F415896

General Info

Members Datasets Scaffolds Average Seq Length
344 164 339 259

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100520442|Ga0068862_1005204422
Length 282
Sequence LKKIFQFPIFKIDHYPETPVCMKPLLLLVDDNEEILEFLEHELSEKYTVMKALNGLEAMDLLKENAVQLVISDIMMPVMDGFELCRIIKTNFDYSHIPIILLTARNTLQSKIEGLEQGADAYIEKPFSPEYLQVQISSLLSNRNKIKEYFASSPLVHIKSIAYSRADELFLERINESIFMNLEDTELDVEKLAKLMNMSKPTLYRKIKSLSDLSPNELINITRLKKAAELLAEGKYKIYEVADMVGYASQTNFGRSFLKQFGMTPSEYLSSKEAEKNKQQDL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
4 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
5 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
6 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
142 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
164 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0
Rhizoplane 0.29
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2394569 2162886011 Unclassified 2012
2 rootH2_10011302 3300003320 Bacteria 9780
3 rootL2_10004165 3300003322 Bacteria 3841
4 JGI25160J50197_1014764 3300003354 Bacteria 2596
5 Ga0055535_1004269 3300003761 Bacteria 3551
6 Ga0055526_1008954 3300003771 Bacteria 4902
7 Ga0055526_1013697 3300003771 Bacteria 3406
8 Ga0055528_1000447 3300003790 Bacteria 33056
9 Ga0055530_10002747 3300003791 Bacteria 10888
10 Ga0055531_10000003 3300003794 Bacteria 274424
11 Ga0055531_10027526 3300003794 Bacteria 1991
12 Ga0065165_1000012 3300005262 Bacteria 303241
13 Ga0065712_10002292 3300005290 Bacteria 5395
14 Ga0070658_10045948 3300005327 Bacteria 3533
15 Ga0070658_10064727 3300005327 Bacteria 2982
16 Ga0070658_10161368 3300005327 Bacteria 1881
17 Ga0070676_10172357 3300005328 Unclassified 1401
18 Ga0070683_100191766 3300005329 Bacteria 1941
19 Ga0070683_100234231 3300005329 Bacteria 1746
20 Ga0070677_10056705 3300005333 Unclassified 1603
21 Ga0068869_100003811 3300005334 Bacteria 9295
22 Ga0070666_10000375 3300005335 Bacteria 28142
23 Ga0070666_10003275 3300005335 Bacteria 9832
24 Ga0070666_10503375 3300005335 Bacteria 878
25 Ga0070680_100001784 3300005336 Bacteria 15806
26 Ga0070680_100019154 3300005336 Bacteria 5421
27 Ga0070682_100000604 3300005337 Bacteria 21844
28 Ga0070682_100001117 3300005337 Bacteria 15346
29 Ga0068868_100132562 3300005338 Bacteria 2040
30 Ga0070691_10000637 3300005341 Bacteria 13533
31 Ga0070691_10000845 3300005341 Bacteria 12373
32 Ga0070668_100378995 3300005347 Unclassified 1203
33 Ga0070669_100020946 3300005353 Unclassified 4671
34 Ga0070675_100006130 3300005354 Bacteria 9217
35 Ga0070673_100106037 3300005364 Bacteria 2323
36 Ga0070667_100001870 3300005367 Bacteria 18708
37 Ga0070667_100051100 3300005367 Bacteria 3485
38 Ga0070714_100722451 3300005435 Bacteria 962
39 Ga0070663_100007879 3300005455 Bacteria 6517
40 Ga0070681_10001921 3300005458 Bacteria 18746
41 Ga0070681_10040611 3300005458 Bacteria 4660
42 Ga0068867_100085788 3300005459 Bacteria 2381
43 Ga0070679_100001924 3300005530 Bacteria 18646
44 Ga0070679_100002323 3300005530 Bacteria 17203
45 Ga0070679_100018144 3300005530 Bacteria 6823
46 Ga0070679_100029404 3300005530 Bacteria 5421
47 Ga0068853_100007390 3300005539 Bacteria 8791
48 Ga0068853_100077239 3300005539 Bacteria 2909
49 Ga0068853_100127875 3300005539 Bacteria 2271
50 Ga0068853_100390364 3300005539 Unclassified 1301
51 Ga0068853_100940179 3300005539 Bacteria 831
52 Ga0070693_100118890 3300005547 Bacteria 1636
53 Ga0070693_100309212 3300005547 Bacteria 1068
54 Ga0070665_100000002 3300005548 Bacteria 849037
55 Ga0070665_100577424 3300005548 Bacteria 1137
56 Ga0068855_100003699 3300005563 Bacteria 18698
57 Ga0068855_100024366 3300005563 Bacteria 7241
58 Ga0068855_100051012 3300005563 Bacteria 4874
59 Ga0068855_100108822 3300005563 Bacteria 3183
60 Ga0068855_100168888 3300005563 Bacteria 2478
61 Ga0068857_100001405 3300005577 Bacteria 19005
62 Ga0068854_100130690 3300005578 Bacteria 1917
63 Ga0068856_100045118 3300005614 Bacteria 4339
64 Ga0068856_100357548 3300005614 Bacteria 1479
65 Ga0068852_100000475 3300005616 Bacteria 26290
66 Ga0068852_100004963 3300005616 Bacteria 9456
67 Ga0068852_100077979 3300005616 Bacteria 2930
68 Ga0068852_100093382 3300005616 Bacteria 2697
69 Ga0068852_100238019 3300005616 Bacteria 1738
70 Ga0068859_100000086 3300005617 Bacteria 85696
71 Ga0068859_100001050 3300005617 Bacteria 28328
72 Ga0068859_100003161 3300005617 Bacteria 16750
73 Ga0068864_100008169 3300005618 Bacteria 8631
74 Ga0068861_100020925 3300005719 Bacteria 4694
75 Ga0068861_100500533 3300005719 Bacteria 1098
76 Ga0068851_10003379 3300005834 Bacteria 7099
77 Ga0068870_10191382 3300005840 Unclassified 1235
78 Ga0068863_100022843 3300005841 Bacteria 5976
79 Ga0068858_100028173 3300005842 Bacteria 5219
80 Ga0068860_100000019 3300005843 Bacteria 299860
81 Ga0068860_100002087 3300005843 Bacteria 21045
82 Ga0068860_100004278 3300005843 Bacteria 14603
83 Ga0068860_100046412 3300005843 Bacteria 4142
