F415924

General Info

Members Datasets Scaffolds Average Seq Length
344 184 344 131

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10148153|Ga0099794_101481532
Length 149
Sequence VGCRAKAIVKFTGESEMAYPKQYRYTKEHEWVDAKGDLATIGITDYAQHELGDVVFVELPKPGAKLETGKTFGTVESVKAVSEIYAPASGEVLEANTELHNTPEELNTDPHGAAWLIKARLTNASELNGLMDAAAYEAYIADKGKEASA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 3.78
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10052049 3300005327 Bacteria 3320
2 Ga0068869_100607024 3300005334 Bacteria 925
3 Ga0070680_100188438 3300005336 Bacteria 1738
4 Ga0070682_100395104 3300005337 Bacteria 1044
5 Ga0070675_100091847 3300005354 Bacteria 2544
6 Ga0070671_101811202 3300005355 Bacteria 542
7 Ga0070667_100475349 3300005367 Unclassified 1144
8 Ga0070709_10027330 3300005434 Bacteria 3391
9 Ga0070709_10048382 3300005434 Bacteria 2653
10 Ga0070709_10105289 3300005434 Unclassified 1886
11 Ga0070709_10322108 3300005434 Bacteria 1135
12 Ga0070714_101223190 3300005435 Unclassified 733
13 Ga0070713_100012481 3300005436 Bacteria 6234
14 Ga0070713_100079360 3300005436 Bacteria 2796
15 Ga0070710_10267835 3300005437 Bacteria 1104
16 Ga0070711_100013439 3300005439 Bacteria 5143
17 Ga0070711_100108696 3300005439 Bacteria 2032
18 Ga0070711_100428047 3300005439 Bacteria 1080
19 Ga0070694_100003040 3300005444 Bacteria 9991
20 Ga0070708_100028741 3300005445 Bacteria 4786
21 Ga0070708_100072609 3300005445 Bacteria 3100
22 Ga0070708_100366184 3300005445 Bacteria 1358
23 Ga0070708_100657034 3300005445 Bacteria 988
24 Ga0070681_10468626 3300005458 Bacteria 1172
25 Ga0070685_10281142 3300005466 Bacteria 1114
26 Ga0070706_100024165 3300005467 Bacteria 5595
27 Ga0070706_100181857 3300005467 Bacteria 1963
28 Ga0070706_100262227 3300005467 Bacteria 1613
29 Ga0070706_100285066 3300005467 Bacteria 1541
30 Ga0070706_100619254 3300005467 Bacteria 1005
31 Ga0070706_100820769 3300005467 Bacteria 860
32 Ga0070707_100021238 3300005468 Bacteria 6136
33 Ga0070707_100283963 3300005468 Bacteria 1608
34 Ga0070707_100293727 3300005468 Bacteria 1579
35 Ga0070707_100294572 3300005468 Bacteria 1577
36 Ga0070707_100641132 3300005468 Bacteria 1025
37 Ga0070698_100005912 3300005471 Bacteria 13345
38 Ga0070698_100006749 3300005471 Bacteria 12442
39 Ga0070698_100068473 3300005471 Bacteria 3567
40 Ga0070698_100546341 3300005471 Bacteria 1098
41 Ga0070698_100643937 3300005471 Bacteria 1001
42 Ga0070698_101786320 3300005471 Bacteria 568
43 Ga0070699_100199571 3300005518 Unclassified 1778
44 Ga0070699_100308918 3300005518 Bacteria 1419
45 Ga0070699_100336950 3300005518 Bacteria 1357
46 Ga0070684_100413903 3300005535 Bacteria 1244
47 Ga0070697_100066869 3300005536 Bacteria 2939
48 Ga0070697_100203927 3300005536 Unclassified 1681
49 Ga0070697_100209670 3300005536 Bacteria 1658
50 Ga0070697_100326832 3300005536 Bacteria 1321
51 Ga0068853_100506545 3300005539 Bacteria 1140
52 Ga0070695_100477820 3300005545 Unclassified 960
53 Ga0070696_100231921 3300005546 Bacteria 1389
54 Ga0070696_100897367 3300005546 Bacteria 735
55 Ga0070693_100002281 3300005547 Bacteria 8788
56 Ga0070665_100010354 3300005548 Bacteria 9434
57 Ga0070665_100540986 3300005548 Bacteria 1177
58 Ga0070704_100058399 3300005549 Bacteria 2748
59 Ga0070704_100310011 3300005549 Bacteria 1318
60 Ga0070704_101177274 3300005549 Bacteria 698
61 Ga0068855_100310575 3300005563 Bacteria 1744
62 Ga0068854_101592260 3300005578 Bacteria 595
63 Ga0068852_101088117 3300005616 Bacteria 819
64 Ga0068859_100103413 3300005617 Bacteria 2906
65 Ga0068864_100241391 3300005618 Bacteria 1674
66 Ga0068858_100084909 3300005842 Bacteria 2945
67 Ga0068858_100377965 3300005842 Unclassified 1359
68 Ga0068860_100004674 3300005843 Bacteria 13980
69 Ga0068860_100381820 3300005843 Bacteria 1391
70 Ga0070717_10161644 3300006028 Bacteria 1943
71 Ga0075363_100013813 3300006048 Bacteria 3929
72 Ga0070715_10049944 3300006163 Unclassified 1794
73 Ga0070715_10071179 3300006163 Bacteria 1554
74 Ga0070716_100008916 3300006173 Bacteria 4988
75 Ga0070716_100112530 3300006173 Bacteria 1690
76 Ga0070716_100223856 3300006173 Unclassified 1266
77 Ga0070716_100721918 3300006173 Unclassified 763
78 Ga0070716_100973415 3300006173 Unclassified 669
79 Ga0070712_100053745 3300006175 Bacteria 2813
80 Ga0070712_100266762 3300006175 Bacteria 1374
81 Ga0070712_100267187 3300006175 Bacteria 1373
82 Ga0070712_100337093 3300006175 Bacteria 1230
83 Ga0070712_100361254 3300006175 Bacteria 1191
84 Ga0097621_100005159 3300006237 Bacteria 9177
85 Ga0097621_100435495 3300006237 Bacteria 1179
86 Ga0068871_100126978 3300006358 Bacteria 2159
87 Ga0068871_101072846 3300006358 Bacteria 752
88 Ga0075428_101332952 3300006844 Unclassified 754
89 Ga0075433_11468636 3300006852 Bacteria 589
90 Ga0075434_100002410 3300006871 Bacteria 16416
91 Ga0068865_101213230 3300006881 Unclassified 668
92 Ga0075436_100003544 3300006914 Bacteria 10708
