F415785

General Info

Members Datasets Scaffolds Average Seq Length
343 280 686 358

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2744054657|2745169074
Length 399
Sequence KWKSAIAAFHFSFSVTKGTMSEWGLFLTPKYNVVTTSKKVNLTMNITSFTDNKPLIYSLRLEEMKQWLEENGEKAFRAAQIFDWLYVKRVTAFEEMSNLSKALRDKLNEEFRINALTEITRQESADGTIKFLFQLIDGHAIETVIMRHNYGNSVCVTTQVGCRIGCTFCASTLGGLKRNLDAGEIVAQVLQAQRALDADEGRVSHVVVMGIGEPFENFEPLLSFLNIINDNRGLNIGQRHITVSTSGIVPKIYEFAERGGQVNLAISLHAPNTELRTKLMPINRGFPLEKLMEACRQYIAKTGRRISFEYGLFGGQNDQPHHAEELAELIGDMLCHVNLIPVNYVPERDYVRTARNDIFTFKRILDDRGINVTIRREHGSDIAAACGQLRAQHAKETAG

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
31 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
35 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
36 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
41 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
42 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
43 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
47 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
48 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
49 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
50 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
56 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
66 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
89 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
90 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
91 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
92 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
93 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
94 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
95 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
96 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
97 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
98 2554235283 Bacillus safensis VK Isolate Rhizosphere
99 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
100 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
101 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
102 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
103 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
104 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
105 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
106 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
107 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
108 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
109 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
110 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
111 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
112 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
113 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
114 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
115 2643221729 Bacillus sp. Root11 Isolate Unclassified
116 2643221730 Bacillus sp. Root131 Isolate Unclassified
117 2643221731 Bacillus sp. Root147 Isolate Unclassified
118 2643221732 Bacillus sp. Root239 Isolate Unclassified
119 2643221735 Bacillus sp. Root920 Isolate Unclassified
120 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
121 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
122 2671180694 Paenibacillus sp. A3 Isolate Unclassified
123 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
124 2684622632 Bacillus cereus 905 Isolate Unclassified
125 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
126 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
127 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
128 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
129 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
130 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
131 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
132 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
133 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
134 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
135 2738541295 Bacillus sp. OK085 Isolate Unclassified
136 2738541358 Bacillus sp. OV752 Isolate Unclassified
137 2738543006 Bacillus sp. OK077 Isolate Unclassified
138 2738543017 Bacillus sp. OV186 Isolate Unclassified
139 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
140 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
141 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
142 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
143 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
144 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
145 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
146 2811994870 Bacillus sp. JB4 Isolate Unclassified
147 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
148 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
149 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
150 2818991441 Niallia circulans 3243 Isolate Rhizosphere