84 Ga0068860_100203610 3300005843 Bacteria 1919
85 Ga0068862_100018946 3300005844 Bacteria 5735
86 Ga0068862_100520442 3300005844 Bacteria 1132
87 Ga0097621_100116623 3300006237 Bacteria 2261
88 Ga0068871_100041243 3300006358 Bacteria 3700
89 Ga0097620_100000086 3300006931 Bacteria 85696
90 Ga0097620_100001050 3300006931 Bacteria 28328
91 Ga0097620_100003161 3300006931 Bacteria 16750
92 Ga0105240_10000093 3300009093 Bacteria 181967
93 Ga0105240_10000285 3300009093 Bacteria 99253
94 Ga0105240_10000573 3300009093 Bacteria 68110
95 Ga0105240_10000607 3300009093 Bacteria 66455
96 Ga0105240_10000773 3300009093 Bacteria 58079
97 Ga0105240_10003844 3300009093 Bacteria 23186
98 Ga0105240_10015765 3300009093 Bacteria 10255
99 Ga0105240_10141946 3300009093 Bacteria 2870
100 Ga0105240_10146725 3300009093 Unclassified 2815
101 Ga0105240_10281816 3300009093 Bacteria 1909
102 Ga0105240_10339305 3300009093 Bacteria 1707
103 Ga0111539_10002802 3300009094 Bacteria 23149
104 Ga0105245_10034065 3300009098 Bacteria 4515
105 Ga0105241_10000357 3300009174 Bacteria 34720
106 Ga0105241_10001385 3300009174 Bacteria 18527
107 Ga0105241_10001435 3300009174 Bacteria 18251
108 Ga0105241_10010387 3300009174 Bacteria 6832
109 Ga0105241_10073243 3300009174 Bacteria 2664
110 Ga0105248_10353283 3300009177 Bacteria 1655
111 Ga0105237_10000083 3300009545 Bacteria 127032
112 Ga0105237_10000143 3300009545 Bacteria 101515
113 Ga0105237_10001381 3300009545 Bacteria 32046
114 Ga0105237_10001891 3300009545 Bacteria 26726
115 Ga0105237_10002802 3300009545 Bacteria 21173
116 Ga0105237_10005465 3300009545 Bacteria 14336
117 Ga0105237_10011230 3300009545 Bacteria 9486
118 Ga0105237_10122508 3300009545 Unclassified 2594
119 Ga0105237_10162298 3300009545 Bacteria 2233
120 Ga0105238_10004053 3300009551 Bacteria 14522
121 Ga0105238_10012810 3300009551 Bacteria 8461
122 Ga0105238_10051968 3300009551 Bacteria 4121
123 Ga0105238_10090867 3300009551 Bacteria 3041
124 Ga0105249_10002367 3300009553 Bacteria 16373
125 Ga0105249_10027548 3300009553 Bacteria 5127
126 Ga0105239_10000267 3300010375 Bacteria 77181
127 Ga0105239_10000666 3300010375 Bacteria 48870
128 Ga0105239_10001492 3300010375 Bacteria 31123
129 Ga0105239_10002201 3300010375 Bacteria 25067
130 Ga0105239_10003273 3300010375 Bacteria 19978
131 Ga0105239_10544878 3300010375 Bacteria 1321
132 Ga0105239_10815774 3300010375 Bacteria 1069
133 Ga0105246_10001658 3300011119 Bacteria 13283
134 Ga0157373_10065306 3300013100 Unclassified 2575
135 Ga0157373_10127982 3300013100 Bacteria 1786
136 Ga0157371_10004968 3300013102 Bacteria 11422
137 Ga0157371_10017539 3300013102 Bacteria 5316
138 Ga0157371_10119535 3300013102 Bacteria 1873
139 Ga0157371_10174205 3300013102 Bacteria 1538
140 Ga0157371_10177514 3300013102 Bacteria 1523
141 Ga0157371_10439459 3300013102 Bacteria 958
142 Ga0157370_10000518 3300013104 Bacteria 48217
143 Ga0157370_10002553 3300013104 Bacteria 21849
144 Ga0157370_10016434 3300013104 Bacteria 7492
145 Ga0157370_10055163 3300013104 Bacteria 3787
146 Ga0157370_10477767 3300013104 Unclassified 1145
147 Ga0157369_10016679 3300013105 Bacteria 8257
148 Ga0157369_10041445 3300013105 Bacteria 5026
149 Ga0157369_10152675 3300013105 Bacteria 2441
150 Ga0157374_10000029 3300013296 Bacteria 211547
151 Ga0157374_10482627 3300013296 Unclassified 1243
152 Ga0157378_10053152 3300013297 Bacteria 3606
153 Ga0157378_10097893 3300013297 Unclassified 2674
154 Ga0157378_10252609 3300013297 Bacteria 1688
155 Ga0163162_10000658 3300013306 Bacteria 31959
156 Ga0163162_10021488 3300013306 Bacteria 6357
157 Ga0163162_10029065 3300013306 Bacteria 5470
158 Ga0163162_10047927 3300013306 Bacteria 4281
159 Ga0163162_10274560 3300013306 Bacteria 1818
160 Ga0157372_10000975 3300013307 Bacteria 31228
161 Ga0157372_10005839 3300013307 Bacteria 13108
162 Ga0157372_10028977 3300013307 Bacteria 6040
163 Ga0157372_10033393 3300013307 Bacteria 5652
164 Ga0157372_10094199 3300013307 Bacteria 3410
165 Ga0157372_10498973 3300013307 Bacteria 1419
166 Ga0157372_11294930 3300013307 Bacteria 841
167 Ga0157375_10094850 3300013308 Bacteria 3053
168 Ga0157375_10415293 3300013308 Bacteria 1512
169 Ga0163163_10133134 3300014325 Bacteria 2526
170 Ga0163163_10283614 3300014325 Bacteria 1708
171 Ga0157380_10017530 3300014326 Bacteria 5301
172 Ga0157380_10035271 3300014326 Bacteria 3863
173 Ga0157377_10004667 3300014745 Bacteria 6341
174 Ga0157376_10004445 3300014969 Bacteria 9769
175 Ga0157376_10148079 3300014969 Unclassified 2114
176 Ga0209258_100404 3300025242 Bacteria 53100
177 Ga0209148_1000550 3300025254 Bacteria 35616
178 Ga0207666_1006282 3300025271 Unclassified 1536
179 Ga0209673_1000446 3300025273 Bacteria 70476
180 Ga0209673_1039054 3300025273 Bacteria 1374
181 Ga0209564_1001973 3300025295 Bacteria 18054
182 Ga0209564_1002721 3300025295 Bacteria 13339
183 Ga0209564_1017892 3300025295 Bacteria 2733
184 Ga0209758_1001411 3300025297 Bacteria 28476