93 Ga0075436_100042243 3300006914 Bacteria 3144
94 Ga0075436_100100437 3300006914 Bacteria 2015
95 Ga0075436_100102234 3300006914 Bacteria 1996
96 Ga0075436_100276649 3300006914 Bacteria 1199
97 Ga0097620_100103411 3300006931 Bacteria 2906
98 Ga0075435_100196342 3300007076 Bacteria 1709
99 Ga0075435_100258267 3300007076 Bacteria 1484
100 Ga0075435_100497496 3300007076 Bacteria 1054
101 Ga0099794_10006987 3300007265 Unclassified 4605
102 Ga0099794_10009033 3300007265 Bacteria 4164
103 Ga0099794_10037532 3300007265 Bacteria 2294
104 Ga0099794_10038357 3300007265 Bacteria 2270
105 Ga0099794_10070667 3300007265 Bacteria 1709
106 Ga0099794_10075789 3300007265 Bacteria 1653
107 Ga0099794_10076303 3300007265 Bacteria 1647
108 Ga0099794_10076461 3300007265 Bacteria 1646
109 Ga0099794_10090855 3300007265 Bacteria 1515
110 Ga0099794_10113534 3300007265 Bacteria 1359
111 Ga0099794_10128949 3300007265 Bacteria 1276
112 Ga0099794_10148153 3300007265 Bacteria 1191
113 Ga0099794_10209918 3300007265 Bacteria 999
114 Ga0099794_10301711 3300007265 Archaea 829
115 Ga0099795_10006836 3300007788 Bacteria 3138
116 Ga0099795_10562321 3300007788 Bacteria 539
117 Ga0111539_11332000 3300009094 Bacteria 833
118 Ga0105245_10291189 3300009098 Bacteria 1599
119 Ga0105247_10175895 3300009101 Bacteria 1426
120 Ga0105247_10434211 3300009101 Bacteria 943
121 Ga0105241_10380916 3300009174 Bacteria 1233
122 Ga0105242_10127529 3300009176 Bacteria 2192
123 Ga0105248_10055865 3300009177 Bacteria 4429
124 Ga0105248_10131474 3300009177 Bacteria 2824
125 Ga0105248_10458098 3300009177 Bacteria 1438
126 Ga0105248_10841643 3300009177 Unclassified 1035
127 Ga0105237_11416892 3300009545 Bacteria 701
128 Ga0105238_10201344 3300009551 Bacteria 1966
129 Ga0105238_10892404 3300009551 Bacteria 907
130 Ga0105238_11705896 3300009551 Bacteria 661
131 Ga0105238_11857497 3300009551 Bacteria 635
132 Ga0099796_10076594 3300010159 Unclassified 1218
133 Ga0099796_10179390 3300010159 Unclassified 849
134 Ga0105239_10277202 3300010375 Bacteria 1887
135 Ga0157370_10257536 3300013104 Bacteria 1613
136 Ga0157369_10243916 3300013105 Bacteria 1876
137 Ga0157374_11059558 3300013296 Bacteria 831
138 Ga0157378_10000216 3300013297 Bacteria 55738
139 Ga0157378_10000355 3300013297 Bacteria 45057
140 Ga0157378_11160254 3300013297 Unclassified 811
141 Ga0163162_10020314 3300013306 Bacteria 6524
142 Ga0163162_11534571 3300013306 Bacteria 759
143 Ga0163162_12187676 3300013306 Bacteria 635
144 Ga0157372_10448882 3300013307 Bacteria 1503
145 Ga0157375_10159114 3300013308 Bacteria 2400
146 Ga0163163_10136184 3300014325 Bacteria 2497
147 Ga0163163_12580425 3300014325 Bacteria 566
148 Ga0157380_10505135 3300014326 Bacteria 1175
149 Ga0157379_10147487 3300014968 Bacteria 2122
150 Ga0157379_10534757 3300014968 Bacteria 1089
151 Ga0157376_10000065 3300014969 Bacteria 86390
152 Ga0157376_10113300 3300014969 Bacteria 2391
153 Ga0213875_10272603 3300021388 Unclassified 799
154 Ga0207710_10463075 3300025900 Bacteria 655
155 Ga0207685_10092471 3300025905 Unclassified 1276
156 Ga0207685_10274532 3300025905 Bacteria 825
157 Ga0207685_10846353 3300025905 Unclassified 506
158 Ga0207699_10014250 3300025906 Bacteria 4092
159 Ga0207699_10017203 3300025906 Bacteria 3799
160 Ga0207699_10054061 3300025906 Unclassified 2384
161 Ga0207699_10122917 3300025906 Bacteria 1681
162 Ga0207699_10333496 3300025906 Bacteria 1067
163 Ga0207699_10363973 3300025906 Bacteria 1023
164 Ga0207699_10592381 3300025906 Bacteria 807
165 Ga0207699_10873097 3300025906 Bacteria 663
166 Ga0207705_10046285 3300025909 Bacteria 3126
167 Ga0207684_10015454 3300025910 Bacteria 6567
168 Ga0207684_10041274 3300025910 Bacteria 3913
169 Ga0207684_10691447 3300025910 Unclassified 867
170 Ga0207707_10329795 3300025912 Bacteria 1317
171 Ga0207695_10234044 3300025913 Bacteria 1740
172 Ga0207671_10821861 3300025914 Bacteria 736
173 Ga0207693_10091088 3300025915 Bacteria 2391
174 Ga0207693_10114455 3300025915 Unclassified 2117
175 Ga0207693_10283301 3300025915 Bacteria 1299
176 Ga0207693_10290260 3300025915 Bacteria 1282
177 Ga0207693_10650107 3300025915 Bacteria 819
178 Ga0207693_10962438 3300025915 Unclassified 653
179 Ga0207663_10031828 3300025916 Unclassified 3126
180 Ga0207663_10626460 3300025916 Unclassified 847
181 Ga0207660_10195560 3300025917 Bacteria 1577
182 Ga0207657_10781380 3300025919 Bacteria 739
183 Ga0207657_11262396 3300025919 Bacteria 559
184 Ga0207646_10002210 3300025922 Bacteria 23166
185 Ga0207646_10061649 3300025922 Bacteria 3347
186 Ga0207646_10251032 3300025922 Bacteria 1598
187 Ga0207646_10780115 3300025922 Bacteria 852
188 Ga0207659_10360635 3300025926 Bacteria 1208
189 Ga0207687_10057694 3300025927 Bacteria 2728
190 Ga0207700_10071261 3300025928 Bacteria 2676
191 Ga0207700_10118009 3300025928 Bacteria 2146
192 Ga0207700_10149850 3300025928 Bacteria 1926
193 Ga0207700_10264549 3300025928 Bacteria 1474
