F415754

General Info

Members Datasets Scaffolds Average Seq Length
343 200 686 132

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0136833|Ga0501067_0136833_641_1105
Length 154
Sequence MSPLGTHVKLGEETQQFRTRGEAEMRIGLLIVAALALIGFVVVAVVLPQMAGTQAKEAAQALVSGAEPARQQVNTAVEKSGNVAGAGKGIKVAPKNDPKYGELKWLVAEDGAIRGWNEKNALEVALTPSVQGGKVSWNCKGYPVSAMPQNCGGR

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
87 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
88 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
89 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.13
Stem 0
Stem Tuber 0
Unclassified 17.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0136833 3300049583 Unclassified 1364
2 Ga0070690_100018649 3300005330 Bacteria 4194
3 Ga0070690_101275272 3300005330 Unclassified 588
4 Ga0068869_100377770 3300005334 Bacteria 1161
5 Ga0068869_100378234 3300005334 Bacteria 1160
6 Ga0070680_100151757 3300005336 Bacteria 1945
7 Ga0070680_100543969 3300005336 Bacteria 995
8 Ga0070680_101891701 3300005336 Bacteria 517
9 Ga0070682_101809028 3300005337 Bacteria 533
10 Ga0070689_100104622 3300005340 Bacteria 2244
11 Ga0070689_100722506 3300005340 Bacteria 871
12 Ga0070691_10093968 3300005341 Bacteria 1482
13 Ga0070691_10333180 3300005341 Unclassified 838
14 Ga0070691_10646606 3300005341 Bacteria 629
15 Ga0070673_100025550 3300005364 Bacteria 4350
16 Ga0070673_100802908 3300005364 Bacteria 869
17 Ga0070711_100301610 3300005439 Bacteria 1274
18 Ga0070711_100613387 3300005439 Unclassified 909
19 Ga0070705_100085669 3300005440 Bacteria 1948
20 Ga0070705_100352949 3300005440 Unclassified 1073
21 Ga0070705_100548121 3300005440 Bacteria 886
22 Ga0070700_100217170 3300005441 Bacteria 1352
23 Ga0070700_100287343 3300005441 Bacteria 1195
24 Ga0070700_100351698 3300005441 Bacteria 1093
25 Ga0070700_100706448 3300005441 Bacteria 802
26 Ga0070700_100998034 3300005441 Unclassified 688
27 Ga0070694_100046093 3300005444 Bacteria 2925
28 Ga0070694_100100462 3300005444 Bacteria 2046
29 Ga0070694_100126481 3300005444 Bacteria 1841
30 Ga0070694_100200704 3300005444 Bacteria 1486
31 Ga0070681_10000421 3300005458 Bacteria 34437
32 Ga0070681_10342347 3300005458 Unclassified 1405
33 Ga0070681_10390946 3300005458 Bacteria 1302
34 Ga0070706_100648846 3300005467 Unclassified 980
35 Ga0070707_100473282 3300005468 Unclassified 1214
36 Ga0070699_100029853 3300005518 Bacteria 4703
37 Ga0070699_100433373 3300005518 Bacteria 1191
38 Ga0070679_100237724 3300005530 Bacteria 1780
39 Ga0070684_100010544 3300005535 Bacteria 7326
40 Ga0070697_100029278 3300005536 Bacteria 4413
41 Ga0070697_100970006 3300005536 Bacteria 755
42 Ga0070686_100008556 3300005544 Bacteria 5733
43 Ga0070686_100358240 3300005544 Bacteria 1098
44 Ga0070686_101145261 3300005544 Bacteria 644
45 Ga0070695_100000952 3300005545 Bacteria 15714
46 Ga0070695_100024514 3300005545 Bacteria 3718
47 Ga0070695_100029054 3300005545 Bacteria 3433
48 Ga0070695_100200443 3300005545 Bacteria 1426
49 Ga0070696_100012777 3300005546 Bacteria 5638
50 Ga0070696_100140226 3300005546 Unclassified 1766
51 Ga0070696_100361299 3300005546 Bacteria 1127
52 Ga0070696_100384855 3300005546 Unclassified 1094
53 Ga0070696_100672688 3300005546 Bacteria 841
54 Ga0070693_100189528 3300005547 Bacteria 1329
55 Ga0070693_101094907 3300005547 Bacteria 607
56 Ga0070704_100159471 3300005549 Unclassified 1783
57 Ga0068855_100132713 3300005563 Bacteria 2843
58 Ga0070664_100579591 3300005564 Bacteria 1039