185 Ga0209758_1007924 3300025297 Bacteria 7048
186 Ga0209050_1001619 3300025298 Bacteria 23124
187 Ga0207426_1000754 3300025302 Bacteria 36199
188 Ga0207426_1042027 3300025302 Bacteria 1413
189 Ga0209051_1048470 3300025303 Bacteria 1440
190 Ga0209257_1000008 3300025304 Bacteria 1294570
191 Ga0209257_1000686 3300025304 Bacteria 52620
192 Ga0207680_10000117 3300025903 Bacteria 36819
193 Ga0207680_10003332 3300025903 Bacteria 7564
194 Ga0207647_10022862 3300025904 Bacteria 4147
195 Ga0207647_10072666 3300025904 Bacteria 2074
196 Ga0207705_10001125 3300025909 Bacteria 21755
197 Ga0207705_10015239 3300025909 Bacteria 5521
198 Ga0207705_10045386 3300025909 Bacteria 3158
199 Ga0207705_10262286 3300025909 Unclassified 1319
200 Ga0207654_10000779 3300025911 Bacteria 17521
201 Ga0207654_10001156 3300025911 Bacteria 14193
202 Ga0207654_10001987 3300025911 Bacteria 10539
203 Ga0207654_10002363 3300025911 Bacteria 9674
204 Ga0207654_10007269 3300025911 Bacteria 5582
205 Ga0207707_10000110 3300025912 Bacteria 82391
206 Ga0207707_10002050 3300025912 Bacteria 18297
207 Ga0207707_10225236 3300025912 Bacteria 1632
208 Ga0207695_10000135 3300025913 Bacteria 217822
209 Ga0207695_10000183 3300025913 Bacteria 181350
210 Ga0207695_10001087 3300025913 Bacteria 47422
211 Ga0207695_10001198 3300025913 Bacteria 44620
212 Ga0207695_10029861 3300025913 Bacteria 6014
213 Ga0207695_10035617 3300025913 Bacteria 5394
214 Ga0207695_10139067 3300025913 Unclassified 2379
215 Ga0207695_10187213 3300025913 Bacteria 1989
216 Ga0207671_10000999 3300025914 Bacteria 34788
217 Ga0207671_10001490 3300025914 Bacteria 27010
218 Ga0207671_10002827 3300025914 Bacteria 18050
219 Ga0207671_10003360 3300025914 Bacteria 16049
220 Ga0207671_10009247 3300025914 Bacteria 8256
221 Ga0207671_10017192 3300025914 Bacteria 5587
222 Ga0207671_10027565 3300025914 Unclassified 4247
223 Ga0207671_10081095 3300025914 Unclassified 2433
224 Ga0207660_10002478 3300025917 Bacteria 12134
225 Ga0207660_10002955 3300025917 Bacteria 11118
226 Ga0207660_10025857 3300025917 Bacteria 3990
227 Ga0207652_10000265 3300025921 Bacteria 54617
228 Ga0207652_10000475 3300025921 Bacteria 41112
229 Ga0207652_10004173 3300025921 Bacteria 11784
230 Ga0207652_10004215 3300025921 Bacteria 11738
231 Ga0207681_10222665 3300025923 Unclassified 1460
232 Ga0207694_10034763 3300025924 Unclassified 3866
233 Ga0207694_10093901 3300025924 Bacteria 2370
234 Ga0207694_10298567 3300025924 Bacteria 1326
235 Ga0207650_10191272 3300025925 Bacteria 1635
236 Ga0207650_10359824 3300025925 Unclassified 1199
237 Ga0207659_10049039 3300025926 Bacteria 2993
238 Ga0207687_10223744 3300025927 Bacteria 1483
239 Ga0207691_10139385 3300025940 Unclassified 2138
240 Ga0207689_10000260 3300025942 Bacteria 47416
241 Ga0207689_10039681 3300025942 Bacteria 3897
242 Ga0207689_10208784 3300025942 Bacteria 1613
243 Ga0207661_10058673 3300025944 Bacteria 3098
244 Ga0207667_10002639 3300025949 Bacteria 22169
245 Ga0207667_10002780 3300025949 Bacteria 21662
246 Ga0207667_10126187 3300025949 Unclassified 2636
247 Ga0207667_10154783 3300025949 Bacteria 2359
248 Ga0207667_10225612 3300025949 Bacteria 1919
249 Ga0207651_10028385 3300025960 Bacteria 3529
250 Ga0207712_10005106 3300025961 Bacteria 8306
251 Ga0207658_10002432 3300025986 Bacteria 13613
252 Ga0207703_10065061 3300026035 Unclassified 2995
253 Ga0207639_10011477 3300026041 Bacteria 6156
254 Ga0207639_10023220 3300026041 Bacteria 4477
255 Ga0207639_10064372 3300026041 Bacteria 2842
256 Ga0207639_10216160 3300026041 Unclassified 1653
257 Ga0207639_10533215 3300026041 Bacteria 1076
258 Ga0207678_10009662 3300026067 Bacteria 8484
259 Ga0207702_10062935 3300026078 Bacteria 3171
260 Ga0207702_10068943 3300026078 Bacteria 3039
261 Ga0207702_10141807 3300026078 Unclassified 2175
262 Ga0207641_10000061 3300026088 Bacteria 160161
263 Ga0207648_10050231 3300026089 Bacteria 3647
264 Ga0207648_10188834 3300026089 Unclassified 1825
265 Ga0207648_10260550 3300026089 Bacteria 1547
266 Ga0207676_10056828 3300026095 Bacteria 3078
267 Ga0207674_10011772 3300026116 Bacteria 9814
268 Ga0207674_10039895 3300026116 Bacteria 4865
269 Ga0207675_100011646 3300026118 Bacteria 8223
270 Ga0207675_100774256 3300026118 Bacteria 972
271 Ga0207698_10001143 3300026142 Bacteria 15448
272 Ga0207698_10023537 3300026142 Bacteria 4304
273 Ga0207698_10142072 3300026142 Bacteria 2070
274 Ga0207698_10203226 3300026142 Unclassified 1776
275 Ga0207698_10535176 3300026142 Bacteria 1146
276 Ga0207698_10719876 3300026142 Unclassified 994
277 Ga0207428_10054775 3300027907 Unclassified 3175
278 Ga0268266_10000022 3300028379 Bacteria 508060
279 Ga0268265_10015341 3300028380 Bacteria 5241
280 Ga0268264_10000115 3300028381 Bacteria 202634
281 Ga0268264_10002707 3300028381 Bacteria 15465
282 Ga0268264_10008645 3300028381 Bacteria 8459
283 Ga0268264_10015122 3300028381 Bacteria 6329
284 Ga0307517_10069335 3300028786 Unclassified 3197
285 Ga0307517_10132062 3300028786 Bacteria 1793
286 Ga0307515_10000001 3300028794 Bacteria 4259510
287 Ga0307508_10003309 3300031616 Bacteria 16378
288 Ga0307414_10024865 3300032004 Bacteria 3826
289 Ga0307414_10442666 3300032004 Bacteria 1138
290 Ga0307510_10005177 3300033180 Bacteria 15493
291 Ga0395899_0000248 3300037312 Bacteria 72047
292 Ga0395899_0005054 3300037312 Bacteria 10261
293 Ga0395899_0080548 3300037312 Bacteria 2370
294 Ga0395900_0003094 3300037418 Bacteria 18068
295 Ga0395900_0100488 3300037418 Bacteria 2971
296 Ga0395898_0000488 3300037466 Bacteria 78598
297 Ga0395898_0011250 3300037466 Bacteria 9311
298 Ga0395898_0564637 3300037466 Bacteria 1080
299 Ga0395905_0100781 3300037471 Bacteria 2712
300 Ga0395901_0008350 3300038443 Bacteria 10469
301 Ga0395901_0120088 3300038443 Bacteria 2762
302 Ga0395901_0850003 3300038443 Bacteria 898
303 Ga0451802_0551381 3300041460 Bacteria 1608
304 Ga0439445_0037539 3300042004 Bacteria 1278
305 Ga0439432_051794 3300042006 Bacteria 1279
306 Ga0439449_0005520 3300042007 Bacteria 4841
307 Ga0439457_012177 3300042014 Bacteria 1942
308 Ga0439457_012829 3300042014 Unclassified 1886
309 Ga0439462_0024745 3300042015 Unclassified 1579
310 Ga0450897_000519 3300042128 Bacteria 2160
311 Ga0450898_001295 3300042134 Bacteria 3261
312 Ga0450899_005796 3300042135 Bacteria 1330
313 Ga0466972_0000019 3300044658 Bacteria 198523
314 Ga0466972_0026691 3300044658 Bacteria 2861
315 Ga0466964_0083768 3300044706 Bacteria 1374
316 Ga0466970_0001553 3300044765 Bacteria 11067
317 Ga0466970_0263478 3300044765 Bacteria 967
318 Ga0495606_0008992 3300046507 Bacteria 8546
319 Ga0495648_0001367 3300046524 Bacteria 24061
320 Ga0495668_0002398 3300046616 Bacteria 15530
321 Ga0495611_0000099 3300046648 Bacteria 60428
322 Ga0495611_0000312 3300046648 Bacteria 32756
323 Ga0495611_0026870 3300046648 Bacteria 2513
324 Ga0495672_0043349 3300047320 Unclassified 2706
325 Ga0495687_001540 3300047443 Bacteria 20976
326 Ga0495687_098471 3300047443 Bacteria 1103
327 Ga0495686_0032262 3300047472 Bacteria 3391
328 Ga0495686_0066724 3300047472 Bacteria 2223
329 Ga0496126_0009290 3300048929 Bacteria 10474
330 Ga0501033_0262176 3300049570 Bacteria 1223
331 Ga0501217_049525 3300049661 Bacteria 1094
332 Ga0501241_002811 3300049758 Bacteria 3344
333 nmdc:mga08y16_10678_c1 3300050511 Bacteria 9638
334 Ga0500583_0000016 3300053092 Bacteria 144540
335 Ga0500568_0008466 3300053139 Bacteria 4951
336 Ga0500588_0133581 3300053146 Bacteria 886
337 Ga0500604_0008427 3300053151 Bacteria 2735
338 Ga0500622_0028955 3300053156 Bacteria 2915
339 Ga0500611_000013 3300053727 Bacteria 135447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049661 Ga0501217_049525 Ga0501217_049525_33_728 226
2 3300053146 Ga0500588_0133581 Ga0500588_0133581_172_864 230
3 3300013307 Ga0157372_10498973 Ga0157372_104989732 249
4 3300009093 Ga0105240_10000573 Ga0105240_1000057318 250
5 3300009174 Ga0105241_10010387 Ga0105241_100103873 250
6 3300009545 Ga0105237_10000143 Ga0105237_1000014393 250
7 3300010375 Ga0105239_10001492 Ga0105239_1000149213 250
8 3300025911 Ga0207654_10007269 Ga0207654_100072693 250
9 3300025913 Ga0207695_10000183 Ga0207695_1000018330 250
10 3300025914 Ga0207671_10000999 Ga0207671_1000099914 250
11 3300032004 Ga0307414_10024865 Ga0307414_100248652 250
12 3300005539 Ga0068853_100127875 Ga0068853_1001278751 251
13 3300005616 Ga0068852_100093382 Ga0068852_1000933822 251
14 3300009093 Ga0105240_10000093 Ga0105240_1000009388 251
15 3300009093 Ga0105240_10339305 Ga0105240_103393051 251
16 3300009174 Ga0105241_10073243 Ga0105241_100732432 251
17 3300009551 Ga0105238_10051968 Ga0105238_100519681 251
18 3300010375 Ga0105239_10000666 Ga0105239_1000066621 251
19 3300010375 Ga0105239_10815774 Ga0105239_108157741 251
20 3300013306 Ga0163162_10029065 Ga0163162_100290653 251
21 3300025904 Ga0207647_10072666 Ga0207647_100726662 251
22 3300025913 Ga0207695_10000135 Ga0207695_1000013552 251
23 3300025913 Ga0207695_10187213 Ga0207695_101872132 251
24 3300026041 Ga0207639_10011477 Ga0207639_100114771 251
25 3300026142 Ga0207698_10142072 Ga0207698_101420722 251
26 3300044706 Ga0466964_0083768 Ga0466964_0083768_398_1153 251
27 3300044765 Ga0466970_0263478 Ga0466970_0263478_133_888 251
28 3300046648 Ga0495611_0000312 Ga0495611_0000312_6428_7192 251
29 3300009093 Ga0105240_10000285 Ga0105240_1000028542 252
30 3300009545 Ga0105237_10162298 Ga0105237_101622982 252
31 3300025913 Ga0207695_10001087 Ga0207695_1000108715 252
32 3300025924 Ga0207694_10298567 Ga0207694_102985671 252
33 3300049570 Ga0501033_0262176 Ga0501033_0262176_23_781 252
34 3300013296 Ga0157374_10000029 Ga0157374_1000002964 253
35 3300014969 Ga0157376_10004445 Ga0157376_100044452 253
36 3300026118 Ga0207675_100774256 Ga0207675_1007742561 253
37 3300005337 Ga0070682_100000604 Ga0070682_10000060410 254
38 3300005341 Ga0070691_10000637 Ga0070691_100006377 254
39 3300005458 Ga0070681_10001921 Ga0070681_100019217 254
40 3300005530 Ga0070679_100001924 Ga0070679_1000019243 254
41 3300005547 Ga0070693_100118890 Ga0070693_1001188902 254
42 3300009093 Ga0105240_10000773 Ga0105240_1000077326 254
43 3300009174 Ga0105241_10000357 Ga0105241_100003576 254
44 3300013102 Ga0157371_10174205 Ga0157371_101742052 254
45 3300013104 Ga0157370_10000518 Ga0157370_1000051813 254
46 3300025911 Ga0207654_10000779 Ga0207654_100007799 254
47 3300025912 Ga0207707_10000110 Ga0207707_1000011027 254
48 3300025913 Ga0207695_10035617 Ga0207695_100356172 254
49 3300025917 Ga0207660_10002478 Ga0207660_100024785 254
50 3300025921 Ga0207652_10000265 Ga0207652_1000026521 254
51 3300025942 Ga0207689_10039681 Ga0207689_100396813 254
52 3300044658 Ga0466972_0000019 Ga0466972_0000019_92063_92905 254
53 3300044658 Ga0466972_0026691 Ga0466972_0026691_1202_1966 254
54 3300003322 rootL2_10004165 rootL2_100041652 255
55 3300005327 Ga0070658_10045948 Ga0070658_100459482 255
56 3300005327 Ga0070658_10161368 Ga0070658_101613682 255
57 3300005329 Ga0070683_100191766 Ga0070683_1001917662 255
58 3300005338 Ga0068868_100132562 Ga0068868_1001325621 255
59 3300005530 Ga0070679_100018144 Ga0070679_1000181444 255
60 3300005539 Ga0068853_100077239 Ga0068853_1000772392 255
61 3300005539 Ga0068853_100940179 Ga0068853_1009401791 255
62 3300005563 Ga0068855_100051012 Ga0068855_1000510123 255
63 3300005577 Ga0068857_100001405 Ga0068857_10000140510 255
64 3300005578 Ga0068854_100130690 Ga0068854_1001306902 255
65 3300005614 Ga0068856_100357548 Ga0068856_1003575482 255
66 3300005616 Ga0068852_100000475 Ga0068852_10000047511 255
67 3300005616 Ga0068852_100004963 Ga0068852_1000049632 255
68 3300005616 Ga0068852_100238019 Ga0068852_1002380192 255
69 3300005843 Ga0068860_100002087 Ga0068860_1000020871 255
70 3300009093 Ga0105240_10015765 Ga0105240_100157653 255
71 3300009545 Ga0105237_10001381 Ga0105237_100013814 255
72 3300009545 Ga0105237_10005465 Ga0105237_100054654 255
73 3300009545 Ga0105237_10122508 Ga0105237_101225082 255
74 3300009551 Ga0105238_10004053 Ga0105238_100040534 255
75 3300009551 Ga0105238_10090867 Ga0105238_100908672 255
76 3300010375 Ga0105239_10003273 Ga0105239_1000327311 255
77 3300013100 Ga0157373_10065306 Ga0157373_100653063 255
78 3300013102 Ga0157371_10017539 Ga0157371_100175393 255
79 3300013104 Ga0157370_10477767 Ga0157370_104777672 255
80 3300013105 Ga0157369_10041445 Ga0157369_100414454 255
81 3300013307 Ga0157372_10000975 Ga0157372_100009754 255
82 3300013307 Ga0157372_10094199 Ga0157372_100941992 255
83 3300025909 Ga0207705_10045386 Ga0207705_100453862 255
84 3300025909 Ga0207705_10262286 Ga0207705_102622861 255
85 3300025913 Ga0207695_10029861 Ga0207695_100298613 255
86 3300025914 Ga0207671_10002827 Ga0207671_100028273 255
87 3300025914 Ga0207671_10009247 Ga0207671_100092475 255
88 3300025914 Ga0207671_10081095 Ga0207671_100810952 255
89 3300025921 Ga0207652_10004215 Ga0207652_100042153 255
90 3300025924 Ga0207694_10034763 Ga0207694_100347632 255
91 3300025924 Ga0207694_10093901 Ga0207694_100939012 255
92 3300025949 Ga0207667_10002639 Ga0207667_1000263912 255
93 3300026041 Ga0207639_10064372 Ga0207639_100643724 255
94 3300026078 Ga0207702_10068943 Ga0207702_100689432 255
95 3300026078 Ga0207702_10141807 Ga0207702_101418072 255
96 3300026116 Ga0207674_10011772 Ga0207674_100117723 255
97 3300026142 Ga0207698_10001143 Ga0207698_100011433 255
98 3300026142 Ga0207698_10023537 Ga0207698_100235372 255
99 3300028381 Ga0268264_10015122 Ga0268264_100151225 255
100 3300046648 Ga0495611_0000099 Ga0495611_0000099_17329_18096 255
101 iso_pu_bacteria 2818991460 2819681331 255
102 iso_pu_bacteria 2929177148 2929179193 255
103 iso_pu_bacteria 2945977869 2945981598 255
104 iso_pu_bacteria 2946013367 2946018999 255
105 3300005459 Ga0068867_100085788 Ga0068867_1000857882 256
106 3300005547 Ga0070693_100309212 Ga0070693_1003092121 256
107 3300042007 Ga0439449_0005520 Ga0439449_0005520_3580_4350 256
108 3300042014 Ga0439457_012829 Ga0439457_012829_281_1051 256
109 3300042015 Ga0439462_0024745 Ga0439462_0024745_791_1561 256
110 3300003320 rootH2_10011302 rootH2_100113023 257
111 3300003354 JGI25160J50197_1014764 JGI25160J50197_10147642 257
112 3300003761 Ga0055535_1004269 Ga0055535_10042692 257
113 3300003771 Ga0055526_1008954 Ga0055526_10089542 257
114 3300003771 Ga0055526_1013697 Ga0055526_10136972 257
115 3300003790 Ga0055528_1000447 Ga0055528_100044712 257
116 3300003791 Ga0055530_10002747 Ga0055530_100027476 257
117 3300003794 Ga0055531_10000003 Ga0055531_1000000347 257
118 3300003794 Ga0055531_10027526 Ga0055531_100275262 257
119 3300005262 Ga0065165_1000012 Ga0065165_100001288 257
120 3300005327 Ga0070658_10064727 Ga0070658_100647272 257
121 3300005328 Ga0070676_10172357 Ga0070676_101723573 257
122 3300005329 Ga0070683_100234231 Ga0070683_1002342312 257
123 3300005333 Ga0070677_10056705 Ga0070677_100567052 257
124 3300005335 Ga0070666_10503375 Ga0070666_105033751 257
125 3300005336 Ga0070680_100001784 Ga0070680_1000017844 257
126 3300005336 Ga0070680_100019154 Ga0070680_1000191542 257
127 3300005337 Ga0070682_100001117 Ga0070682_1000011174 257
128 3300005341 Ga0070691_10000845 Ga0070691_100008456 257
129 3300005347 Ga0070668_100378995 Ga0070668_1003789952 257
130 3300005367 Ga0070667_100051100 Ga0070667_1000511002 257
131 3300005435 Ga0070714_100722451 Ga0070714_1007224511 257
132 3300005455 Ga0070663_100007879 Ga0070663_1000078791 257
133 3300005458 Ga0070681_10040611 Ga0070681_100406112 257
134 3300005530 Ga0070679_100002323 Ga0070679_1000023235 257
135 3300005530 Ga0070679_100029404 Ga0070679_1000294042 257
136 3300005539 Ga0068853_100007390 Ga0068853_1000073903 257
137 3300005548 Ga0070665_100577424 Ga0070665_1005774242 257
138 3300005563 Ga0068855_100003699 Ga0068855_1000036994 257
139 3300005563 Ga0068855_100024366 Ga0068855_1000243662 257
140 3300005563 Ga0068855_100108822 Ga0068855_1001088222 257
141 3300005563 Ga0068855_100168888 Ga0068855_1001688881 257
142 3300005614 Ga0068856_100045118 Ga0068856_1000451182 257
143 3300005617 Ga0068859_100001050 Ga0068859_1000010507 257
144 3300005719 Ga0068861_100500533 Ga0068861_1005005332 257
145 3300005843 Ga0068860_100046412 Ga0068860_1000464122 257
146 3300005843 Ga0068860_100203610 Ga0068860_1002036101 257
147 3300006237 Ga0097621_100116623 Ga0097621_1001166233 257
148 3300006358 Ga0068871_100041243 Ga0068871_1000412435 257
149 3300006931 Ga0097620_100001050 Ga0097620_1000010507 257
150 3300009093 Ga0105240_10003844 Ga0105240_100038448 257
151 3300009093 Ga0105240_10141946 Ga0105240_101419462 257
152 3300009093 Ga0105240_10146725 Ga0105240_101467252 257
153 3300009093 Ga0105240_10281816 Ga0105240_102818162 257
154 3300009174 Ga0105241_10001435 Ga0105241_100014357 257
155 3300009545 Ga0105237_10002802 Ga0105237_1000280213 257
156 3300009553 Ga0105249_10027548 Ga0105249_100275482 257
157 3300010375 Ga0105239_10000267 Ga0105239_1000026765 257
158 3300010375 Ga0105239_10002201 Ga0105239_100022018 257
159 3300013100 Ga0157373_10127982 Ga0157373_101279821 257
160 3300013102 Ga0157371_10004968 Ga0157371_1000496810 257
161 3300013102 Ga0157371_10119535 Ga0157371_101195352 257
162 3300013102 Ga0157371_10177514 Ga0157371_101775141 257
163 3300013102 Ga0157371_10439459 Ga0157371_104394591 257
164 3300013104 Ga0157370_10002553 Ga0157370_100025538 257
165 3300013104 Ga0157370_10016434 Ga0157370_100164343 257
166 3300013104 Ga0157370_10055163 Ga0157370_100551632 257
167 3300013105 Ga0157369_10016679 Ga0157369_100166797 257
168 3300013105 Ga0157369_10152675 Ga0157369_101526752 257
169 3300013297 Ga0157378_10097893 Ga0157378_100978932 257
170 3300013297 Ga0157378_10252609 Ga0157378_102526091 257
171 3300013306 Ga0163162_10047927 Ga0163162_100479272 257
172 3300013306 Ga0163162_10274560 Ga0163162_102745602 257
173 3300013307 Ga0157372_10005839 Ga0157372_100058393 257
174 3300013307 Ga0157372_10028977 Ga0157372_100289772 257
175 3300013307 Ga0157372_11294930 Ga0157372_112949301 257
176 3300013308 Ga0157375_10094850 Ga0157375_100948503 257
177 3300013308 Ga0157375_10415293 Ga0157375_104152932 257
178 3300014325 Ga0163163_10283614 Ga0163163_102836142 257
179 3300014326 Ga0157380_10017530 Ga0157380_100175304 257
180 3300014745 Ga0157377_10004667 Ga0157377_100046672 257
181 3300025242 Ga0209258_100404 Ga0209258_10040430 257
182 3300025254 Ga0209148_1000550 Ga0209148_100055011 257
183 3300025273 Ga0209673_1000446 Ga0209673_100044620 257
184 3300025273 Ga0209673_1039054 Ga0209673_10390542 257
185 3300025295 Ga0209564_1001973 Ga0209564_10019734 257
186 3300025295 Ga0209564_1002721 Ga0209564_100272113 257
187 3300025295 Ga0209564_1017892 Ga0209564_10178922 257
188 3300025297 Ga0209758_1001411 Ga0209758_100141113 257
189 3300025297 Ga0209758_1007924 Ga0209758_10079246 257
190 3300025298 Ga0209050_1001619 Ga0209050_10016196 257
191 3300025302 Ga0207426_1000754 Ga0207426_100075429 257
192 3300025302 Ga0207426_1042027 Ga0207426_10420272 257
193 3300025303 Ga0209051_1048470 Ga0209051_10484701 257
194 3300025304 Ga0209257_1000008 Ga0209257_1000008259 257
195 3300025304 Ga0209257_1000686 Ga0209257_100068624 257
196 3300025904 Ga0207647_10022862 Ga0207647_100228622 257
197 3300025909 Ga0207705_10001125 Ga0207705_100011253 257
198 3300025909 Ga0207705_10015239 Ga0207705_100152392 257
199 3300025911 Ga0207654_10002363 Ga0207654_100023634 257
200 3300025912 Ga0207707_10002050 Ga0207707_100020505 257
201 3300025912 Ga0207707_10225236 Ga0207707_102252362 257
202 3300025913 Ga0207695_10139067 Ga0207695_101390672 257
203 3300025914 Ga0207671_10027565 Ga0207671_100275652 257
204 3300025917 Ga0207660_10002955 Ga0207660_100029554 257
205 3300025917 Ga0207660_10025857 Ga0207660_100258571 257
206 3300025921 Ga0207652_10000475 Ga0207652_100004752 257
207 3300025921 Ga0207652_10004173 Ga0207652_100041738 257
208 3300025925 Ga0207650_10191272 Ga0207650_101912721 257
209 3300025925 Ga0207650_10359824 Ga0207650_103598241 257
210 3300025944 Ga0207661_10058673 Ga0207661_100586733 257
211 3300025949 Ga0207667_10002780 Ga0207667_1000278016 257
212 3300025949 Ga0207667_10126187 Ga0207667_101261872 257
213 3300025949 Ga0207667_10154783 Ga0207667_101547831 257
214 3300025949 Ga0207667_10225612 Ga0207667_102256122 257
215 3300026041 Ga0207639_10023220 Ga0207639_100232202 257
216 3300026041 Ga0207639_10533215 Ga0207639_105332152 257
217 3300026067 Ga0207678_10009662 Ga0207678_100096624 257
218 3300026078 Ga0207702_10062935 Ga0207702_100629352 257
219 3300026089 Ga0207648_10050231 Ga0207648_100502313 257
220 3300026089 Ga0207648_10260550 Ga0207648_102605502 257
221 3300026142 Ga0207698_10535176 Ga0207698_105351762 257
222 3300026142 Ga0207698_10719876 Ga0207698_107198762 257
223 3300028381 Ga0268264_10008645 Ga0268264_100086453 257
224 3300028794 Ga0307515_10000001 Ga0307515_100000012794 257
225 3300032004 Ga0307414_10442666 Ga0307414_104426662 257
226 3300037312 Ga0395899_0000248 Ga0395899_0000248_53838_54620 257
227 3300037312 Ga0395899_0005054 Ga0395899_0005054_2550_3344 257
228 3300037312 Ga0395899_0080548 Ga0395899_0080548_165_959 257
229 3300037418 Ga0395900_0003094 Ga0395900_0003094_919_1701 257
230 3300037418 Ga0395900_0100488 Ga0395900_0100488_424_1218 257
231 3300037466 Ga0395898_0000488 Ga0395898_0000488_57848_58630 257
232 3300037466 Ga0395898_0011250 Ga0395898_0011250_4661_5455 257
233 3300037466 Ga0395898_0564637 Ga0395898_0564637_143_937 257
234 3300037471 Ga0395905_0100781 Ga0395905_0100781_19_813 257
235 3300038443 Ga0395901_0008350 Ga0395901_0008350_3280_4062 257
236 3300038443 Ga0395901_0120088 Ga0395901_0120088_538_1332 257
237 3300038443 Ga0395901_0850003 Ga0395901_0850003_43_831 257
238 3300041460 Ga0451802_0551381 Ga0451802_0551381_488_1261 257
239 3300042004 Ga0439445_0037539 Ga0439445_0037539_326_1099 257
240 3300042006 Ga0439432_051794 Ga0439432_051794_374_1147 257
241 3300042014 Ga0439457_012177 Ga0439457_012177_521_1294 257
242 3300042128 Ga0450897_000519 Ga0450897_000519_432_1205 257
243 3300042134 Ga0450898_001295 Ga0450898_001295_514_1287 257
244 3300042135 Ga0450899_005796 Ga0450899_005796_358_1131 257
245 3300044765 Ga0466970_0001553 Ga0466970_0001553_4035_4820 257
246 3300046616 Ga0495668_0002398 Ga0495668_0002398_14049_14822 257
247 3300047320 Ga0495672_0043349 Ga0495672_0043349_101_889 257
248 3300047443 Ga0495687_098471 Ga0495687_098471_300_1082 257
249 3300047472 Ga0495686_0032262 Ga0495686_0032262_1592_2380 257
250 3300047472 Ga0495686_0066724 Ga0495686_0066724_873_1658 257
251 3300048929 Ga0496126_0009290 Ga0496126_0009290_6816_7604 257
252 3300049758 Ga0501241_002811 Ga0501241_002811_1304_2092 257
253 3300053092 Ga0500583_0000016 Ga0500583_0000016_137249_138031 257
254 3300053139 Ga0500568_0008466 Ga0500568_0008466_3246_4022 257
255 3300053151 Ga0500604_0008427 Ga0500604_0008427_1894_2667 257
256 3300053727 Ga0500611_000013 Ga0500611_000013_37371_38147 257
257 iso_pu_bacteria 2898713307 2898715117 257
258 2162886011 MRS1b_contig_2394569 MRS1b_0780.00000950 258
259 3300005290 Ga0065712_10002292 Ga0065712_100022923 258
260 3300005334 Ga0068869_100003811 Ga0068869_1000038114 258
261 3300005335 Ga0070666_10000375 Ga0070666_1000037522 258
262 3300005335 Ga0070666_10003275 Ga0070666_100032759 258
263 3300005353 Ga0070669_100020946 Ga0070669_1000209462 258
264 3300005354 Ga0070675_100006130 Ga0070675_1000061301 258
265 3300005364 Ga0070673_100106037 Ga0070673_1001060372 258
266 3300005367 Ga0070667_100001870 Ga0070667_1000018705 258
267 3300005539 Ga0068853_100390364 Ga0068853_1003903642 258
268 3300005548 Ga0070665_100000002 Ga0070665_100000002123 258
269 3300005616 Ga0068852_100077979 Ga0068852_1000779792 258
270 3300005617 Ga0068859_100000086 Ga0068859_10000008625 258
271 3300005617 Ga0068859_100003161 Ga0068859_1000031613 258
272 3300005618 Ga0068864_100008169 Ga0068864_1000081692 258
273 3300005719 Ga0068861_100020925 Ga0068861_1000209254 258
274 3300005834 Ga0068851_10003379 Ga0068851_100033796 258
275 3300005840 Ga0068870_10191382 Ga0068870_101913822 258
276 3300005841 Ga0068863_100022843 Ga0068863_1000228434 258
277 3300005842 Ga0068858_100028173 Ga0068858_1000281732 258
278 3300005843 Ga0068860_100000019 Ga0068860_10000001970 258
279 3300005843 Ga0068860_100004278 Ga0068860_10000427811 258
280 3300005844 Ga0068862_100018946 Ga0068862_1000189462 258
281 3300005844 Ga0068862_100520442 Ga0068862_1005204422 258
282 3300006931 Ga0097620_100000086 Ga0097620_10000008658 258
283 3300006931 Ga0097620_100003161 Ga0097620_1000031613 258
284 3300009093 Ga0105240_10000607 Ga0105240_1000060713 258
285 3300009094 Ga0111539_10002802 Ga0111539_100028028 258
286 3300009098 Ga0105245_10034065 Ga0105245_100340652 258
287 3300009174 Ga0105241_10001385 Ga0105241_1000138510 258
288 3300009177 Ga0105248_10353283 Ga0105248_103532832 258
289 3300009545 Ga0105237_10000083 Ga0105237_1000008342 258
290 3300009545 Ga0105237_10001891 Ga0105237_100018918 258
291 3300009545 Ga0105237_10011230 Ga0105237_100112309 258
292 3300009551 Ga0105238_10012810 Ga0105238_100128104 258
293 3300009553 Ga0105249_10002367 Ga0105249_100023678 258
294 3300010375 Ga0105239_10544878 Ga0105239_105448782 258
295 3300011119 Ga0105246_10001658 Ga0105246_100016588 258
296 3300013296 Ga0157374_10482627 Ga0157374_104826272 258
297 3300013297 Ga0157378_10053152 Ga0157378_100531522 258
298 3300013306 Ga0163162_10000658 Ga0163162_100006585 258
299 3300013306 Ga0163162_10021488 Ga0163162_100214883 258
300 3300013307 Ga0157372_10033393 Ga0157372_100333933 258
301 3300014325 Ga0163163_10133134 Ga0163163_101331342 258
302 3300014326 Ga0157380_10035271 Ga0157380_100352714 258
303 3300014969 Ga0157376_10148079 Ga0157376_101480792 258
304 3300025271 Ga0207666_1006282 Ga0207666_10062822 258
305 3300025903 Ga0207680_10000117 Ga0207680_100001177 258
306 3300025903 Ga0207680_10003332 Ga0207680_100033322 258
307 3300025911 Ga0207654_10001156 Ga0207654_1000115611 258
308 3300025911 Ga0207654_10001987 Ga0207654_100019873 258
309 3300025913 Ga0207695_10001198 Ga0207695_100011982 258
310 3300025914 Ga0207671_10001490 Ga0207671_100014908 258
311 3300025914 Ga0207671_10003360 Ga0207671_1000336010 258
312 3300025914 Ga0207671_10017192 Ga0207671_100171922 258
313 3300025923 Ga0207681_10222665 Ga0207681_102226652 258
314 3300025926 Ga0207659_10049039 Ga0207659_100490392 258
315 3300025927 Ga0207687_10223744 Ga0207687_102237442 258
316 3300025940 Ga0207691_10139385 Ga0207691_101393851 258
317 3300025942 Ga0207689_10000260 Ga0207689_1000026017 258
318 3300025942 Ga0207689_10208784 Ga0207689_102087842 258
319 3300025960 Ga0207651_10028385 Ga0207651_100283853 258
320 3300025961 Ga0207712_10005106 Ga0207712_100051062 258
321 3300025986 Ga0207658_10002432 Ga0207658_100024328 258
322 3300026035 Ga0207703_10065061 Ga0207703_100650614 258
323 3300026041 Ga0207639_10216160 Ga0207639_102161602 258
324 3300026088 Ga0207641_10000061 Ga0207641_10000061130 258
325 3300026089 Ga0207648_10188834 Ga0207648_101888342 258
326 3300026095 Ga0207676_10056828 Ga0207676_100568282 258
327 3300026116 Ga0207674_10039895 Ga0207674_100398952 258
328 3300026118 Ga0207675_100011646 Ga0207675_1000116463 258
329 3300026142 Ga0207698_10203226 Ga0207698_102032262 258
330 3300027907 Ga0207428_10054775 Ga0207428_100547752 258
331 3300028379 Ga0268266_10000022 Ga0268266_10000022313 258
332 3300028380 Ga0268265_10015341 Ga0268265_100153415 258
333 3300028381 Ga0268264_10000115 Ga0268264_1000011593 258
334 3300028381 Ga0268264_10002707 Ga0268264_100027073 258
335 3300028786 Ga0307517_10069335 Ga0307517_100693352 258
336 3300028786 Ga0307517_10132062 Ga0307517_101320622 258
337 3300031616 Ga0307508_10003309 Ga0307508_100033093 258
338 3300033180 Ga0307510_10005177 Ga0307510_100051773 258
339 3300046507 Ga0495606_0008992 Ga0495606_0008992_123_908 258
340 3300046524 Ga0495648_0001367 Ga0495648_0001367_18664_19455 258
341 3300046648 Ga0495611_0026870 Ga0495611_0026870_660_1451 258
342 3300047443 Ga0495687_001540 Ga0495687_001540_13032_13817 258
343 3300050511 nmdc:mga08y16_10678_c1 nmdc:mga08y16_10678_c1_8035_8811 258
344 3300053156 Ga0500622_0028955 Ga0500622_0028955_1548_2339 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

192

271

0.98

PF00072

Response_reg

Response regulator receiver domain

26

137

0.96

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

231

270

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9755 4 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9703 4 124
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9585 4 120
1udr-assembly1.cif.gz_C chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4) 0.9577 4 117
1m5t-assembly1.cif.gz_A crystal structure of the response regulator divk 0.9571 4 120
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9677 202 252 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9578 196 251 1.10.10.60
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9565 1 129 3.40.50.2300
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9563 4 120 3.40.50.2300
3n53B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9521 4 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A355E8K7-F1-model_v4 Response regulatory domain-containing protein 0.9821 1 124 GO:0000160
GO:0016301
AF-A0A6P0YJ19-F1-model_v4 Response regulator 0.9786 2 122 GO:0000160
AF-A0A8A5VXE5-F1-model_v4 deleted 0.9766 1 127
AF-A0A4P8HY21-F1-model_v4 CheY-like chemotaxis protein 0.9714 2 129 GO:0000160
AF-A0A6P0YJ19-F1-model_v4 Response regulator 0.9629 2 122 GO:0000160

Feature Viewer

pLDDT pTM Quality
88.08 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map