194 Ga0207664_10764230 3300025929 Unclassified 869
195 Ga0207686_10236801 3300025934 Bacteria 1326
196 Ga0207709_11199348 3300025935 Unclassified 625
197 Ga0207704_10293239 3300025938 Bacteria 1242
198 Ga0207704_10760455 3300025938 Bacteria 807
199 Ga0207665_10000185 3300025939 Bacteria 41706
200 Ga0207665_10025317 3300025939 Bacteria 3915
201 Ga0207665_10028620 3300025939 Bacteria 3681
202 Ga0207665_10032645 3300025939 Bacteria 3448
203 Ga0207665_10299693 3300025939 Bacteria 1201
204 Ga0207665_10671698 3300025939 Unclassified 813
205 Ga0207711_10254284 3300025941 Bacteria 1614
206 Ga0207711_10328195 3300025941 Bacteria 1415
207 Ga0207711_10680417 3300025941 Unclassified 960
208 Ga0207711_10864297 3300025941 Bacteria 841
209 Ga0207667_10407844 3300025949 Bacteria 1383
210 Ga0207712_10524526 3300025961 Unclassified 1015
211 Ga0207658_11077874 3300025986 Bacteria 734
212 Ga0207703_10269660 3300026035 Bacteria 1541
213 Ga0207639_11172387 3300026041 Bacteria 721
214 Ga0207641_10005018 3300026088 Bacteria 11347
215 Ga0207676_10216735 3300026095 Bacteria 1702
216 Ga0207676_11122471 3300026095 Bacteria 778
217 Ga0209179_1008926 3300027512 Bacteria 1704
218 Ga0209588_1003071 3300027671 Unclassified 4603
219 Ga0209588_1021275 3300027671 Bacteria 2036
220 Ga0209588_1071253 3300027671 Bacteria 1122
221 Ga0209588_1072546 3300027671 Unclassified 1112
222 Ga0209588_1103247 3300027671 Unclassified 917
223 Ga0209588_1123156 3300027671 Unclassified 829
224 Ga0209588_1195296 3300027671 Unclassified 632
225 Ga0209588_1209572 3300027671 Bacteria 605
226 Ga0268266_10000785 3300028379 Bacteria 42401
227 Ga0268266_10408482 3300028379 Bacteria 1285
228 Ga0268265_11012407 3300028380 Bacteria 821
229 Ga0268264_10175849 3300028381 Bacteria 1940
230 Ga0268264_10183839 3300028381 Bacteria 1900
231 Ga0268264_10271090 3300028381 Bacteria 1586
232 Ga0265326_10062877 3300028558 Bacteria 1050
233 Ga0265336_10005747 3300028666 Bacteria 4540
234 Ga0265338_10013197 3300028800 Bacteria 9350
235 Ga0265338_10155054 3300028800 Bacteria 1775
236 Ga0265338_10455448 3300028800 Bacteria 905
237 Ga0265324_10031067 3300029957 Bacteria 1872
238 Ga0265332_10035891 3300031238 Bacteria 2153
239 Ga0265320_10002658 3300031240 Bacteria 12368
240 Ga0265325_10024249 3300031241 Bacteria 3302
241 Ga0265325_10046806 3300031241 Bacteria 2242
242 Ga0265329_10052909 3300031242 Archaea 1291
243 Ga0265331_10002345 3300031250 Bacteria 12866
244 Ga0265316_10049355 3300031344 Bacteria 3316
245 Ga0265316_10207791 3300031344 Bacteria 1449
246 Ga0265316_10334925 3300031344 Bacteria 1097
247 Ga0265314_10016361 3300031711 Bacteria 5858
248 Ga0265314_10069570 3300031711 Bacteria 2362
249 Ga0265342_10194828 3300031712 Bacteria 1104
250 Ga0265342_10469419 3300031712 Archaea 644
251 Ga0316580_10110075 3300032139 Bacteria 843
252 Ga0316212_1001970 3300033547 Unclassified 2886
253 Ga0373926_0002697 3300035083 Bacteria 5659
254 Ga0373929_0118726 3300035085 Bacteria 683
255 Ga0373936_0255246 3300035113 Bacteria 784
256 Ga0373946_0029261 3300035171 Unclassified 2191
257 Ga0373931_0064405 3300035691 Bacteria 1984
258 Ga0373931_0197376 3300035691 Bacteria 1200
259 Ga0373931_0211562 3300035691 Bacteria 1163
260 Ga0373935_0295162 3300035692 Bacteria 1144
261 Ga0373927_0000078 3300035695 Bacteria 71963
262 Ga0373933_0798664 3300035724 Unclassified 621
263 Ga0373947_0041314 3300035725 Unclassified 2749
264 Ga0373947_1084526 3300035725 Unclassified 546
265 Ga0373937_1068886 3300036401 Bacteria 756
266 Ga0373937_1214170 3300036401 Unclassified 702
267 Ga0373925_0000127 3300037068 Bacteria 82229
268 Ga0373925_0227305 3300037068 Bacteria 1491
269 Ga0395905_0837095 3300037471 Bacteria 823
270 Ga0436364_1546721 3300037853 Unclassified 799
271 Ga0451800_1135808 3300041459 Unclassified 549
272 Ga0466959_0560576 3300045049 Unclassified 770
273 Ga0451576_1678026 3300045051 Bacteria 658
274 Ga0466958_0277382 3300045836 Bacteria 1074
275 Ga0495592_0060038 3300046454 Bacteria 2798
276 Ga0495603_0049325 3300046455 Bacteria 2506
277 Ga0495638_0013177 3300046460 Bacteria 5642
278 Ga0495641_0055299 3300046461 Bacteria 1802
279 Ga0495651_0017095 3300046462 Bacteria 5621
280 Ga0495653_0250209 3300046463 Bacteria 1176
281 Ga0495580_0003307 3300046472 Bacteria 13780
282 Ga0495580_0445215 3300046472 Bacteria 869
283 Ga0495580_0686475 3300046472 Unclassified 671
284 Ga0495582_0047833 3300046473 Bacteria 2356
285 Ga0495664_0104203 3300046477 Unclassified 1710
286 Ga0495584_0277962 3300046491 Bacteria 851
287 Ga0495608_0155994 3300046511 Bacteria 1453
288 Ga0495618_0024609 3300046514 Bacteria 3730
289 Ga0495628_0286015 3300046516 Bacteria 1223
290 Ga0495630_0009426 3300046517 Bacteria 7019
291 Ga0495652_1048642 3300046529 Unclassified 531
292 Ga0495640_0191526 3300046533 Unclassified 1300
293 Ga0495645_0009870 3300046543 Bacteria 6682
294 Ga0495645_0115037 3300046543 Bacteria 1900
295 Ga0495667_0052487 3300046559 Bacteria 2686