59 Ga0068856_100609440 3300005614 Bacteria 1113
60 Ga0070702_100113098 3300005615 Bacteria 1687
61 Ga0070702_100183465 3300005615 Bacteria 1371
62 Ga0070702_100296617 3300005615 Bacteria 1116
63 Ga0070702_101271051 3300005615 Bacteria 596
64 Ga0068859_101264898 3300005617 Bacteria 813
65 Ga0068864_100019992 3300005618 Bacteria 5599
66 Ga0068864_100367396 3300005618 Bacteria 1361
67 Ga0068863_100191202 3300005841 Bacteria 1967
68 Ga0068863_100681145 3300005841 Bacteria 1021
69 Ga0068858_100181382 3300005842 Unclassified 1988
70 Ga0068858_100878987 3300005842 Bacteria 876
71 Ga0068860_100106659 3300005843 Bacteria 2676
72 Ga0068862_101078160 3300005844 Bacteria 797
73 Ga0081539_10000188 3300005985 Bacteria 143987
74 Ga0070717_11023695 3300006028 Unclassified 752
75 Ga0070716_101017498 3300006173 Bacteria 656
76 Ga0097621_100022287 3300006237 Bacteria 4915
77 Ga0097621_102299435 3300006237 Unclassified 516
78 Ga0068871_100001395 3300006358 Bacteria 16182
79 Ga0075430_101219950 3300006846 Bacteria 619
80 Ga0075433_10002531 3300006852 Bacteria 13913
81 Ga0075433_10023400 3300006852 Bacteria 5200
82 Ga0075433_10349318 3300006852 Bacteria 1307
83 Ga0075433_10725038 3300006852 Bacteria 870
84 Ga0075434_100000204 3300006871 Bacteria 40084
85 Ga0075434_100000459 3300006871 Bacteria 30427
86 Ga0075434_100006775 3300006871 Bacteria 10530
87 Ga0075434_100181410 3300006871 Bacteria 2125
88 Ga0075434_100486284 3300006871 Bacteria 1255
89 Ga0075429_100161777 3300006880 Bacteria 1960
90 Ga0075436_100000090 3300006914 Bacteria 52278
91 Ga0075436_100004588 3300006914 Bacteria 9460
92 Ga0075436_100009613 3300006914 Bacteria 6620
93 Ga0075436_100018129 3300006914 Bacteria 4821
94 Ga0075436_100043849 3300006914 Bacteria 3084
95 Ga0075436_100186892 3300006914 Bacteria 1465
96 Ga0075436_100455367 3300006914 Bacteria 932
97 Ga0075436_101182241 3300006914 Unclassified 577
98 Ga0097620_101265100 3300006931 Bacteria 813
99 Ga0075435_100005884 3300007076 Bacteria 8630
100 Ga0075435_100007989 3300007076 Bacteria 7573
101 Ga0075435_100013641 3300007076 Bacteria 6053
102 Ga0075435_100079112 3300007076 Unclassified 2697
103 Ga0075435_100138516 3300007076 Bacteria 2040
104 Ga0075435_100681841 3300007076 Unclassified 893
105 Ga0075435_100689897 3300007076 Bacteria 887
106 Ga0075435_101108187 3300007076 Unclassified 692
107 Ga0111539_10044485 3300009094 Bacteria 5319
108 Ga0111539_10055992 3300009094 Bacteria 4688
109 Ga0111539_12139989 3300009094 Bacteria 649
110 Ga0114129_10395969 3300009147 Bacteria 1821
111 Ga0114129_10766704 3300009147 Unclassified 1234
112 Ga0105248_11111761 3300009177 Bacteria 893
113 Ga0105248_11628160 3300009177 Bacteria 731
114 Ga0157369_10855976 3300013105 Bacteria 933
115 Ga0157374_11542640 3300013296 Bacteria 688
116 Ga0157372_10182189 3300013307 Unclassified 2432
117 Ga0157379_12680819 3300014968 Bacteria 500
118 Ga0157376_10082893 3300014969 Bacteria 2757
119 Ga0207692_10114224 3300025898 Bacteria 1502
120 Ga0207707_10000483 3300025912 Bacteria 41343
121 Ga0207707_10312290 3300025912 Bacteria 1358
122 Ga0207707_10646178 3300025912 Bacteria 892
123 Ga0207663_10824218 3300025916 Unclassified 740
124 Ga0207660_10122613 3300025917 Bacteria 1970
125 Ga0207662_10130453 3300025918 Bacteria 1584
126 Ga0207652_10197552 3300025921 Bacteria 1810
127 Ga0207646_10171183 3300025922 Unclassified 1961
128 Ga0207664_10059823 3300025929 Bacteria 3036
129 Ga0207665_11305107 3300025939 Unclassified 579
