| 285 | 3300033547 | Ga0316212_1001970 | Ga0316212_10019702 | 128 |
| 286 | 3300035083 | Ga0373926_0002697 | Ga0373926_0002697_1910_2311 | 128 |
| 287 | 3300035085 | Ga0373929_0118726 | Ga0373929_0118726_140_541 | 128 |
| 288 | 3300035113 | Ga0373936_0255246 | Ga0373936_0255246_168_569 | 128 |
| 289 | 3300035171 | Ga0373946_0029261 | Ga0373946_0029261_1440_1841 | 128 |
| 290 | 3300035691 | Ga0373931_0064405 | Ga0373931_0064405_585_986 | 128 |
| 291 | 3300035691 | Ga0373931_0197376 | Ga0373931_0197376_454_855 | 128 |
| 292 | 3300035691 | Ga0373931_0211562 | Ga0373931_0211562_197_598 | 128 |
| 293 | 3300035692 | Ga0373935_0295162 | Ga0373935_0295162_428_829 | 128 |
| 294 | 3300035695 | Ga0373927_0000078 | Ga0373927_0000078_4414_4815 | 128 |
| 295 | 3300035724 | Ga0373933_0798664 | Ga0373933_0798664_210_611 | 128 |
| 296 | 3300035725 | Ga0373947_0041314 | Ga0373947_0041314_1923_2324 | 128 |
| 297 | 3300035725 | Ga0373947_1084526 | Ga0373947_1084526_15_416 | 128 |
| 298 | 3300036401 | Ga0373937_1214170 | Ga0373937_1214170_208_609 | 128 |
| 299 | 3300037068 | Ga0373925_0000127 | Ga0373925_0000127_12371_12772 | 128 |
| 300 | 3300037068 | Ga0373925_0227305 | Ga0373925_0227305_548_949 | 128 |
| 301 | 3300045051 | Ga0451576_1678026 | Ga0451576_1678026_202_603 | 128 |
| 302 | 3300046454 | Ga0495592_0060038 | Ga0495592_0060038_2332_2733 | 128 |
| 303 | 3300046455 | Ga0495603_0049325 | Ga0495603_0049325_368_769 | 128 |
| 304 | 3300046461 | Ga0495641_0055299 | Ga0495641_0055299_92_493 | 128 |
| 305 | 3300046463 | Ga0495653_0250209 | Ga0495653_0250209_746_1147 | 128 |
| 306 | 3300046472 | Ga0495580_0003307 | Ga0495580_0003307_2006_2407 | 128 |
| 307 | 3300046473 | Ga0495582_0047833 | Ga0495582_0047833_1685_2086 | 128 |
| 308 | 3300046477 | Ga0495664_0104203 | Ga0495664_0104203_537_944 | 128 |
| 309 | 3300046491 | Ga0495584_0277962 | Ga0495584_0277962_236_637 | 128 |
| 310 | 3300046514 | Ga0495618_0024609 | Ga0495618_0024609_2818_3219 | 128 |
| 311 | 3300046517 | Ga0495630_0009426 | Ga0495630_0009426_5692_6093 | 128 |
| 312 | 3300046533 | Ga0495640_0191526 | Ga0495640_0191526_325_732 | 128 |
| 313 | 3300046543 | Ga0495645_0009870 | Ga0495645_0009870_1881_2288 | 128 |
| 314 | 3300046678 | Ga0495599_0264857 | Ga0495599_0264857_451_858 | 128 |
| 315 | 3300046683 | Ga0495658_0452535 | Ga0495658_0452535_66_467 | 128 |
| 316 | 3300047317 | Ga0495604_0219289 | Ga0495604_0219289_761_1162 | 128 |
| 317 | 3300047319 | Ga0495674_0109266 | Ga0495674_0109266_532_939 | 128 |
| 318 | 3300047321 | Ga0495676_0097324 | Ga0495676_0097324_154_555 | 128 |
| 319 | 3300047444 | Ga0495675_0646336 | Ga0495675_0646336_79_480 | 128 |
| 320 | 3300048089 | Ga0495614_0156465 | Ga0495614_0156465_284_685 | 128 |
| 321 | 3300048904 | Ga0496101_0107597 | Ga0496101_0107597_977_1378 | 128 |
| 322 | 3300048905 | Ga0496102_0005886 | Ga0496102_0005886_3923_4327 | 128 |
| 323 | 3300048906 | Ga0496103_0287101 | Ga0496103_0287101_373_777 | 128 |
| 324 | 3300048907 | Ga0496104_0894879 | Ga0496104_0894879_150_551 | 128 |