296 Ga0495635_0301376 3300046663 Bacteria 1075
297 Ga0495599_0264857 3300046678 Unclassified 1044
298 Ga0495623_0011585 3300046679 Bacteria 5711
299 Ga0495623_0191222 3300046679 Bacteria 1182
300 Ga0495658_0452535 3300046683 Bacteria 820
301 Ga0495600_0096711 3300046809 Bacteria 1925
302 Ga0495604_0119561 3300047317 Bacteria 1909
303 Ga0495604_0129986 3300047317 Bacteria 1811
304 Ga0495604_0219289 3300047317 Bacteria 1310
305 Ga0495604_0673569 3300047317 Bacteria 658
306 Ga0495674_0016271 3300047319 Bacteria 6939
307 Ga0495674_0109266 3300047319 Bacteria 2346
308 Ga0495674_0846415 3300047319 Bacteria 709
309 Ga0495676_0097324 3300047321 Bacteria 2186
310 Ga0495680_0166911 3300047322 Bacteria 1595
311 Ga0495675_0088817 3300047444 Bacteria 1941
312 Ga0495675_0646336 3300047444 Bacteria 596
313 Ga0495684_0016081 3300047471 Bacteria 5760
314 Ga0495684_0022536 3300047471 Bacteria 4844
315 Ga0495602_0004066 3300048088 Bacteria 15231
316 Ga0495614_0156465 3300048089 Bacteria 1018
317 Ga0496101_0107597 3300048904 Bacteria 2095
318 Ga0496101_1476037 3300048904 Unclassified 530
319 Ga0496102_0005886 3300048905 Bacteria 10437
320 Ga0496103_0287101 3300048906 Bacteria 1058
321 Ga0496104_0894879 3300048907 Bacteria 793
322 Ga0496108_0458260 3300048911 Unclassified 1114
323 Ga0496109_1282145 3300048912 Bacteria 669
324 Ga0496114_0006808 3300048917 Bacteria 9005
325 Ga0496114_0395542 3300048917 Bacteria 1224
326 Ga0496115_0008926 3300048918 Bacteria 7435
327 Ga0496115_0030200 3300048918 Bacteria 4262
328 Ga0496115_0850096 3300048918 Bacteria 707
329 nmdc:mga03n38_8027_c1 3300050490 Bacteria 3766
330 nmdc:mga0n895_2071561_c1 3300050512 Bacteria 526
331 nmdc:mga0n895_9170_c1 3300050512 Bacteria 8640
332 nmdc:mga0rr50_239380_c1 3300050513 Bacteria 1504
333 nmdc:mga0rr50_314335_c1 3300050513 Bacteria 1312
334 nmdc:mga0rr50_453794_c1 3300050513 Bacteria 1087
335 nmdc:mga08x19_146638_c1 3300050514 Bacteria 1596
336 nmdc:mga08x19_21309_c1 3300050514 Bacteria 3999
337 nmdc:mga08x19_250_c1 3300050514 Bacteria 40812
338 nmdc:mga08x19_41521_c1 3300050514 Bacteria 2930
339 nmdc:mga08x19_47958_c1 3300050514 Bacteria 2735
340 nmdc:mga08x19_566017_c1 3300050514 Bacteria 805
341 nmdc:mga0a205_37172_c1 3300050515 Bacteria 4681
342 nmdc:mga0a205_422357_c1 3300050515 Bacteria 1195
343 Ga0495601_0004463 3300053077 Bacteria 8085
344 Ga0495619_0087573 3300053085 Unclassified 2106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100091847 Ga0070675_1000918473 124
2 3300025926 Ga0207659_10360635 Ga0207659_103606352 124
3 3300045049 Ga0466959_0560576 Ga0466959_0560576_61_435 124
4 3300045836 Ga0466958_0277382 Ga0466958_0277382_57_431 124
5 3300032139 Ga0316580_10110075 Ga0316580_101100751 125
6 3300041459 Ga0451800_1135808 Ga0451800_1135808_101_478 125
7 3300006844 Ga0075428_101332952 Ga0075428_1013329522 126
8 3300005434 Ga0070709_10027330 Ga0070709_100273302 127
9 3300005434 Ga0070709_10048382 Ga0070709_100483822 127
10 3300005435 Ga0070714_101223190 Ga0070714_1012231901 127
11 3300005436 Ga0070713_100079360 Ga0070713_1000793603 127
12 3300005444 Ga0070694_100003040 Ga0070694_10000304010 127
13 3300005458 Ga0070681_10468626 Ga0070681_104686261 127
14 3300005467 Ga0070706_100024165 Ga0070706_1000241652 127
15 3300005471 Ga0070698_100068473 Ga0070698_1000684733 127
16 3300005471 Ga0070698_100643937 Ga0070698_1006439372 127
17 3300005535 Ga0070684_100413903 Ga0070684_1004139032 127
18 3300005536 Ga0070697_100066869 Ga0070697_1000668692 127
19 3300005536 Ga0070697_100203927 Ga0070697_1002039272 127
20 3300005546 Ga0070696_100231921 Ga0070696_1002319212 127
21 3300005578 Ga0068854_101592260 Ga0068854_1015922602 127
22 3300006048 Ga0075363_100013813 Ga0075363_1000138132 127
23 3300006173 Ga0070716_100973415 Ga0070716_1009734152 127
24 3300006175 Ga0070712_100267187 Ga0070712_1002671872 127
25 3300006237 Ga0097621_100435495 Ga0097621_1004354952 127
26 3300007265 Ga0099794_10090855 Ga0099794_100908552 127
27 3300009094 Ga0111539_11332000 Ga0111539_113320002 127
28 3300009177 Ga0105248_10841643 Ga0105248_108416432 127
29 3300009551 Ga0105238_10892404 Ga0105238_108924043 127
30 3300013105 Ga0157369_10243916 Ga0157369_102439162 127
31 3300013297 Ga0157378_11160254 Ga0157378_111602542 127
32 3300013307 Ga0157372_10448882 Ga0157372_104488822 127
33 3300014326 Ga0157380_10505135 Ga0157380_105051352 127
34 3300014968 Ga0157379_10534757 Ga0157379_105347572 127
35 3300014969 Ga0157376_10113300 Ga0157376_101133002 127
36 3300021388 Ga0213875_10272603 Ga0213875_102726032 127
37 3300025905 Ga0207685_10846353 Ga0207685_108463532 127
38 3300025906 Ga0207699_10014250 Ga0207699_100142502 127
39 3300025906 Ga0207699_10017203 Ga0207699_100172032 127
40 3300025906 Ga0207699_10333496 Ga0207699_103334962 127
41 3300025906 Ga0207699_10592381 Ga0207699_105923812 127
42 3300025910 Ga0207684_10015454 Ga0207684_100154542 127
43 3300025912 Ga0207707_10329795 Ga0207707_103297952 127
44 3300025915 Ga0207693_10114455 Ga0207693_101144552 127
45 3300025916 Ga0207663_10626460 Ga0207663_106264602 127
46 3300025917 Ga0207660_10195560 Ga0207660_101955602 127
47 3300025928 Ga0207700_10149850 Ga0207700_101498501 127
48 3300025929 Ga0207664_10764230 Ga0207664_107642301 127
49 3300025935 Ga0207709_11199348 Ga0207709_111993481 127
50 3300025941 Ga0207711_10254284 Ga0207711_102542842 127
51 3300027671 Ga0209588_1123156 Ga0209588_11231562 127
52 3300028380 Ga0268265_11012407 Ga0268265_110124071 127
53 3300028558 Ga0265326_10062877 Ga0265326_100628772 127
54 3300028666 Ga0265336_10005747 Ga0265336_100057473 127
55 3300028800 Ga0265338_10013197 Ga0265338_100131972 127
56 3300028800 Ga0265338_10455448 Ga0265338_104554482 127
57 3300029957 Ga0265324_10031067 Ga0265324_100310672 127
58 3300031238 Ga0265332_10035891 Ga0265332_100358914 127
59 3300031240 Ga0265320_10002658 Ga0265320_100026586 127
60 3300031241 Ga0265325_10024249 Ga0265325_100242492 127
61 3300031241 Ga0265325_10046806 Ga0265325_100468062 127
62 3300031242 Ga0265329_10052909 Ga0265329_100529092 127
63 3300031250 Ga0265331_10002345 Ga0265331_100023454 127
64 3300031344 Ga0265316_10049355 Ga0265316_100493552 127
65 3300031344 Ga0265316_10207791 Ga0265316_102077912 127
66 3300031344 Ga0265316_10334925 Ga0265316_103349252 127
67 3300031711 Ga0265314_10016361 Ga0265314_100163612 127
68 3300031711 Ga0265314_10069570 Ga0265314_100695703 127
69 3300031712 Ga0265342_10194828 Ga0265342_101948282 127
70 3300031712 Ga0265342_10469419 Ga0265342_104694191 127
71 3300036401 Ga0373937_1068886 Ga0373937_1068886_266_649 127
72 3300037471 Ga0395905_0837095 Ga0395905_0837095_329_712 127
73 3300037853 Ga0436364_1546721 Ga0436364_1546721_287_673 127
74 3300046460 Ga0495638_0013177 Ga0495638_0013177_2136_2522 127
75 3300046462 Ga0495651_0017095 Ga0495651_0017095_5183_5566 127
76 3300046472 Ga0495580_0445215 Ga0495580_0445215_121_504 127
77 3300046472 Ga0495580_0686475 Ga0495580_0686475_195_578 127
78 3300046511 Ga0495608_0155994 Ga0495608_0155994_928_1311 127
79 3300046516 Ga0495628_0286015 Ga0495628_0286015_614_997 127
80 3300046529 Ga0495652_1048642 Ga0495652_1048642_114_497 127
81 3300046543 Ga0495645_0115037 Ga0495645_0115037_214_597 127
82 3300046559 Ga0495667_0052487 Ga0495667_0052487_1165_1548 127
83 3300046663 Ga0495635_0301376 Ga0495635_0301376_390_773 127
84 3300046679 Ga0495623_0011585 Ga0495623_0011585_933_1316 127
85 3300046679 Ga0495623_0191222 Ga0495623_0191222_469_852 127
86 3300046809 Ga0495600_0096711 Ga0495600_0096711_1429_1812 127
87 3300047317 Ga0495604_0119561 Ga0495604_0119561_216_599 127
88 3300047317 Ga0495604_0129986 Ga0495604_0129986_1294_1677 127
89 3300047317 Ga0495604_0673569 Ga0495604_0673569_63_446 127
90 3300047319 Ga0495674_0016271 Ga0495674_0016271_2430_2813 127
91 3300047319 Ga0495674_0846415 Ga0495674_0846415_315_698 127
92 3300047322 Ga0495680_0166911 Ga0495680_0166911_122_505 127
93 3300047444 Ga0495675_0088817 Ga0495675_0088817_1459_1842 127
94 3300047471 Ga0495684_0016081 Ga0495684_0016081_1164_1547 127
95 3300047471 Ga0495684_0022536 Ga0495684_0022536_1169_1552 127
96 3300048088 Ga0495602_0004066 Ga0495602_0004066_6688_7071 127
97 3300048904 Ga0496101_1476037 Ga0496101_1476037_77_460 127
98 3300048912 Ga0496109_1282145 Ga0496109_1282145_113_496 127
99 3300050490 nmdc:mga03n38_8027_c1 nmdc:mga03n38_8027_c1_1295_1681 127
100 3300050512 nmdc:mga0n895_2071561_c1 nmdc:mga0n895_2071561_c1_35_421 127
101 3300005327 Ga0070658_10052049 Ga0070658_100520493 128
102 3300005334 Ga0068869_100607024 Ga0068869_1006070241 128
103 3300005336 Ga0070680_100188438 Ga0070680_1001884382 128
104 3300005337 Ga0070682_100395104 Ga0070682_1003951042 128
105 3300005355 Ga0070671_101811202 Ga0070671_1018112022 128
106 3300005367 Ga0070667_100475349 Ga0070667_1004753492 128
107 3300005434 Ga0070709_10105289 Ga0070709_101052891 128
108 3300005434 Ga0070709_10322108 Ga0070709_103221082 128
109 3300005436 Ga0070713_100012481 Ga0070713_1000124816 128
110 3300005437 Ga0070710_10267835 Ga0070710_102678352 128
111 3300005439 Ga0070711_100013439 Ga0070711_1000134393 128
112 3300005439 Ga0070711_100108696 Ga0070711_1001086962 128
113 3300005439 Ga0070711_100428047 Ga0070711_1004280472 128
114 3300005445 Ga0070708_100028741 Ga0070708_1000287413 128
115 3300005445 Ga0070708_100072609 Ga0070708_1000726093 128
116 3300005445 Ga0070708_100366184 Ga0070708_1003661842 128
117 3300005445 Ga0070708_100657034 Ga0070708_1006570342 128
118 3300005466 Ga0070685_10281142 Ga0070685_102811422 128
119 3300005467 Ga0070706_100181857 Ga0070706_1001818572 128
120 3300005467 Ga0070706_100262227 Ga0070706_1002622272 128
121 3300005467 Ga0070706_100285066 Ga0070706_1002850661 128
122 3300005467 Ga0070706_100619254 Ga0070706_1006192541 128
123 3300005467 Ga0070706_100820769 Ga0070706_1008207691 128
124 3300005468 Ga0070707_100021238 Ga0070707_1000212383 128