151 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
152 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
153 2818991459 Paenibacillus sp. 597 Isolate Unclassified
154 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
155 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
156 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
157 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
158 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
159 2842682962 Bacillus sp. R-72492 Isolate Unclassified
160 2842882022 Bacillus sp. R-71893 Isolate Unclassified
161 2849139964 Bacillus sp. R-71875 Isolate Unclassified
162 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
163 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
164 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
165 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
166 2857472729 Cohnella sp. R-74144 Isolate Unclassified
167 2857581216 Bacillus sp. R-71922 Isolate Unclassified
168 2857586860 Bacillus sp. R-71935 Isolate Unclassified
169 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
170 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
171 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
172 2860837431 Bacillus sp. WR11 Isolate Unclassified
173 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
174 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
175 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
176 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
177 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
178 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
179 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
180 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
181 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
182 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
183 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
184 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
185 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
186 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
187 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
188 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
189 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
190 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
191 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
192 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
193 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
194 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
195 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
196 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
197 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
198 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
199 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
200 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
201 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
202 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
203 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
204 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
205 2919720352 Priestia megaterium 4340 Isolate Unclassified
206 2919726948 Bacillus pumilus 4489 Isolate Unclassified
207 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
208 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
209 2929004312 Priestia megaterium 1104 Isolate Unclassified
210 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
211 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
212 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
213 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
214 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
215 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
216 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
217 2938917290 Bacillus sp. CR71 Isolate Unclassified
218 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
219 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
220 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
221 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
222 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
223 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
224 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
225 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
226 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
227 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
228 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
229 2965761152 Bacillus sp. COPE52 Isolate Unclassified
230 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
231 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
232 2969141011 Bacillus velezensis MH25 Isolate Unclassified
233 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
234 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
235 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
236 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
237 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
238 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
239 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
240 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
241 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
242 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
243 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
244 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
245 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
246 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
247 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
248 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
249 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
250 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
251 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
252 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
253 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
254 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
255 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
256 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
257 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
258 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
259 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
260 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
261 8022653035 Bacillus sp. Rc4 Isolate Unclassified
262 8022792930 Bacillus sp. Xin Isolate Rhizosphere
263 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
264 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
265 8023438354 Bacillus sp. BH2 Isolate Unclassified
266 8023444577 Bacillus sp. BH32 Isolate Unclassified
267 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
268 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
269 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
270 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
271 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
272 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
273 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
274 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
275 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
276 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
277 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
278 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
279 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
280 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 37.9
Metatranscriptomes 5.83
Isolates 56.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 13.12
Nodule 0.58
Rhizoplane 6.41
Rhizosphere 40.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002605 3300002987 Bacteria 6759
2 JGI25159J45721_1003855 3300002987 Bacteria 5147
3 JGI25151J46595_10000132 3300003187 Bacteria 99442
4 JGI25151J46595_10007661 3300003187 Bacteria 5266
5 JGI25151J46595_10035463 3300003187 Bacteria 1894
6 JGI25151J46595_10048108 3300003187 Bacteria 1477
7 JGI25151J46595_10056065 3300003187 Bacteria 1295
8 rootH1_10001147 3300003316 Bacteria 54261
9 rootH2_10021408 3300003320 Bacteria 7120
10 rootL2_10074625 3300003322 Bacteria 23985
11 rootH1_10102978 3300003323 Bacteria 4638
12 Ga0006562J51391_1000324 3300003578 Bacteria 33632
13 Ga0006562J51391_1001252 3300003578 Bacteria 15410
14 Ga0006562J51391_1015159 3300003578 Bacteria 5247
15 Ga0006562J51391_1061042 3300003578 Bacteria 2069
16 Ga0055538_1000312 3300003751 Bacteria 23138
17 Ga0055538_1000489 3300003751 Bacteria 14440
18 Ga0055532_1000004 3300003758 Bacteria 471824
19 Ga0055532_1001546 3300003758 Bacteria 6196
20 Ga0055535_1001343 3300003761 Bacteria 12987
21 Ga0055536_1010915 3300003781 Bacteria 3542
22 Ga0055528_1002612 3300003790 Bacteria 9541
23 Ga0055541_1000214 3300003841 Bacteria 24188
24 Ga0055541_1006253 3300003841 Bacteria 2029
25 Ga0070682_100166467 3300005337 Bacteria 1528
26 Ga0105244_10007983 3300009036 Bacteria 6662
27 Ga0105244_10015772 3300009036 Bacteria 4324
28 Ga0105250_10000710 3300009092 Bacteria 20530
29 Ga0105245_10038299 3300009098 Bacteria 4266
30 Ga0105243_10002974 3300009148 Bacteria 14002
31 Ga0209784_100041 3300025224 Bacteria 228573
32 Ga0209784_100184 3300025224 Bacteria 50021
33 Ga0209566_100054 3300025225 Bacteria 221422
34 Ga0209566_100154 3300025225 Bacteria 78286
35 Ga0209566_100568 3300025225 Bacteria 24100
36 Ga0209147_100010 3300025229 Bacteria 741391
37 Ga0209147_100082 3300025229 Bacteria 194153
38 Ga0209147_100147 3300025229 Bacteria 103478
39 Ga0209147_103244 3300025229 Bacteria 3298
40 Ga0209130_1002308 3300025284 Bacteria 9757
41 Ga0209130_1002320 3300025284 Bacteria 9727
42 Ga0209130_1002942 3300025284 Bacteria 7773
43 Ga0209675_1006526 3300025291 Bacteria 4658
44 Ga0209676_1000671 3300025292 Bacteria 48631
45 Ga0209676_1001257 3300025292 Bacteria 26488
46 Ga0209676_1007828 3300025292 Bacteria 4916
47 Ga0209676_1032443 3300025292 Bacteria 1571
48 Ga0209025_1000001 3300025294 Bacteria 1888151
49 Ga0209025_1001046 3300025294 Bacteria 40531
50 Ga0209025_1001474 3300025294 Bacteria 30636
51 Ga0209025_1001604 3300025294 Bacteria 28407
52 Ga0209025_1001829 3300025294 Bacteria 25005
53 Ga0209025_1005803 3300025294 Bacteria 9900
54 Ga0209025_1005920 3300025294 Bacteria 9748
55 Ga0209025_1005986 3300025294 Bacteria 9664
56 Ga0209025_1009883 3300025294 Bacteria 6565
57 Ga0209025_1048559 3300025294 Bacteria 1719
58 Ga0209025_1060210 3300025294 Bacteria 1427
59 Ga0207426_1010545 3300025302 Bacteria 3581
60 Ga0207696_1000943 3300025711 Bacteria 17794
61 Ga0207696_1002435 3300025711 Bacteria 9133
62 Ga0207655_1006507 3300025728 Bacteria 7728
63 Ga0207713_1000974 3300025735 Bacteria 25301
64 Ga0209371_1004392 3300027312 Bacteria 6175
65 Ga0237817_10064 3300030083 Bacteria 35967
66 Ga0237817_10223 3300030083 Bacteria 14523
67 Ga0268256_1004133 3300030500 Bacteria 6175
68 Ga0307416_100127039 3300032002 Bacteria 2286
69 Ga0237819_00110 3300038705 Bacteria 30255
70 Ga0237819_02962 3300038705 Bacteria 3169
71 Ga0400483_156723 3300039062 Bacteria 1723
72 Ga0439436_0003330 3300041404 Bacteria 4874
73 Ga0439439_0006380 3300041406 Bacteria 2726
74 Ga0439433_0002939 3300041999 Bacteria 3649
75 Ga0439449_0000182 3300042007 Bacteria 21833
76 Ga0439462_0001637 3300042015 Bacteria 5040
77 Ga0439462_0007517 3300042015 Bacteria 2729
78 Ga0466969_0027164 3300044656 Bacteria 2931
79 Ga0466961_0051435 3300044693 Bacteria 2631
80 Ga0466959_0003132 3300045049 Bacteria 10724
81 Ga0466967_0000014 3300045976 Bacteria 99206
82 Ga0495603_0023369 3300046455 Bacteria 3741
83 Ga0495590_0053536 3300046457 Bacteria 1409
84 Ga0495654_0032729 3300046530 Bacteria 2635
85 Ga0495622_0011375 3300046557 Bacteria 4111
86 Ga0495661_0064973 3300046665 Bacteria 2151
87 Ga0495626_0067709 3300048091 Bacteria 1612
88 Ga0496100_0000498 3300048903 Bacteria 18867
89 Ga0496101_0000571 3300048904 Bacteria 22550
90 Ga0496102_0002229 3300048905 Bacteria 16619
91 Ga0496103_0000697 3300048906 Bacteria 24934
92 Ga0496103_0021469 3300048906 Bacteria 3885
93 Ga0496104_0010074 3300048907 Bacteria 8437
94 Ga0496105_0001675 3300048908 Bacteria 15800
95 Ga0496106_0000192 3300048909 Bacteria 43140
96 Ga0496107_0000406 3300048910 Bacteria 23295
97 Ga0496108_0000290 3300048911 Bacteria 43303
98 Ga0496109_0001566 3300048912 Bacteria 19050
99 Ga0496110_0000255 3300048913 Bacteria 34630
100 Ga0496110_0001866 3300048913 Bacteria 15570
101 Ga0496111_0000587 3300048914 Bacteria 19083
102 Ga0496111_0001283 3300048914 Bacteria 14070
103 Ga0496112_0001734 3300048915 Bacteria 17071
104 Ga0496112_0090630 3300048915 Bacteria 3026
105 Ga0496113_0013007 3300048916 Bacteria 5615
106 Ga0496116_0002109 3300048919 Bacteria 21219
107 Ga0496116_0003533 3300048919 Bacteria 15388
108 Ga0496116_0025664 3300048919 Bacteria 4327
109 Ga0496116_0070116 3300048919 Bacteria 2226
110 Ga0496117_0009797 3300048920 Bacteria 8834
111 Ga0496117_0013711 3300048920 Bacteria 7043
112 Ga0496117_0045964 3300048920 Bacteria 3146
113 Ga0496118_0052381 3300048921 Bacteria 3113
114 Ga0496119_0000166 3300048922 Bacteria 92117
115 Ga0496119_0002606 3300048922 Bacteria 19566
116 Ga0496119_0024913 3300048922 Bacteria 4193
117 Ga0496120_0000406 3300048923 Bacteria 69216
118 Ga0496120_0015290 3300048923 Bacteria 5071
119 Ga0496121_0076429 3300048924 Bacteria 2669
120 Ga0496122_0013662 3300048925 Bacteria 7925
121 Ga0496122_0031285 3300048925 Bacteria 4434
122 Ga0496122_0051970 3300048925 Bacteria 3107
123 Ga0496123_0027817 3300048926 Bacteria 4201
124 Ga0496123_0110797 3300048926 Bacteria 1570
125 Ga0496124_0000748 3300048927 Bacteria 53309
126 Ga0496124_0013597 3300048927 Bacteria 7936
127 Ga0496124_0092373 3300048927 Bacteria 2465
128 Ga0496124_0098401 3300048927 Bacteria 2374
129 Ga0496125_0004997 3300048928 Bacteria 14974
130 Ga0496125_0015416 3300048928 Bacteria 7396
131 Ga0496125_0157690 3300048928 Bacteria 1547
132 Ga0496126_0005500 3300048929 Bacteria 14439
133 Ga0496126_0028610 3300048929 Bacteria 5308
134 Ga0501343_000307 3300049132 Bacteria 2755
135 Ga0501305_005241 3300049161 Bacteria 1562
136 Ga0501305_005702 3300049161 Bacteria 1520
137 Ga0501305_008345 3300049161 Bacteria 1338
138 Ga0501311_001367 3300049527 Bacteria 2093
139 Ga0501311_006817 3300049527 Bacteria 1299
140 Ga0501312_000973 3300049528 Bacteria 2634
141 Ga0501312_005174 3300049528 Bacteria 1574
142 Ga0501315_000603 3300049531 Bacteria 2599
143 Ga0501316_000339 3300049532 Bacteria 3066
144 Ga0501318_008005 3300049534 Bacteria 1119
145 Ga0501321_001166 3300049537 Bacteria 2010
146 Ga0501324_002892 3300049540 Bacteria 1281
147 Ga0501327_00729 3300049543 Bacteria 1420
148 Ga0501335_000132 3300049551 Bacteria 3706