| 325 | 3300048911 | Ga0496108_0458260 | Ga0496108_0458260_139_543 | 128 |
| 326 | 3300048917 | Ga0496114_0006808 | Ga0496114_0006808_4661_5062 | 128 |
| 327 | 3300048917 | Ga0496114_0395542 | Ga0496114_0395542_354_755 | 128 |
| 328 | 3300048918 | Ga0496115_0008926 | Ga0496115_0008926_3477_3878 | 128 |
| 329 | 3300048918 | Ga0496115_0030200 | Ga0496115_0030200_2936_3337 | 128 |
| 330 | 3300048918 | Ga0496115_0850096 | Ga0496115_0850096_31_432 | 128 |
| 331 | 3300050512 | nmdc:mga0n895_9170_c1 | nmdc:mga0n895_9170_c1_7859_8260 | 128 |
| 332 | 3300050513 | nmdc:mga0rr50_239380_c1 | nmdc:mga0rr50_239380_c1_102_503 | 128 |
| 333 | 3300050513 | nmdc:mga0rr50_314335_c1 | nmdc:mga0rr50_314335_c1_790_1191 | 128 |
| 334 | 3300050513 | nmdc:mga0rr50_453794_c1 | nmdc:mga0rr50_453794_c1_530_934 | 128 |
| 335 | 3300050514 | nmdc:mga08x19_146638_c1 | nmdc:mga08x19_146638_c1_629_1030 | 128 |
| 336 | 3300050514 | nmdc:mga08x19_21309_c1 | nmdc:mga08x19_21309_c1_3045_3446 | 128 |
| 337 | 3300050514 | nmdc:mga08x19_250_c1 | nmdc:mga08x19_250_c1_6776_7177 | 128 |
| 338 | 3300050514 | nmdc:mga08x19_41521_c1 | nmdc:mga08x19_41521_c1_2340_2741 | 128 |
| 339 | 3300050514 | nmdc:mga08x19_47958_c1 | nmdc:mga08x19_47958_c1_1299_1700 | 128 |
| 340 | 3300050514 | nmdc:mga08x19_566017_c1 | nmdc:mga08x19_566017_c1_306_707 | 128 |
| 341 | 3300050515 | nmdc:mga0a205_37172_c1 | nmdc:mga0a205_37172_c1_2893_3294 | 128 |
| 342 | 3300050515 | nmdc:mga0a205_422357_c1 | nmdc:mga0a205_422357_c1_753_1154 | 128 |
| 343 | 3300053077 | Ga0495601_0004463 | Ga0495601_0004463_7182_7589 | 128 |
| 344 | 3300053085 | Ga0495619_0087573 | Ga0495619_0087573_532_933 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9928 | 1 | 127 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9915 | 7 | 126 |
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9898 | 7 | 123 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9775 | 1 | 127 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.966 | 2 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.994 | 7 | 123 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9913 | 7 | 126 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9776 | 7 | 124 | 2.40.50.100 |
| af_Q54JU3_2_142_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9708 | 6 | 124 | 2.40.50.100 |
| af_Q4E4F5_6_138_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9695 | 5 | 124 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A067GPV7-F1-model_v4 | Glycine cleavage system H protein | 0.999 | 4 | 127 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A4D8YYX3-F1-model_v4 | deleted | 0.9988 | 5 | 127 |
|
| AF-A0A314YSG0-F1-model_v4 | Pentatricopeptide repeat-containing protein | 0.9986 | 4 | 127 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A2I0KP74-F1-model_v4 | Glycine cleavage system H protein | 0.9984 | 4 | 127 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A2K3NJQ1-F1-model_v4 | Glycine cleavage system H protein | 0.9984 | 6 | 127 |
GO:0005739
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar