F415782

General Info

Members Datasets Scaffolds Average Seq Length
343 184 686 204

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221678|2644435523
Length 238
Sequence SLPGAQGSDVDGKIDDRSSTGRTLGFMGRTSDAREKILSAARSLIELRGYSALGVAEICKTAGVPKGSFYYFFESKEALALTVVDEQWAGQRRAWERVLHAEGAPLSRLRLLFEETEAGQRAGQQSCGTVAGCLFGNLTLELSNQTEAVRDRLQGIFEAQVEMVESVVAEALGRGEVSVTDTRAAARAVVAQLEGQVMFAKLYNDTDRLGPLWTNCLALLGAPAPRPGAVGAVGAVGA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
3 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
4 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
5 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
6 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
7 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
8 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
9 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
10 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
11 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
12 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
13 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
14 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
15 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
16 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
17 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
18 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
19 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
20 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
23 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
24 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
25 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
26 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
27 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
28 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
29 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
30 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
31 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
32 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
33 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
34 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
35 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
36 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
37 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
38 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
39 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
40 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
41 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
42 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
43 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
44 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
48 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
49 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
50 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
51 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
52 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
53 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
54 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
55 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
56 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
57 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
109 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
130 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
131 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
132 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
133 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
137 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
140 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
141 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
144 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
145 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
148 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
149 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
150 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
151 2643221647 Streptomyces sp. Root369 Isolate Unclassified
152 2643221670 Streptomyces sp. Root431 Isolate Unclassified
153 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
154 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
155 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
156 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
157 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
158 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
159 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
160 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
161 2867428634 Streptomyces sp. RP5T Isolate Unclassified
162 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
163 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
164 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
165 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
166 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
167 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
168 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
169 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
170 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
171 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
172 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
173 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
174 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
175 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
176 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
177 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
178 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
179 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
180 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
181 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
182 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
183 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
184 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.63
Metatranscriptomes 0.29
Isolates 11.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.75
Nodule 0.29
Rhizoplane 0.58
Rhizosphere 75.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10169953 3300003323 Bacteria 2071
2 Ga0075367_10000715 3300006178 Bacteria 12829
3 Ga0099826_10044140 3300006948 Bacteria 3061
4 Ga0157369_10175920 3300013105 Bacteria 2253
5 Ga0224712_10224807 3300022467 Bacteria 860
6 Ga0209758_1004301 3300025297 Bacteria 12005
7 Ga0307517_10001880 3300028786 Bacteria 34363
8 Ga0307517_10006239 3300028786 Bacteria 17728
9 Ga0307517_10025095 3300028786 Bacteria 7311
10 Ga0307515_10000287 3300028794 Bacteria 123976
11 Ga0307511_10001720 3300030521 Bacteria 23047
12 Ga0307511_10186861 3300030521 Bacteria 1104
13 Ga0307512_10003551 3300030522 Bacteria 17971
14 Ga0307513_10142719 3300031456 Bacteria 2318
15 Ga0307513_10451813 3300031456 Bacteria 1009
16 Ga0307509_10004445 3300031507 Bacteria 20209
17 Ga0307509_10046720 3300031507 Bacteria 4660
18 Ga0307509_10062694 3300031507 Bacteria 3919
19 Ga0307508_10000257 3300031616 Bacteria 64856
20 Ga0307508_10006169 3300031616 Bacteria 11309
21 Ga0307508_10019397 3300031616 Bacteria 6182
22 Ga0307508_10021604 3300031616 Bacteria 5854
23 Ga0307508_10083792 3300031616 Bacteria 2771
24 Ga0307508_10116089 3300031616 Bacteria 2278
25 Ga0307514_10002888 3300031649 Bacteria 17124
26 Ga0307514_10063734 3300031649 Bacteria 2798
27 Ga0307514_10074080 3300031649 Bacteria 2543
28 Ga0307514_10096441 3300031649 Bacteria 2136
29 Ga0307516_10004784 3300031730 Bacteria 16505
30 Ga0307516_10013126 3300031730 Bacteria 8856
31 Ga0307516_10115308 3300031730 Bacteria 2483
32 Ga0307516_10349521 3300031730 Bacteria 1144
33 Ga0307518_10046590 3300031838 Bacteria 3153
34 Ga0307518_10313179 3300031838 Bacteria 944
35 Ga0307415_101266411 3300032126 Bacteria 697
36 Ga0307507_10000001 3300033179 Bacteria 417520
37 Ga0307507_10019151 3300033179 Bacteria 7726
38 Ga0307507_10284166 3300033179 Bacteria 1031
39 Ga0307510_10000644 3300033180 Bacteria 35417
40 Ga0307510_10041314 3300033180 Bacteria 5044
41 Ga0307510_10048221 3300033180 Bacteria 4548
42 Ga0395900_0175915 3300037418 Bacteria 2177
43 Ga0395898_0012160 3300037466 Bacteria 8903
44 Ga0395898_0099272 3300037466 Bacteria 2796
45 Ga0395898_0118972 3300037466 Bacteria 2531
46 Ga0395898_0362689 3300037466 Bacteria 1382
47 Ga0395905_0330937 3300037471 Bacteria 1414
48 Ga0395901_0108366 3300038443 Bacteria 2916
49 Ga0450903_001172 3300042138 Bacteria 4945
50 Ga0466972_0012918 3300044658 Bacteria 4195
51 Ga0466972_0084585 3300044658 Bacteria 1508
52 Ga0466965_0060227 3300044683 Bacteria 1896
53 Ga0466971_0065896 3300044719 Bacteria 1640
54 Ga0466968_0370423 3300044735 Bacteria 698
55 Ga0466957_0069411 3300044842 Bacteria 2177
56 Ga0466958_0252108 3300045836 Bacteria 1129
57 Ga0466967_0120292 3300045976 Bacteria 2425
58 Ga0495617_034048 3300046452 Bacteria 1709
59 Ga0495627_014204 3300046453 Bacteria 2785
60 Ga0495627_044880 3300046453 Bacteria 1348
61 Ga0495592_0018204 3300046454 Bacteria 5338
62 Ga0495592_0088650 3300046454 Bacteria 2223
63 Ga0495603_0000350 3300046455 Bacteria 24761
64 Ga0495603_0004215 3300046455 Bacteria 8565
65 Ga0495603_0012389 3300046455 Bacteria 5163
66 Ga0495590_0236605 3300046457 Bacteria 677
67 Ga0495629_0002837 3300046459 Bacteria 13246
68 Ga0495629_0003393 3300046459 Bacteria 12051
69 Ga0495629_0019508 3300046459 Bacteria 4842
70 Ga0495629_0036164 3300046459 Bacteria 3487
71 Ga0495629_0036801 3300046459 Bacteria 3452
72 Ga0495629_0051976 3300046459 Bacteria 2867
73 Ga0495629_0182383 3300046459 Bacteria 1455
74 Ga0495638_0037919 3300046460 Bacteria 3065
75 Ga0495638_0048620 3300046460 Bacteria 2654
76 Ga0495651_0003385 3300046462 Bacteria 12238
77 Ga0495651_0004438 3300046462 Bacteria 10749
78 Ga0495651_0123456 3300046462 Bacteria 1899
79 Ga0495651_0140522 3300046462 Bacteria 1751
80 Ga0495653_0017608 3300046463 Bacteria 5810
81 Ga0495653_0323825 3300046463 Bacteria 998
82 Ga0495582_0015493 3300046473 Bacteria 4188
83 Ga0495605_0002953 3300046474 Bacteria 10294
84 Ga0495662_0002888 3300046476 Bacteria 8689
85 Ga0495664_0011388 3300046477 Bacteria 5013
86 Ga0495664_0052161 3300046477 Bacteria 2429
87 Ga0495584_0299515 3300046491 Bacteria 817
88 Ga0495585_0055773 3300046492 Bacteria 2183
89 Ga0495585_0077196 3300046492 Bacteria 1808
90 Ga0495585_0107696 3300046492 Bacteria 1485
91 Ga0495594_0010519 3300046499 Bacteria 4799
92 Ga0495594_0047764 3300046499 Bacteria 2350
93 Ga0495594_0059055 3300046499 Bacteria 2120
94 Ga0495594_0088112 3300046499 Bacteria 1737
95 Ga0495594_0157680 3300046499 Bacteria 1289
96 Ga0495594_0210261 3300046499 Bacteria 1109
97 Ga0495596_0074372 3300046500 Bacteria 1319
98 Ga0495607_0052446 3300046501 Bacteria 2362
99 Ga0495607_0120790 3300046501 Bacteria 1376
100 Ga0495583_0079623 3300046506 Bacteria 1425
101 Ga0495583_0082293 3300046506 Bacteria 1397
102 Ga0495606_0006484 3300046507 Bacteria 10769
103 Ga0495608_0013625 3300046511 Bacteria 5640
104 Ga0495610_0039247 3300046512 Bacteria 2397
105 Ga0495616_0023644 3300046513 Bacteria 3304
106 Ga0495618_0035126 3300046514 Bacteria 3146
107 Ga0495618_0038572 3300046514 Bacteria 3003
108 Ga0495618_0074717 3300046514 Bacteria 2158
109 Ga0495620_0002190 3300046515 Bacteria 11364
110 Ga0495620_0005402 3300046515 Bacteria 7131
111 Ga0495628_0011762 3300046516 Bacteria 7388
112 Ga0495628_0012901 3300046516 Bacteria 7037
113 Ga0495628_0032372 3300046516 Bacteria 4220
114 Ga0495628_0075896 3300046516 Bacteria 2617
115 Ga0495628_0089521 3300046516 Bacteria 2383
116 Ga0495632_0171427 3300046519 Bacteria 997
117 Ga0495643_0002386 3300046522 Bacteria 14999
118 Ga0495643_0023879 3300046522 Bacteria 3471
119 Ga0495666_0080754 3300046526 Bacteria 1538
120 Ga0495666_0104542 3300046526 Bacteria 1333
121 Ga0495652_0006111 3300046529 Bacteria 11261
122 Ga0495652_0025346 3300046529 Bacteria 5248
123 Ga0495652_0070994 3300046529 Bacteria 2908
124 Ga0495652_0124991 3300046529 Bacteria 2045
125 Ga0495654_0043320 3300046530 Bacteria 2231
126 Ga0495640_0005500 3300046533 Bacteria 10075
127 Ga0495640_0028812 3300046533 Bacteria 3993
128 Ga0495640_0051212 3300046533 Bacteria 2839
129 Ga0495640_0286513 3300046533 Bacteria 1025
130 Ga0495586_0069975 3300046535 Bacteria 1916
131 Ga0495587_0007220 3300046536 Bacteria 7208
132 Ga0495587_0205855 3300046536 Bacteria 1112
133 Ga0495587_0330174 3300046536 Bacteria 851
134 Ga0495609_0028912 3300046538 Bacteria 2527
135 Ga0495597_0007618 3300046542 Bacteria 5480
136 Ga0495597_0061032 3300046542 Bacteria 1643
137 Ga0495645_0029347 3300046543 Bacteria 4000
138 Ga0495645_0071328 3300046543 Bacteria 2505
139 Ga0495622_0012318 3300046557 Bacteria 3956
140 Ga0495622_0066172 3300046557 Bacteria 1670
141 Ga0495622_0208359 3300046557 Bacteria 869
142 Ga0495633_0041416 3300046558 Bacteria 2190
143 Ga0495667_0034172 3300046559 Bacteria 3399
144 Ga0495668_0017113 3300046616 Bacteria 4210
145 Ga0495668_0041670 3300046616 Bacteria 2557
146 Ga0495634_0029439 3300046642 Bacteria 3801
147 Ga0495634_0043598 3300046642 Bacteria 3040
148 Ga0495634_0049374 3300046642 Bacteria 2830
149 Ga0495634_0067560 3300046642 Bacteria 2364
150 Ga0495634_0177381 3300046642 Bacteria 1336
151 Ga0495634_0191241 3300046642 Bacteria 1276
152 Ga0495634_0233734 3300046642 Bacteria 1130
153 Ga0495611_0092443 3300046648 Bacteria 1399
154 Ga0495625_0021356 3300046660 Bacteria 4986
155 Ga0495625_0045363 3300046660 Bacteria 3177
156 Ga0495635_0000258 3300046663 Bacteria 33989
157 Ga0495635_0002608 3300046663 Bacteria 12347
158 Ga0495635_0032272 3300046663 Bacteria 3633
159 Ga0495635_0378948 3300046663 Bacteria 941
160 Ga0495661_0044921 3300046665 Bacteria 2705
161 Ga0495588_0008339 3300046674 Bacteria 4751
162 Ga0495588_0024709 3300046674 Bacteria 2986
163 Ga0495588_0095686 3300046674 Bacteria 1557
164 Ga0495657_0003043 3300046675 Bacteria 13876
165 Ga0495657_0007227 3300046675 Bacteria 8608
166 Ga0495657_0011620 3300046675 Bacteria 6575
167 Ga0495657_0141138 3300046675 Bacteria 1501
168 Ga0495599_0114664 3300046678 Bacteria 1677
169 Ga0495599_0118133 3300046678 Bacteria 1649
170 Ga0495623_0012366 3300046679 Bacteria 5525
171 Ga0495623_0035532 3300046679 Bacteria 3194
172 Ga0495623_0080586 3300046679 Bacteria 2015
173 Ga0495623_0367014 3300046679 Bacteria 781
174 Ga0495646_0023299 3300046680 Bacteria 3898
175 Ga0495646_0092807 3300046680 Bacteria 1740
176 Ga0495646_0359969 3300046680 Bacteria 761
177 Ga0495658_0029778 3300046683 Bacteria 2958
178 Ga0495613_0000904 3300046689 Bacteria 22821
179 Ga0495613_0003591 3300046689 Bacteria 11624
180 Ga0495613_0004318 3300046689 Bacteria 10642
181 Ga0495613_0017054 3300046689 Bacteria 5406
182 Ga0495613_0027270 3300046689 Bacteria 4250
183 Ga0495613_0051102 3300046689 Bacteria 3047
184 Ga0495613_0101763 3300046689 Bacteria 2075
185 Ga0495613_0121646 3300046689 Bacteria 1874
186 Ga0495613_0146452 3300046689 Bacteria 1685
187 Ga0495613_0200134 3300046689 Bacteria 1408
188 Ga0495624_0112390 3300046690 Bacteria 1674
189 Ga0495624_0219041 3300046690 Bacteria 1154
190 Ga0495670_0123006 3300046691 Bacteria 1349
191 Ga0495671_0129204 3300046692 Bacteria 1232
192 Ga0495671_0277989 3300046692 Bacteria 807
193 Ga0495649_0008971 3300046694 Bacteria 5978
194 Ga0495589_0003927 3300046794 Bacteria 7979
195 Ga0495589_0040516 3300046794 Bacteria 2325
196 Ga0495589_0045445 3300046794 Bacteria 2181
197 Ga0495589_0055911 3300046794 Bacteria 1943
198 Ga0495600_0001440 3300046809 Bacteria 13170
199 Ga0495600_0005628 3300046809 Bacteria 7568
200 Ga0495600_0037947 3300046809 Bacteria 3133
201 Ga0495600_0060052 3300046809 Bacteria 2482
202 Ga0495600_0156239 3300046809 Bacteria 1475
203 Ga0495660_0028245 3300046810 Bacteria 3171
204 Ga0495581_0012014 3300047315 Bacteria 5009
205 Ga0495581_0027515 3300047315 Bacteria 3297
206 Ga0495581_0045401 3300047315 Bacteria 2540
207 Ga0495581_0190468 3300047315 Bacteria 1200
208 Ga0495604_0001336 3300047317 Bacteria 20165
209 Ga0495604_0004139 3300047317 Bacteria 11518
210 Ga0495604_0038861 3300047317 Bacteria 3744
211 Ga0495636_0001132 3300047318 Bacteria 10042
212 Ga0495636_0100643 3300047318 Bacteria 1263
213 Ga0495636_0168753 3300047318 Bacteria 989
214 Ga0495636_0252554 3300047318 Bacteria 816
215 Ga0495672_0237659 3300047320 Bacteria 891
216 Ga0495676_0003494 3300047321 Bacteria 14226
217 Ga0495676_0008808 3300047321 Bacteria 9226
218 Ga0495676_0009007 3300047321 Bacteria 9107
219 Ga0495676_0013501 3300047321 Bacteria 7341
220 Ga0495676_0024757 3300047321 Bacteria 5188
221 Ga0495676_0097976 3300047321 Bacteria 2176
222 Ga0495676_0136902 3300047321 Bacteria 1760
223 Ga0495676_0166815 3300047321 Bacteria 1552
224 Ga0495676_0289174 3300047321 Bacteria 1108
225 Ga0495680_0037709 3300047322 Bacteria 3870
226 Ga0495680_0509195 3300047322 Bacteria 816
227 Ga0495687_001601 3300047443 Bacteria 20428
228 Ga0495687_011543 3300047443 Bacteria 4741
229 Ga0495687_022102 3300047443 Bacteria 3060
230 Ga0495687_047423 3300047443 Bacteria 1848
231 Ga0495687_126151 3300047443 Bacteria 914
232 Ga0495675_0016648 3300047444 Bacteria 4648
233 Ga0495675_0036772 3300047444 Bacteria 3120
234 Ga0495675_0096956 3300047444 Bacteria 1848
235 Ga0495675_0099914 3300047444 Bacteria 1817
236 Ga0495679_022795 3300047446 Bacteria 2137
237 Ga0495685_005866 3300047447 Bacteria 4012
238 Ga0495685_018378 3300047447 Bacteria 2399
239 Ga0495685_018914 3300047447 Bacteria 2365
240 Ga0495685_025720 3300047447 Bacteria 2025
241 Ga0495681_0003265 3300047470 Bacteria 11308
242 Ga0495681_0009898 3300047470 Bacteria 5823
243 Ga0495681_0017963 3300047470 Bacteria 3912
244 Ga0495684_0079524 3300047471 Bacteria 2489
245 Ga0495684_0272206 3300047471 Bacteria 1225
246 Ga0495686_0279386 3300047472 Bacteria 928
247 Ga0495593_0000283 3300047673 Bacteria 27649
248 Ga0495593_0015495 3300047673 Bacteria 4316
249 Ga0495593_0057783 3300047673 Bacteria 2036
250 Ga0495602_0097221 3300048088 Bacteria 2426
251 Ga0495602_0121902 3300048088 Bacteria 2096
252 Ga0495614_0007777 3300048089 Bacteria 4763
253 Ga0495614_0011103 3300048089 Bacteria 3963
254 Ga0495614_0021276 3300048089 Bacteria 2801
255 Ga0495614_0053384 3300048089 Bacteria 1733
256 Ga0495615_0083334 3300048090 Bacteria 880
257 Ga0495626_0019021 3300048091 Bacteria 3437
258 Ga0496115_0013452 3300048918 Bacteria 6190
259 Ga0495678_031361 3300049459 Bacteria 2217
260 Ga0501034_0531719 3300049571 Bacteria 1086
261 Ga0501038_0004832 3300049574 Bacteria 12514
262 Ga0501039_0546076 3300049575 Bacteria 909
263 Ga0501043_0094917 3300049579 Bacteria 2344
264 Ga0501046_0201490 3300049580 Bacteria 1481
265 Ga0501047_0342863 3300049581 Bacteria 1331
266 Ga0501070_0002413 3300049586 Bacteria 16397
267 Ga0501035_0294307 3300049822 Bacteria 1369
268 Ga0501044_0003733 3300049823 Bacteria 17105
269 Ga0501044_0019189 3300049823 Bacteria 7319
270 Ga0501044_0062483 3300049823 Bacteria 3806
271 nmdc:mga06z11_1011_c1 3300050494 Bacteria 10273
272 Ga0495601_0005701 3300053077 Bacteria 7257
273 Ga0495601_0107714 3300053077 Bacteria 1803
274 Ga0495612_0000828 3300053078 Bacteria 12579
275 Ga0495612_0000861 3300053078 Bacteria 12349
276 Ga0495612_0134989 3300053078 Bacteria 1068
277 Ga0500610_0067015 3300053079 Bacteria 1872
278 Ga0495619_0159014 3300053085 Bacteria 1560
279 Ga0495619_0235357 3300053085 Bacteria 1269
280 Ga0500578_0016163 3300053086 Bacteria 4790
281 Ga0500578_0034839 3300053086 Bacteria 3235
282 Ga0500583_0074126 3300053092 Bacteria 1633
283 Ga0500583_0105468 3300053092 Bacteria 1384
284 Ga0500566_0057977 3300053094 Bacteria 2199
285 Ga0500640_003291 3300053095 Bacteria 5605
286 Ga0500654_048527 3300053099 Bacteria 2317
287 Ga0500660_049324 3300053100 Bacteria 2093
288 Ga0500553_119915 3300053101 Bacteria 1086
289 Ga0500569_002272 3300053109 Bacteria 3764
290 Ga0500572_069225 3300053111 Bacteria 1087
291 Ga0500614_010256 3300053123 Bacteria 2010
292 Ga0500628_003691 3300053129 Bacteria 2528
293 Ga0500652_007570 3300053131 Bacteria 3563
294 Ga0500658_0016192 3300053134 Bacteria 2776
295 Ga0500573_0019513 3300053140 Bacteria 3878
296 Ga0500579_067363 3300053143 Bacteria 2087
297 Ga0500600_0006942 3300053149 Bacteria 6783
298 Ga0500600_0017902 3300053149 Bacteria 4278
299 Ga0500616_0005363 3300053153 Bacteria 8729
300 Ga0500616_0042773 3300053153 Bacteria 2424
301 Ga0500624_010406 3300053157 Bacteria 1339
302 Ga0500633_0240520 3300053160 Bacteria 673
303 Ga0500634_0045538 3300053161 Bacteria 2373
304 Ga0500636_0033219 3300053177 Bacteria 3056
305 Ga0500656_008349 3300053732 Bacteria 1097
306 2644435523 2643221678 Bacteria 9540101
307 2585312089 2582581314 Bacteria 11452267
308 2616699440 2616644814 Bacteria 11555299
309 2644263861 2643221647 Bacteria 10741251
310 2644388214 2643221670 Bacteria 6497041
311 2786674856 2786546132 Bacteria 10419719
312 2793977451 2791355406 Bacteria 11364898
313 2808848145 2808606359 Bacteria 9866990
314 2808915020 2808606375 Bacteria 9466072
315 2809197237 2808606439 Bacteria 5952208
316 2812352084 2811994878 Bacteria 5992952
317 2856742915 2856741275 Bacteria 8096094
318 2862289215 2862281513 Bacteria 9621493
319 2867436372 2867428634 Bacteria 9590268
320 2891396857 2891395885 Bacteria 9251614
321 2891559473 2891554331 Bacteria 8812224
322 2891970213 2891968417 Bacteria 5821697
323 2895436274 2895427314 Bacteria 13147766
324 2919475305 2919468124 Bacteria 9133025
325 2939658825 2939657138 Bacteria 3740283
326 2954382499 2954380949 Bacteria 10050426
327 2954390242 2954380949 Bacteria 10050426
328 2954680546 2954673503 Bacteria 9685905
329 2954683607 2954682443 Bacteria 9862841
330 2954693300 2954691527 Bacteria 10720516
331 2954708393 2954701450 Bacteria 10834262
332 2954713007 2954711539 Bacteria 10867210
333 2954722966 2954721474 Bacteria 10456478
334 2954738863 2954731030 Bacteria 10243860
335 2954741876 2954740390 Bacteria 10229294
336 2954757721 2954749733 Bacteria 10366972
337 2954760853 2954759201 Bacteria 9358192
338 8008575131 8008574985 Bacteria 7815457
339 8047902699 8047893842 Bacteria 11723082
340 8048370497 8048369669 Bacteria 11666822
341 8048388925 8048379754 Bacteria 11877923
342 8056836160 8056829672 Bacteria 9045328
343 8057347516 8057345674 Bacteria 4160394
344 rootH1_10169953
345 Ga0075367_10000715
346 Ga0099826_10044140
347 Ga0157369_10175920
348 Ga0224712_10224807
349 Ga0209758_1004301
350 Ga0307517_10001880
351 Ga0307517_10006239
352 Ga0307517_10025095
353 Ga0307515_10000287
354 Ga0307511_10001720
355 Ga0307511_10186861
356 Ga0307512_10003551
357 Ga0307513_10142719
358 Ga0307513_10451813
359 Ga0307509_10004445
360 Ga0307509_10046720
361 Ga0307509_10062694
362 Ga0307508_10000257
363 Ga0307508_10006169
364 Ga0307508_10019397
365 Ga0307508_10021604
366 Ga0307508_10083792
367 Ga0307508_10116089
368 Ga0307514_10002888
369 Ga0307514_10063734
370 Ga0307514_10074080
371 Ga0307514_10096441
372 Ga0307516_10004784
373 Ga0307516_10013126
374 Ga0307516_10115308
375 Ga0307516_10349521
376 Ga0307518_10046590
377 Ga0307518_10313179
378 Ga0307415_101266411
379 Ga0307507_10000001
380 Ga0307507_10019151
381 Ga0307507_10284166
382 Ga0307510_10000644
383 Ga0307510_10041314
384 Ga0307510_10048221
385 Ga0395900_0175915
386 Ga0395898_0012160
387 Ga0395898_0099272
388 Ga0395898_0118972
389 Ga0395898_0362689
390 Ga0395905_0330937
391 Ga0395901_0108366
392 Ga0450903_001172
393 Ga0466972_0012918
394 Ga0466972_0084585
395 Ga0466965_0060227
396 Ga0466971_0065896
397 Ga0466968_0370423
398 Ga0466957_0069411
399 Ga0466958_0252108
400 Ga0466967_0120292
401 Ga0495617_034048
402 Ga0495627_014204
403 Ga0495627_044880
404 Ga0495592_0018204
405 Ga0495592_0088650
406 Ga0495603_0000350
407 Ga0495603_0004215
408 Ga0495603_0012389
409 Ga0495590_0236605
410 Ga0495629_0002837
411 Ga0495629_0003393
412 Ga0495629_0019508
413 Ga0495629_0036164
414 Ga0495629_0036801
415 Ga0495629_0051976
416 Ga0495629_0182383
417 Ga0495638_0037919
418 Ga0495638_0048620
419 Ga0495651_0003385
420 Ga0495651_0004438
421 Ga0495651_0123456
422 Ga0495651_0140522
423 Ga0495653_0017608
424 Ga0495653_0323825
425 Ga0495582_0015493
426 Ga0495605_0002953
427 Ga0495662_0002888
428 Ga0495664_0011388
429 Ga0495664_0052161
430 Ga0495584_0299515
431 Ga0495585_0055773
432 Ga0495585_0077196
433 Ga0495585_0107696
434 Ga0495594_0010519
435 Ga0495594_0047764
436 Ga0495594_0059055
437 Ga0495594_0088112
438 Ga0495594_0157680
439 Ga0495594_0210261
440 Ga0495596_0074372
441 Ga0495607_0052446
442 Ga0495607_0120790
443 Ga0495583_0079623
444 Ga0495583_0082293
445 Ga0495606_0006484
446 Ga0495608_0013625
447 Ga0495610_0039247
448 Ga0495616_0023644
449 Ga0495618_0035126
450 Ga0495618_0038572
451 Ga0495618_0074717
452 Ga0495620_0002190
453 Ga0495620_0005402
454 Ga0495628_0011762
455 Ga0495628_0012901
456 Ga0495628_0032372
457 Ga0495628_0075896
458 Ga0495628_0089521
459 Ga0495632_0171427
460 Ga0495643_0002386
461 Ga0495643_0023879
462 Ga0495666_0080754
463 Ga0495666_0104542
464 Ga0495652_0006111
465 Ga0495652_0025346
466 Ga0495652_0070994
467 Ga0495652_0124991
468 Ga0495654_0043320
469 Ga0495640_0005500
470 Ga0495640_0028812
471 Ga0495640_0051212
472 Ga0495640_0286513
473 Ga0495586_0069975
474 Ga0495587_0007220
475 Ga0495587_0205855
476 Ga0495587_0330174
477 Ga0495609_0028912
478 Ga0495597_0007618
479 Ga0495597_0061032
480 Ga0495645_0029347
481 Ga0495645_0071328
482 Ga0495622_0012318
483 Ga0495622_0066172
484 Ga0495622_0208359
485 Ga0495633_0041416
486 Ga0495667_0034172
487 Ga0495668_0017113
488 Ga0495668_0041670
489 Ga0495634_0029439
490 Ga0495634_0043598
491 Ga0495634_0049374
492 Ga0495634_0067560
493 Ga0495634_0177381
494 Ga0495634_0191241
495 Ga0495634_0233734
496 Ga0495611_0092443
497 Ga0495625_0021356
498 Ga0495625_0045363
499 Ga0495635_0000258
500 Ga0495635_0002608
501 Ga0495635_0032272
502 Ga0495635_0378948
503 Ga0495661_0044921
504 Ga0495588_0008339
505 Ga0495588_0024709
506 Ga0495588_0095686
507 Ga0495657_0003043
508 Ga0495657_0007227
509 Ga0495657_0011620
510 Ga0495657_0141138
511 Ga0495599_0114664
512 Ga0495599_0118133
513 Ga0495623_0012366
514 Ga0495623_0035532
515 Ga0495623_0080586
516 Ga0495623_0367014
517 Ga0495646_0023299
518 Ga0495646_0092807
519 Ga0495646_0359969
520 Ga0495658_0029778
521 Ga0495613_0000904
522 Ga0495613_0003591
523 Ga0495613_0004318
524 Ga0495613_0017054
525 Ga0495613_0027270
526 Ga0495613_0051102
527 Ga0495613_0101763
528 Ga0495613_0121646
529 Ga0495613_0146452
530 Ga0495613_0200134
531 Ga0495624_0112390
532 Ga0495624_0219041
533 Ga0495670_0123006
534 Ga0495671_0129204
535 Ga0495671_0277989
536 Ga0495649_0008971
537 Ga0495589_0003927
538 Ga0495589_0040516
539 Ga0495589_0045445
540 Ga0495589_0055911
541 Ga0495600_0001440
542 Ga0495600_0005628
543 Ga0495600_0037947
544 Ga0495600_0060052
545 Ga0495600_0156239
546 Ga0495660_0028245
547 Ga0495581_0012014
548 Ga0495581_0027515
549 Ga0495581_0045401
550 Ga0495581_0190468
551 Ga0495604_0001336
552 Ga0495604_0004139
553 Ga0495604_0038861
554 Ga0495636_0001132
555 Ga0495636_0100643
556 Ga0495636_0168753
557 Ga0495636_0252554
558 Ga0495672_0237659
559 Ga0495676_0003494
560 Ga0495676_0008808
561 Ga0495676_0009007
562 Ga0495676_0013501
563 Ga0495676_0024757
564 Ga0495676_0097976
565 Ga0495676_0136902
566 Ga0495676_0166815
567 Ga0495676_0289174
568 Ga0495680_0037709
569 Ga0495680_0509195
570 Ga0495687_001601
571 Ga0495687_011543
572 Ga0495687_022102
573 Ga0495687_047423
574 Ga0495687_126151
575 Ga0495675_0016648
576 Ga0495675_0036772
577 Ga0495675_0096956
578 Ga0495675_0099914
579 Ga0495679_022795
580 Ga0495685_005866
581 Ga0495685_018378
582 Ga0495685_018914
583 Ga0495685_025720
584 Ga0495681_0003265
585 Ga0495681_0009898
586 Ga0495681_0017963
587 Ga0495684_0079524
588 Ga0495684_0272206
589 Ga0495686_0279386
590 Ga0495593_0000283
591 Ga0495593_0015495
592 Ga0495593_0057783
593 Ga0495602_0097221
594 Ga0495602_0121902
595 Ga0495614_0007777
596 Ga0495614_0011103
597 Ga0495614_0021276
598 Ga0495614_0053384
599 Ga0495615_0083334
600 Ga0495626_0019021
601 Ga0496115_0013452
602 Ga0495678_031361
603 Ga0501034_0531719
604 Ga0501038_0004832
605 Ga0501039_0546076
606 Ga0501043_0094917
607 Ga0501046_0201490
608 Ga0501047_0342863
609 Ga0501070_0002413
610 Ga0501035_0294307
611 Ga0501044_0003733
612 Ga0501044_0019189
613 Ga0501044_0062483
614 nmdc:mga06z11_1011_c1
615 Ga0495601_0005701
616 Ga0495601_0107714
617 Ga0495612_0000828
618 Ga0495612_0000861
619 Ga0495612_0134989
620 Ga0500610_0067015
621 Ga0495619_0159014
622 Ga0495619_0235357
623 Ga0500578_0016163
624 Ga0500578_0034839
625 Ga0500583_0074126
626 Ga0500583_0105468
627 Ga0500566_0057977
628 Ga0500640_003291
629 Ga0500654_048527
630 Ga0500660_049324
631 Ga0500553_119915
632 Ga0500569_002272
633 Ga0500572_069225
634 Ga0500614_010256
635 Ga0500628_003691
636 Ga0500652_007570
637 Ga0500658_0016192
638 Ga0500573_0019513
639 Ga0500579_067363
640 Ga0500600_0006942
641 Ga0500600_0017902
642 Ga0500616_0005363
643 Ga0500616_0042773
644 Ga0500624_010406
645 Ga0500633_0240520
646 Ga0500634_0045538
647 Ga0500636_0033219
648 Ga0500656_008349
649 2644435523
650 2585312089
651 2616699440
652 2644263861
653 2644388214
654 2786674856
655 2793977451
656 2808848145
657 2808915020
658 2809197237
659 2812352084
660 2856742915
661 2862289215
662 2867436372
663 2891396857
664 2891559473
665 2891970213
666 2895436274
667 2919475305
668 2939658825
669 2954382499
670 2954390242
671 2954680546
672 2954683607
673 2954693300
674 2954708393
675 2954713007
676 2954722966
677 2954738863
678 2954741876
679 2954757721
680 2954760853
681 8008575131
682 8047902699
683 8048370497
684 8048388925
685 8056836160
686 8057347516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

37

83

0.97

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

105

214

0.92

PF21993

TetR_C_13_2

Transcriptional regulator LmrA/YxaF-like, C-terminal domain

105

211

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.8912 6 198
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8859 4 193
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8794 3 196
4yze-assembly2.cif.gz_D crystal structure of e.coli nemr reduced form 0.8787 6 197
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.8784 6 198
ID Description Score Start End Superfamily
6el2B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9858 7 53 1.10.10.60
5mwrB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9857 9 53 1.10.10.60
6el2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9774 9 53 1.10.10.60
2g0eE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9752 7 53 1.10.10.60
3br6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9734 7 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2N0J3H6-F1-model_v4 deleted 0.9796 38 198
AF-A0A429HKM6-F1-model_v4 deleted 0.9725 1 197
AF-A0A250V320-F1-model_v4 TetR family transcriptional regulator 0.9705 1 198 GO:0003677
GO:0006355
AF-A0A7K3GP71-F1-model_v4 TetR family transcriptional regulator 0.9702 1 199 GO:0003677
GO:0006355
AF-A0A7T7RG28-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9701 1 197 GO:0003677
GO:0006355

Map