149 Ga0501336_000808 3300049552 Bacteria 1698
150 Ga0501217_013653 3300049661 Bacteria 1825
151 2745169074 2744054657 Bacteria 5016802
152 2511177219 2510917027 Bacteria 5287437
153 2511699475 2511231119 Bacteria 4019861
154 2512640838 2512564013 Bacteria 6286191
155 2512734697 2512564039 Bacteria 8739048
156 2524186434 2524023129 Bacteria 6762600
157 2545556312 2545555800 Bacteria 4222588
158 2550900950 2548877040 Bacteria 7507281
159 2553391033 2551306519 Bacteria 5465154
160 2555469159 2554235283 Bacteria 3683090
161 2563927098 2563366752 Bacteria 4961801
162 2571532688 2571042143 Bacteria 6986194
163 2573040823 2571042588 Bacteria 5045676
164 2578336776 2576861424 Bacteria 5270569
165 2578929744 2576861599 Bacteria 4217202
166 2580929972 2579778775 Bacteria 5360914
167 2587737999 2585428059 Bacteria 8696589
168 2595089147 2593339131 Bacteria 5116855
169 2595319391 2593339198 Bacteria 7267884
170 2600198124 2599185353 Bacteria 2219443
171 2600400896 2600254943 Bacteria 2613887
172 2601638324 2600255286 Bacteria 5390125
173 2621274986 2619619294 Bacteria 5575484
174 2631982719 2630968484 Bacteria 3876276
175 2643738160 2643221543 Bacteria 6628015
176 2644423652 2643221676 Bacteria 8119172
177 2644705241 2643221729 Bacteria 6621700
178 2644709934 2643221730 Bacteria 6523787
179 2644716078 2643221731 Bacteria 5623886
180 2644724052 2643221732 Bacteria 5756404
181 2644739859 2643221735 Bacteria 3676263
182 2651532886 2648501850 Bacteria 3975476
183 2672335055 2671180330 Bacteria 5521719
184 2673819928 2671180694 Bacteria 7506943
185 2674419778 2671180844 Bacteria 4164150
186 2685151829 2684622632 Bacteria 5380049
187 2686996752 2684623153 Bacteria 3878815
188 2687498055 2687453109 Bacteria 3860091
189 2695627425 2695420354 Bacteria 3922431
190 2698321335 2695420987 Bacteria 6152737
191 2705995775 2703719227 Bacteria 5631989
192 2717916780 2716884898 Bacteria 3928789
193 2721506995 2718218445 Bacteria 5113413
194 2723604796 2721755693 Bacteria 6126117
195 2728532541 2728368933 Bacteria 7044283
196 2730135434 2728369359 Bacteria 5621728
197 2738812870 2738541295 Bacteria 5730091
198 2739154969 2738541358 Bacteria 5932299
199 2739207659 2738543006 Bacteria 5904091
200 2739268621 2738543017 Bacteria 4271950
201 2753809763 2751185905 Bacteria 6142767
202 2757564901 2757320391 Bacteria 4746095
203 2777764130 2775507177 Bacteria 4384303
204 2777836934 2775507192 Bacteria 4622234
205 2791212267 2788500588 Bacteria 4584915
206 2802437051 2802428803 Bacteria 5806948
207 2809054953 2808606399 Bacteria 4021018
208 2812315893 2811994870 Bacteria 3776934
209 2816863932 2816332186 Bacteria 5331395
210 2817479837 2816332295 Bacteria 4352468
211 2817619606 2816332336 Bacteria 5207640
212 2819567658 2818991441 Bacteria 5062707
213 2819581052 2818991443 Bacteria 6598732
214 2819625880 2818991451 Bacteria 4697364
215 2819670298 2818991459 Bacteria 8736032
216 2819709550 2818991465 Bacteria 5388835
217 2819724652 2818991468 Bacteria 3723169
218 2821114536 2821111986 Bacteria 6894338
219 2823527892 2823526263 Bacteria 3765752
220 2831906950 2831905167 Bacteria 3319172
221 2842685172 2842682962 Bacteria 5589973
222 2842884195 2842882022 Bacteria 6158489
223 2849140846 2849139964 Bacteria 5613304
224 2857360077 2857357740 Bacteria 9937880
225 2857457088 2857453340 Bacteria 8090534
226 2857462206 2857460504 Bacteria 5194327
227 2857467078 2857465823 Bacteria 6772595
228 2857473083 2857472729 Bacteria 6568124
229 2857584311 2857581216 Bacteria 5522813
230 2857588650 2857586860 Bacteria 4354574
231 2857592994 2857591370 Bacteria 6569758
232 2857605081 2857604169 Bacteria 5111450
233 2857611830 2857609550 Bacteria 3753890
234 2860839144 2860837431 Bacteria 4202080
235 2864737571 2864733723 Bacteria 6770668
236 2865000086 2864997549 Bacteria 5139696
237 2865004226 2865002811 Bacteria 6333767
238 2877770253 2877768649 Bacteria 3957164
239 2880171256 2880169592 Bacteria 3900066
240 2881637966 2881636855 Bacteria 5205297
241 2885527498 2885526491 Bacteria 7164189
242 2888582647 2888578766 Bacteria 6743310
243 2889046690 2889042446 Bacteria 7618936
244 2889055140 2889049205 Bacteria 7524325
245 2889280707 2889276214 Bacteria 5979355
246 2889296331 2889295896 Bacteria 4704906
247 2897111274 2897109615 Bacteria 4009619
248 2898907466 2898907183 Bacteria 4067722
249 2904114929 2904113452 Bacteria 7796941
250 2904163342 2904162308 Bacteria 7086713
251 2904493511 2904490793 Bacteria 7046938
252 2904524776 2904524088 Bacteria 5887454
253 2904560795 2904560550 Bacteria 4029838
254 2904595365 2904595352 Bacteria 6124848
255 2904608228 2904606771 Bacteria 4684500
256 2904760279 2904755435 Bacteria 7986759
257 2907205662 2907202186 Bacteria 6632024
258 2908665831 2908665501 Bacteria 3678115
259 2915602323 2915597211 Bacteria 6475886
260 2915609237 2915606848 Bacteria 6032732
261 2919093970 2919093281 Bacteria 3660974
262 2919146628 2919143609 Bacteria 6219228
263 2919162676 2919160200 Bacteria 6929020
264 2919414623 2919414237 Bacteria 5429133
265 2919427333 2919425241 Bacteria 8055701
266 2919518551 2919517244 Bacteria 5858162
267 2919722918 2919720352 Bacteria 5986006
268 2919729123 2919726948 Bacteria 3696050
269 2925332559 2925326138 Bacteria 9652120
270 2928096554 2928093941 Bacteria 5965005
271 2929006070 2929004312 Bacteria 5678476
272 2929187503 2929183550 Bacteria 6377511
273 2929210431 2929206907 Bacteria 5918291
274 2929237521 2929233124 Bacteria 5948380
275 2931390138 2931384279 Bacteria 7299545
276 2936343914 2936340661 Bacteria 5139038
277 2936365225 2936361878 Bacteria 5632809
278 2938649769 2938649242 Bacteria 7118381
279 2938921715 2938917290 Bacteria 5914775
280 2939679842 2939679117 Bacteria 6921672
281 2939706374 2939702853 Bacteria 5139229
282 2945997633 2945991243 Bacteria 7008369
283 2946053850 2946053406 Bacteria 6978655
284 2947430606 2947426588 Bacteria 5357194
285 2954774610 2954773129 Bacteria 3741715
286 2956901356 2956897341 Bacteria 5447711
287 2960320542 2960319331 Bacteria 5502575
288 2960380614 2960375949 Bacteria 5361395
289 2962292589 2962290636 Bacteria 4072939
290 2964378803 2964375228 Bacteria 4909004
291 2965765212 2965761152 Bacteria 5806513
292 2968561274 2968558590 Bacteria 6956864
293 2969138538 2969136845 Bacteria 3923176
294 2969142704 2969141011 Bacteria 4118468
295 2969766541 2969765954 Bacteria 4216713
296 2969772334 2969770375 Bacteria 4271280
297 2971405781 2971403814 Bacteria 7370929
298 2971416170 2971410472 Bacteria 8311090
299 2971515570 2971511577 Bacteria 5404012
300 2971895021 2971893375 Bacteria 3929648
301 2977258357 2977254563 Bacteria 4828420
302 2979087484 2979083700 Bacteria 5894929
303 2980125610 2980125574 Bacteria 5567337
304 2980180073 2980176882 Bacteria 5397533
305 2980188666 2980182181 Bacteria 9454109
306 2980494333 2980492589 Bacteria 4072961
307 2981288074 2981284811 Bacteria 4641497
308 2981292211 2981289755 Bacteria 4641509
309 2981983693 2981980479 Bacteria 4641628
310 2981988268 2981985349 Bacteria 4641497
311 2984530238 2984527788 Bacteria 5288478
312 2984536346 2984532647 Bacteria 5288506
313 2988229333 2988225383 Bacteria 7221625
314 2990279389 2990275345 Bacteria 4887158
315 2996639072 2996632988 Bacteria 6921523
316 3001893537 3001892409 Bacteria 6328293
317 3006860176 3006858327 Bacteria 4317835
318 3006880782 3006879489 Bacteria 4064221
319 3006979168 3006978542 Bacteria 5328100
320 648170836 648028048 Bacteria 5394884
321 8002322318 8002317523 Bacteria 8051857
322 8022630877 8022630665 Bacteria 3886130
323 8022653472 8022653035 Bacteria 4035078
324 8022793891 8022792930 Bacteria 5693794
325 8022897868 8022893055 Bacteria 5300455
326 8022917049 8022914991 Bacteria 5584517
327 8023440610 8023438354 Bacteria 5779374
328 8023444713 8023444577 Bacteria 5661597
329 8046997778 8046991243 Bacteria 8497463
330 8051952850 8051952484 Bacteria 3926774
331 8052174653 8052174270 Bacteria 3881265
332 8054281947 8054280661 Bacteria 4232245
333 8054467973 8054465665 Bacteria 7323556
334 8054795850 8054795415 Bacteria 9785225
335 8055532961 8055531788 Bacteria 5249694
336 8055634913 8055632911 Bacteria 5283357
337 8056539793 8056533031 Bacteria 8964429
338 8057473883 8057473075 Bacteria 5892720
339 8057476333 8057473075 Bacteria 5892720
340 8057586292 8057582654 Bacteria 5218944
341 8057634145 8057632132 Bacteria 4726859
342 8057737742 8057733483 Bacteria 6578323
343 8057980326 8057977335 Bacteria 5694872
344 JGI25159J45721_1002605
345 JGI25159J45721_1003855
346 JGI25151J46595_10000132
347 JGI25151J46595_10007661
348 JGI25151J46595_10035463
349 JGI25151J46595_10048108
350 JGI25151J46595_10056065
351 rootH1_10001147
352 rootH2_10021408
353 rootL2_10074625
354 rootH1_10102978
355 Ga0006562J51391_1000324
356 Ga0006562J51391_1001252
357 Ga0006562J51391_1015159
358 Ga0006562J51391_1061042
359 Ga0055538_1000312
360 Ga0055538_1000489
361 Ga0055532_1000004
362 Ga0055532_1001546
363 Ga0055535_1001343
364 Ga0055536_1010915
365 Ga0055528_1002612
366 Ga0055541_1000214
367 Ga0055541_1006253
368 Ga0070682_100166467
369 Ga0105244_10007983
370 Ga0105244_10015772
371 Ga0105250_10000710
372 Ga0105245_10038299
373 Ga0105243_10002974
374 Ga0209784_100041
375 Ga0209784_100184
376 Ga0209566_100054
377 Ga0209566_100154
378 Ga0209566_100568
379 Ga0209147_100010
380 Ga0209147_100082
381 Ga0209147_100147
382 Ga0209147_103244
383 Ga0209130_1002308
384 Ga0209130_1002320
385 Ga0209130_1002942
386 Ga0209675_1006526
387 Ga0209676_1000671
388 Ga0209676_1001257
389 Ga0209676_1007828
390 Ga0209676_1032443
391 Ga0209025_1000001
392 Ga0209025_1001046
393 Ga0209025_1001474
394 Ga0209025_1001604
395 Ga0209025_1001829
396 Ga0209025_1005803
397 Ga0209025_1005920
398 Ga0209025_1005986
399 Ga0209025_1009883
400 Ga0209025_1048559
401 Ga0209025_1060210
402 Ga0207426_1010545
403 Ga0207696_1000943
404 Ga0207696_1002435