125 3300005468 Ga0070707_100283963 Ga0070707_1002839632 128
126 3300005468 Ga0070707_100293727 Ga0070707_1002937271 128
127 3300005468 Ga0070707_100294572 Ga0070707_1002945722 128
128 3300005468 Ga0070707_100641132 Ga0070707_1006411322 128
129 3300005471 Ga0070698_100005912 Ga0070698_1000059128 128
130 3300005471 Ga0070698_100006749 Ga0070698_1000067495 128
131 3300005471 Ga0070698_100546341 Ga0070698_1005463412 128
132 3300005471 Ga0070698_101786320 Ga0070698_1017863201 128
133 3300005518 Ga0070699_100199571 Ga0070699_1001995712 128
134 3300005518 Ga0070699_100308918 Ga0070699_1003089182 128
135 3300005518 Ga0070699_100336950 Ga0070699_1003369502 128
136 3300005536 Ga0070697_100209670 Ga0070697_1002096702 128
137 3300005536 Ga0070697_100326832 Ga0070697_1003268321 128
138 3300005539 Ga0068853_100506545 Ga0068853_1005065452 128
139 3300005545 Ga0070695_100477820 Ga0070695_1004778202 128
140 3300005546 Ga0070696_100897367 Ga0070696_1008973672 128
141 3300005547 Ga0070693_100002281 Ga0070693_1000022816 128
142 3300005548 Ga0070665_100010354 Ga0070665_1000103544 128
143 3300005548 Ga0070665_100540986 Ga0070665_1005409862 128
144 3300005549 Ga0070704_100058399 Ga0070704_1000583992 128
145 3300005549 Ga0070704_100310011 Ga0070704_1003100112 128
146 3300005549 Ga0070704_101177274 Ga0070704_1011772742 128
147 3300005563 Ga0068855_100310575 Ga0068855_1003105752 128
148 3300005616 Ga0068852_101088117 Ga0068852_1010881172 128
149 3300005617 Ga0068859_100103413 Ga0068859_1001034132 128
150 3300005618 Ga0068864_100241391 Ga0068864_1002413912 128
151 3300005842 Ga0068858_100084909 Ga0068858_1000849093 128
152 3300005842 Ga0068858_100377965 Ga0068858_1003779652 128
153 3300005843 Ga0068860_100004674 Ga0068860_1000046742 128
154 3300005843 Ga0068860_100381820 Ga0068860_1003818202 128
155 3300006028 Ga0070717_10161644 Ga0070717_101616442 128
156 3300006163 Ga0070715_10049944 Ga0070715_100499441 128
157 3300006163 Ga0070715_10071179 Ga0070715_100711792 128
158 3300006173 Ga0070716_100008916 Ga0070716_1000089162 128
159 3300006173 Ga0070716_100112530 Ga0070716_1001125302 128
160 3300006173 Ga0070716_100223856 Ga0070716_1002238562 128
161 3300006173 Ga0070716_100721918 Ga0070716_1007219182 128
162 3300006175 Ga0070712_100053745 Ga0070712_1000537452 128
163 3300006175 Ga0070712_100266762 Ga0070712_1002667622 128
164 3300006175 Ga0070712_100337093 Ga0070712_1003370932 128
165 3300006175 Ga0070712_100361254 Ga0070712_1003612542 128
166 3300006237 Ga0097621_100005159 Ga0097621_1000051598 128
167 3300006358 Ga0068871_100126978 Ga0068871_1001269782 128
168 3300006358 Ga0068871_101072846 Ga0068871_1010728461 128
169 3300006852 Ga0075433_11468636 Ga0075433_114686361 128
170 3300006871 Ga0075434_100002410 Ga0075434_1000024104 128
171 3300006881 Ga0068865_101213230 Ga0068865_1012132302 128
172 3300006914 Ga0075436_100003544 Ga0075436_1000035444 128
173 3300006914 Ga0075436_100042243 Ga0075436_1000422433 128
174 3300006914 Ga0075436_100100437 Ga0075436_1001004372 128
175 3300006914 Ga0075436_100102234 Ga0075436_1001022342 128
176 3300006914 Ga0075436_100276649 Ga0075436_1002766491 128
177 3300006931 Ga0097620_100103411 Ga0097620_1001034114 128
178 3300007076 Ga0075435_100196342 Ga0075435_1001963422 128
179 3300007076 Ga0075435_100258267 Ga0075435_1002582672 128
180 3300007076 Ga0075435_100497496 Ga0075435_1004974962 128
181 3300007265 Ga0099794_10006987 Ga0099794_100069874 128
182 3300007265 Ga0099794_10009033 Ga0099794_100090332 128
183 3300007265 Ga0099794_10037532 Ga0099794_100375323 128
184 3300007265 Ga0099794_10038357 Ga0099794_100383573 128
185 3300007265 Ga0099794_10070667 Ga0099794_100706672 128
186 3300007265 Ga0099794_10075789 Ga0099794_100757892 128
187 3300007265 Ga0099794_10076303 Ga0099794_100763032 128
188 3300007265 Ga0099794_10076461 Ga0099794_100764611 128
189 3300007265 Ga0099794_10113534 Ga0099794_101135341 128
190 3300007265 Ga0099794_10128949 Ga0099794_101289492 128
191 3300007265 Ga0099794_10148153 Ga0099794_101481532 128
192 3300007265 Ga0099794_10209918 Ga0099794_102099182 128
193 3300007265 Ga0099794_10301711 Ga0099794_103017112 128
194 3300007788 Ga0099795_10006836 Ga0099795_100068362 128
195 3300007788 Ga0099795_10562321 Ga0099795_105623211 128
196 3300009098 Ga0105245_10291189 Ga0105245_102911892 128
197 3300009101 Ga0105247_10175895 Ga0105247_101758952 128
198 3300009101 Ga0105247_10434211 Ga0105247_104342112 128
199 3300009174 Ga0105241_10380916 Ga0105241_103809162 128
200 3300009176 Ga0105242_10127529 Ga0105242_101275292 128
201 3300009177 Ga0105248_10055865 Ga0105248_100558652 128
202 3300009177 Ga0105248_10131474 Ga0105248_101314741 128
203 3300009177 Ga0105248_10458098 Ga0105248_104580982 128
204 3300009545 Ga0105237_11416892 Ga0105237_114168922 128
205 3300009551 Ga0105238_10201344 Ga0105238_102013441 128
206 3300009551 Ga0105238_11705896 Ga0105238_117058961 128
207 3300009551 Ga0105238_11857497 Ga0105238_118574972 128
208 3300010159 Ga0099796_10076594 Ga0099796_100765941 128
209 3300010159 Ga0099796_10179390 Ga0099796_101793902 128
210 3300010375 Ga0105239_10277202 Ga0105239_102772022 128
211 3300013104 Ga0157370_10257536 Ga0157370_102575362 128
212 3300013296 Ga0157374_11059558 Ga0157374_110595582 128
213 3300013297 Ga0157378_10000216 Ga0157378_1000021613 128
214 3300013297 Ga0157378_10000355 Ga0157378_1000035524 128
215 3300013306 Ga0163162_10020314 Ga0163162_100203146 128
216 3300013306 Ga0163162_11534571 Ga0163162_115345712 128
217 3300013306 Ga0163162_12187676 Ga0163162_121876762 128
218 3300013308 Ga0157375_10159114 Ga0157375_101591142 128
219 3300014325 Ga0163163_10136184 Ga0163163_101361843 128
220 3300014325 Ga0163163_12580425 Ga0163163_125804251 128
221 3300014968 Ga0157379_10147487 Ga0157379_101474872 128
222 3300014969 Ga0157376_10000065 Ga0157376_1000006570 128
223 3300025900 Ga0207710_10463075 Ga0207710_104630752 128
224 3300025905 Ga0207685_10092471 Ga0207685_100924712 128
225 3300025905 Ga0207685_10274532 Ga0207685_102745322 128
226 3300025906 Ga0207699_10054061 Ga0207699_100540613 128
227 3300025906 Ga0207699_10122917 Ga0207699_101229172 128
228 3300025906 Ga0207699_10363973 Ga0207699_103639732 128
229 3300025906 Ga0207699_10873097 Ga0207699_108730971 128
230 3300025909 Ga0207705_10046285 Ga0207705_100462852 128
231 3300025910 Ga0207684_10041274 Ga0207684_100412742 128
232 3300025910 Ga0207684_10691447 Ga0207684_106914471 128
233 3300025913 Ga0207695_10234044 Ga0207695_102340442 128
234 3300025914 Ga0207671_10821861 Ga0207671_108218612 128
235 3300025915 Ga0207693_10091088 Ga0207693_100910882 128
236 3300025915 Ga0207693_10283301 Ga0207693_102833012 128
237 3300025915 Ga0207693_10290260 Ga0207693_102902602 128
238 3300025915 Ga0207693_10650107 Ga0207693_106501071 128
239 3300025915 Ga0207693_10962438 Ga0207693_109624381 128
240 3300025916 Ga0207663_10031828 Ga0207663_100318283 128
241 3300025919 Ga0207657_10781380 Ga0207657_107813802 128
242 3300025919 Ga0207657_11262396 Ga0207657_112623961 128
243 3300025922 Ga0207646_10002210 Ga0207646_1000221013 128
244 3300025922 Ga0207646_10061649 Ga0207646_100616493 128
245 3300025922 Ga0207646_10251032 Ga0207646_102510322 128
246 3300025922 Ga0207646_10780115 Ga0207646_107801151 128
247 3300025927 Ga0207687_10057694 Ga0207687_100576942 128
248 3300025928 Ga0207700_10071261 Ga0207700_100712612 128
249 3300025928 Ga0207700_10118009 Ga0207700_101180092 128
250 3300025928 Ga0207700_10264549 Ga0207700_102645492 128
251 3300025934 Ga0207686_10236801 Ga0207686_102368012 128
252 3300025938 Ga0207704_10293239 Ga0207704_102932392 128
253 3300025938 Ga0207704_10760455 Ga0207704_107604552 128
254 3300025939 Ga0207665_10000185 Ga0207665_1000018522 128
255 3300025939 Ga0207665_10025317 Ga0207665_100253173 128
256 3300025939 Ga0207665_10028620 Ga0207665_100286202 128
257 3300025939 Ga0207665_10032645 Ga0207665_100326453 128
258 3300025939 Ga0207665_10299693 Ga0207665_102996932 128
259 3300025939 Ga0207665_10671698 Ga0207665_106716982 128
260 3300025941 Ga0207711_10328195 Ga0207711_103281952 128
261 3300025941 Ga0207711_10680417 Ga0207711_106804172 128
262 3300025941 Ga0207711_10864297 Ga0207711_108642972 128
263 3300025949 Ga0207667_10407844 Ga0207667_104078442 128
264 3300025961 Ga0207712_10524526 Ga0207712_105245262 128
265 3300025986 Ga0207658_11077874 Ga0207658_110778742 128
266 3300026035 Ga0207703_10269660 Ga0207703_102696602 128
267 3300026041 Ga0207639_11172387 Ga0207639_111723872 128
268 3300026088 Ga0207641_10005018 Ga0207641_100050187 128
269 3300026095 Ga0207676_10216735 Ga0207676_102167351 128
270 3300026095 Ga0207676_11122471 Ga0207676_111224712 128
271 3300027512 Ga0209179_1008926 Ga0209179_10089262 128
272 3300027671 Ga0209588_1003071 Ga0209588_10030714 128
273 3300027671 Ga0209588_1021275 Ga0209588_10212752 128
274 3300027671 Ga0209588_1071253 Ga0209588_10712532 128
275 3300027671 Ga0209588_1072546 Ga0209588_10725462 128
276 3300027671 Ga0209588_1103247 Ga0209588_11032471 128
277 3300027671 Ga0209588_1195296 Ga0209588_11952961 128
278 3300027671 Ga0209588_1209572 Ga0209588_12095722 128
279 3300028379 Ga0268266_10000785 Ga0268266_100007855 128
280 3300028379 Ga0268266_10408482 Ga0268266_104084822 128
281 3300028381 Ga0268264_10175849 Ga0268264_101758492 128
282 3300028381 Ga0268264_10183839 Ga0268264_101838392 128
283 3300028381 Ga0268264_10271090 Ga0268264_102710901 128
284 3300028800 Ga0265338_10155054 Ga0265338_101550542 128
285 3300033547 Ga0316212_1001970 Ga0316212_10019702 128
286 3300035083 Ga0373926_0002697 Ga0373926_0002697_1910_2311 128
287 3300035085 Ga0373929_0118726 Ga0373929_0118726_140_541 128
288 3300035113 Ga0373936_0255246 Ga0373936_0255246_168_569 128
289 3300035171 Ga0373946_0029261 Ga0373946_0029261_1440_1841 128
290 3300035691 Ga0373931_0064405 Ga0373931_0064405_585_986 128
291 3300035691 Ga0373931_0197376 Ga0373931_0197376_454_855 128
292 3300035691 Ga0373931_0211562 Ga0373931_0211562_197_598 128
293 3300035692 Ga0373935_0295162 Ga0373935_0295162_428_829 128
294 3300035695 Ga0373927_0000078 Ga0373927_0000078_4414_4815 128
295 3300035724 Ga0373933_0798664 Ga0373933_0798664_210_611 128
296 3300035725 Ga0373947_0041314 Ga0373947_0041314_1923_2324 128
297 3300035725 Ga0373947_1084526 Ga0373947_1084526_15_416 128
298 3300036401 Ga0373937_1214170 Ga0373937_1214170_208_609 128
299 3300037068 Ga0373925_0000127 Ga0373925_0000127_12371_12772 128
300 3300037068 Ga0373925_0227305 Ga0373925_0227305_548_949 128
301 3300045051 Ga0451576_1678026 Ga0451576_1678026_202_603 128
302 3300046454 Ga0495592_0060038 Ga0495592_0060038_2332_2733 128
303 3300046455 Ga0495603_0049325 Ga0495603_0049325_368_769 128
304 3300046461 Ga0495641_0055299 Ga0495641_0055299_92_493 128
305 3300046463 Ga0495653_0250209 Ga0495653_0250209_746_1147 128
306 3300046472 Ga0495580_0003307 Ga0495580_0003307_2006_2407 128
307 3300046473 Ga0495582_0047833 Ga0495582_0047833_1685_2086 128
308 3300046477 Ga0495664_0104203 Ga0495664_0104203_537_944 128
309 3300046491 Ga0495584_0277962 Ga0495584_0277962_236_637 128
310 3300046514 Ga0495618_0024609 Ga0495618_0024609_2818_3219 128
311 3300046517 Ga0495630_0009426 Ga0495630_0009426_5692_6093 128
312 3300046533 Ga0495640_0191526 Ga0495640_0191526_325_732 128
313 3300046543 Ga0495645_0009870 Ga0495645_0009870_1881_2288 128
314 3300046678 Ga0495599_0264857 Ga0495599_0264857_451_858 128
315 3300046683 Ga0495658_0452535 Ga0495658_0452535_66_467 128
316 3300047317 Ga0495604_0219289 Ga0495604_0219289_761_1162 128
317 3300047319 Ga0495674_0109266 Ga0495674_0109266_532_939 128
318 3300047321 Ga0495676_0097324 Ga0495676_0097324_154_555 128
319 3300047444 Ga0495675_0646336 Ga0495675_0646336_79_480 128
320 3300048089 Ga0495614_0156465 Ga0495614_0156465_284_685 128
321 3300048904 Ga0496101_0107597 Ga0496101_0107597_977_1378 128
322 3300048905 Ga0496102_0005886 Ga0496102_0005886_3923_4327 128
323 3300048906 Ga0496103_0287101 Ga0496103_0287101_373_777 128
324 3300048907 Ga0496104_0894879 Ga0496104_0894879_150_551 128
325 3300048911 Ga0496108_0458260 Ga0496108_0458260_139_543 128
326 3300048917 Ga0496114_0006808 Ga0496114_0006808_4661_5062 128
327 3300048917 Ga0496114_0395542 Ga0496114_0395542_354_755 128
328 3300048918 Ga0496115_0008926 Ga0496115_0008926_3477_3878 128
329 3300048918 Ga0496115_0030200 Ga0496115_0030200_2936_3337 128
330 3300048918 Ga0496115_0850096 Ga0496115_0850096_31_432 128
331 3300050512 nmdc:mga0n895_9170_c1 nmdc:mga0n895_9170_c1_7859_8260 128
332 3300050513 nmdc:mga0rr50_239380_c1 nmdc:mga0rr50_239380_c1_102_503 128
333 3300050513 nmdc:mga0rr50_314335_c1 nmdc:mga0rr50_314335_c1_790_1191 128
334 3300050513 nmdc:mga0rr50_453794_c1 nmdc:mga0rr50_453794_c1_530_934 128
335 3300050514 nmdc:mga08x19_146638_c1 nmdc:mga08x19_146638_c1_629_1030 128
336 3300050514 nmdc:mga08x19_21309_c1 nmdc:mga08x19_21309_c1_3045_3446 128
337 3300050514 nmdc:mga08x19_250_c1 nmdc:mga08x19_250_c1_6776_7177 128
338 3300050514 nmdc:mga08x19_41521_c1 nmdc:mga08x19_41521_c1_2340_2741 128
339 3300050514 nmdc:mga08x19_47958_c1 nmdc:mga08x19_47958_c1_1299_1700 128
340 3300050514 nmdc:mga08x19_566017_c1 nmdc:mga08x19_566017_c1_306_707 128
341 3300050515 nmdc:mga0a205_37172_c1 nmdc:mga0a205_37172_c1_2893_3294 128
342 3300050515 nmdc:mga0a205_422357_c1 nmdc:mga0a205_422357_c1_753_1154 128
343 3300053077 Ga0495601_0004463 Ga0495601_0004463_7182_7589 128
344 3300053085 Ga0495619_0087573 Ga0495619_0087573_532_933 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

23

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9928 1 127
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9915 7 126
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9898 7 123
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9775 1 127
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.966 2 125
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.994 7 123 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9913 7 126 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9776 7 124 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9708 6 124 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9695 5 124 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A067GPV7-F1-model_v4 Glycine cleavage system H protein 0.999 4 127 GO:0005739
GO:0005960
GO:0019464
AF-A0A4D8YYX3-F1-model_v4 deleted 0.9988 5 127
AF-A0A314YSG0-F1-model_v4 Pentatricopeptide repeat-containing protein 0.9986 4 127 GO:0005739
GO:0005960
GO:0019464
AF-A0A2I0KP74-F1-model_v4 Glycine cleavage system H protein 0.9984 4 127 GO:0005739
GO:0005960
GO:0019464
AF-A0A2K3NJQ1-F1-model_v4 Glycine cleavage system H protein 0.9984 6 127 GO:0005739
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
96.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map