405 Ga0207655_1006507
406 Ga0207713_1000974
407 Ga0209371_1004392
408 Ga0237817_10064
409 Ga0237817_10223
410 Ga0268256_1004133
411 Ga0307416_100127039
412 Ga0237819_00110
413 Ga0237819_02962
414 Ga0400483_156723
415 Ga0439436_0003330
416 Ga0439439_0006380
417 Ga0439433_0002939
418 Ga0439449_0000182
419 Ga0439462_0001637
420 Ga0439462_0007517
421 Ga0466969_0027164
422 Ga0466961_0051435
423 Ga0466959_0003132
424 Ga0466967_0000014
425 Ga0495603_0023369
426 Ga0495590_0053536
427 Ga0495654_0032729
428 Ga0495622_0011375
429 Ga0495661_0064973
430 Ga0495626_0067709
431 Ga0496100_0000498
432 Ga0496101_0000571
433 Ga0496102_0002229
434 Ga0496103_0000697
435 Ga0496103_0021469
436 Ga0496104_0010074
437 Ga0496105_0001675
438 Ga0496106_0000192
439 Ga0496107_0000406
440 Ga0496108_0000290
441 Ga0496109_0001566
442 Ga0496110_0000255
443 Ga0496110_0001866
444 Ga0496111_0000587
445 Ga0496111_0001283
446 Ga0496112_0001734
447 Ga0496112_0090630
448 Ga0496113_0013007
449 Ga0496116_0002109
450 Ga0496116_0003533
451 Ga0496116_0025664
452 Ga0496116_0070116
453 Ga0496117_0009797
454 Ga0496117_0013711
455 Ga0496117_0045964
456 Ga0496118_0052381
457 Ga0496119_0000166
458 Ga0496119_0002606
459 Ga0496119_0024913
460 Ga0496120_0000406
461 Ga0496120_0015290
462 Ga0496121_0076429
463 Ga0496122_0013662
464 Ga0496122_0031285
465 Ga0496122_0051970
466 Ga0496123_0027817
467 Ga0496123_0110797
468 Ga0496124_0000748
469 Ga0496124_0013597
470 Ga0496124_0092373
471 Ga0496124_0098401
472 Ga0496125_0004997
473 Ga0496125_0015416
474 Ga0496125_0157690
475 Ga0496126_0005500
476 Ga0496126_0028610
477 Ga0501343_000307
478 Ga0501305_005241
479 Ga0501305_005702
480 Ga0501305_008345
481 Ga0501311_001367
482 Ga0501311_006817
483 Ga0501312_000973
484 Ga0501312_005174
485 Ga0501315_000603
486 Ga0501316_000339
487 Ga0501318_008005
488 Ga0501321_001166
489 Ga0501324_002892
490 Ga0501327_00729
491 Ga0501335_000132
492 Ga0501336_000808
493 Ga0501217_013653
494 2745169074
495 2511177219
496 2511699475
497 2512640838
498 2512734697
499 2524186434
500 2545556312
501 2550900950
502 2553391033
503 2555469159
504 2563927098
505 2571532688
506 2573040823
507 2578336776
508 2578929744
509 2580929972
510 2587737999
511 2595089147
512 2595319391
513 2600198124
514 2600400896
515 2601638324
516 2621274986
517 2631982719
518 2643738160
519 2644423652
520 2644705241
521 2644709934
522 2644716078
523 2644724052
524 2644739859
525 2651532886
526 2672335055
527 2673819928
528 2674419778
529 2685151829
530 2686996752
531 2687498055
532 2695627425
533 2698321335
534 2705995775
535 2717916780
536 2721506995
537 2723604796
538 2728532541
539 2730135434
540 2738812870
541 2739154969
542 2739207659
543 2739268621
544 2753809763
545 2757564901
546 2777764130
547 2777836934
548 2791212267
549 2802437051
550 2809054953
551 2812315893
552 2816863932
553 2817479837
554 2817619606
555 2819567658
556 2819581052
557 2819625880
558 2819670298
559 2819709550
560 2819724652
561 2821114536
562 2823527892
563 2831906950
564 2842685172
565 2842884195
566 2849140846
567 2857360077
568 2857457088
569 2857462206
570 2857467078
571 2857473083
572 2857584311
573 2857588650
574 2857592994
575 2857605081
576 2857611830
577 2860839144
578 2864737571
579 2865000086
580 2865004226
581 2877770253
582 2880171256
583 2881637966
584 2885527498
585 2888582647
586 2889046690
587 2889055140
588 2889280707
589 2889296331
590 2897111274
591 2898907466
592 2904114929
593 2904163342
594 2904493511
595 2904524776
596 2904560795
597 2904595365
598 2904608228
599 2904760279
600 2907205662
601 2908665831
602 2915602323
603 2915609237
604 2919093970
605 2919146628
606 2919162676
607 2919414623
608 2919427333
609 2919518551
610 2919722918
611 2919729123
612 2925332559
613 2928096554
614 2929006070
615 2929187503
616 2929210431
617 2929237521
618 2931390138
619 2936343914
620 2936365225
621 2938649769
622 2938921715
623 2939679842
624 2939706374
625 2945997633
626 2946053850
627 2947430606
628 2954774610
629 2956901356
630 2960320542
631 2960380614
632 2962292589
633 2964378803
634 2965765212
635 2968561274
636 2969138538
637 2969142704
638 2969766541
639 2969772334
640 2971405781
641 2971416170
642 2971515570
643 2971895021
644 2977258357
645 2979087484
646 2980125610
647 2980180073
648 2980188666
649 2980494333
650 2981288074
651 2981292211
652 2981983693
653 2981988268
654 2984530238
655 2984536346
656 2988229333
657 2990279389
658 2996639072
659 3001893537
660 3006860176
661 3006880782
662 3006979168
663 648170836
664 8002322318
665 8022630877
666 8022653472
667 8022793891
668 8022897868
669 8022917049
670 8023440610
671 8023444713
672 8046997778
673 8051952850
674 8052174653
675 8054281947
676 8054467973
677 8054795850
678 8055532961
679 8055634913
680 8056539793
681 8057473883
682 8057476333
683 8057586292
684 8057634145
685 8057737742
686 8057980326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21016

RlmN_N

Ribosomal RNA large subunit methyltransferase N-terminal domain

56

113

0.95

PF04055

Radical_SAM

Radical SAM superfamily

156

330

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fz6-assembly2.cif.gz_B crystal structure of a radical sam methyltransferase from sphaerobacter thermophilus 0.9468 17 351
5hr7-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn from escherichia coli with cross-linked in vitro transcribed trna 0.9347 16 351
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.9335 16 342
3rfa-assembly2.cif.gz_A x-ray structure of rlmn from escherichia coli in complex with s-adenosylmethionine 0.9327 16 342
5hr6-assembly2.cif.gz_B x-ray crystal structure of c118a rlmn with cross-linked trna purified from escherichia coli 0.9318 18 351
ID Description Score Start End Superfamily
af_A0A0R0LFU5_57_140_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9808 225 292 3.20.20.70
af_Q2FZ66_80_363_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.976 78 360 3.20.20.70
af_Q2FZ66_80_363_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9693 78 360 3.20.20.70
6fz6B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9569 79 351 3.20.20.70
af_P9WH15_79_363_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9531 79 351 3.20.20.70
ID Description Score Start End GO Terms
AF-S7SSX2-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase (EC 2.1.1.192) 0.9759 15 196 GO:0002935
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A3D2JKG7-F1-model_v4 deleted 0.9752 187 293
AF-A0A2S6DJ86-F1-model_v4 deleted 0.9749 19 258
AF-A0A7X8ZV77-F1-model_v4 23S rRNA (Adenine(2503)-C(2))-methyltransferase RlmN (EC 2.1.1.192) 0.9747 61 362 GO:0000049
GO:0002935
GO:0005737
GO:0019843
GO:0030488
GO:0046872
GO:0051539
GO:0070040
GO:0070475
AF-A0A3A0V329-F1-model_v4 Radical SAM protein 0.9733 163 318 GO:0003824
GO:0030488
GO:0046872
GO:0051539
GO:0070475

Map