130 Ga0207711_10873655 3300025941 Bacteria 836
131 Ga0207689_10147771 3300025942 Bacteria 1936
132 Ga0207667_10497496 3300025949 Bacteria 1237
133 Ga0207651_10620566 3300025960 Bacteria 947
134 Ga0207677_10951020 3300026023 Bacteria 777
135 Ga0207703_10159212 3300026035 Bacteria 1976
136 Ga0207703_10757961 3300026035 Unclassified 925
137 Ga0207639_10855425 3300026041 Bacteria 849
138 Ga0207708_10180883 3300026075 Bacteria 1674
139 Ga0207708_10245324 3300026075 Unclassified 1442
140 Ga0207702_10487720 3300026078 Unclassified 1200
141 Ga0207702_10498681 3300026078 Bacteria 1187
142 Ga0207641_10722034 3300026088 Bacteria 982
143 Ga0207676_10173658 3300026095 Bacteria 1880
144 Ga0207698_10587023 3300026142 Bacteria 1097
145 Ga0209967_1000777 3300027364 Bacteria 4086
146 Ga0209981_1016355 3300027378 Bacteria 1042
147 Ga0209995_1002764 3300027471 Bacteria 2779
148 Ga0209968_1001624 3300027526 Bacteria 3387
149 Ga0209999_1002363 3300027543 Bacteria 3325
150 Ga0207428_10210927 3300027907 Bacteria 1459
151 Ga0207428_10507050 3300027907 Bacteria 876
152 Ga0268265_10331780 3300028380 Bacteria 1382
153 Ga0268264_10468629 3300028381 Bacteria 1223
154 Ga0307408_100083865 3300031548 Bacteria 2389
155 Ga0307408_100685963 3300031548 Bacteria 919
156 Ga0307408_101111901 3300031548 Unclassified 733
157 Ga0307408_102022975 3300031548 Unclassified 554
158 Ga0307416_101679282 3300032002 Bacteria 740
159 Ga0373930_0027912 3300034816 Bacteria 1146
160 Ga0373948_0032567 3300034817 Bacteria 1058
161 Ga0373959_0102240 3300034820 Bacteria 683
162 Ga0373959_0108987 3300034820 Unclassified 667
163 Ga0373928_0033481 3300035084 Unclassified 1149
164 Ga0373934_0339937 3300035086 Bacteria 624
165 Ga0373951_0063860 3300035091 Bacteria 926
166 Ga0373923_0010963 3300035111 Bacteria 3314
167 Ga0373932_0037743 3300035112 Unclassified 1378
168 Ga0373932_0262280 3300035112 Bacteria 634
169 Ga0373936_0006933 3300035113 Bacteria 4264
170 Ga0373939_0006848 3300035114 Bacteria 2756
171 Ga0373939_0262494 3300035114 Bacteria 676
172 Ga0373941_0008758 3300035115 Unclassified 2527
173 Ga0373945_0003831 3300035116 Bacteria 4750
174 Ga0373953_0489412 3300035117 Unclassified 545
175 Ga0373956_0025979 3300035119 Bacteria 2534
176 Ga0373957_0172763 3300035120 Bacteria 893
177 Ga0373960_0004788 3300035121 Bacteria 3116
178 Ga0373946_0012814 3300035171 Bacteria 3144
179 Ga0373955_0590581 3300035172 Unclassified 680
180 Ga0373942_0012824 3300035207 Unclassified 2007
181 Ga0373942_0020044 3300035207 Bacteria 1676
182 Ga0373961_0017719 3300035241 Bacteria 1852
183 Ga0373961_0112570 3300035241 Bacteria 893
184 Ga0373962_0028251 3300035242 Bacteria 1521
185 Ga0373924_0024593 3300035410 Bacteria 2374
186 Ga0373924_0132918 3300035410 Bacteria 1083
187 Ga0373924_0176603 3300035410 Bacteria 939
188 Ga0373924_0341400 3300035410 Unclassified 667
189 Ga0373931_0008329 3300035691 Bacteria 4911
190 Ga0373931_0020465 3300035691 Bacteria 3311
191 Ga0373931_0021189 3300035691 Bacteria 3260
192 Ga0373935_0364538 3300035692 Bacteria 1032
193 Ga0373927_0336510 3300035695 Bacteria 994
194 Ga0373933_0004693 3300035724 Bacteria 7483
195 Ga0373933_0051790 3300035724 Bacteria 2455
196 Ga0373933_0203272 3300035724 Bacteria 1268
197 Ga0373947_0021621 3300035725 Bacteria 3724
198 Ga0373937_0025458 3300036401 Bacteria 5341
199 Ga0373937_0037082 3300036401 Bacteria 4443
200 Ga0373937_0298882 3300036401 Bacteria 1521
201 Ga0373937_0766760 3300036401 Bacteria 912
202 Ga0436360_1369309 3300039438 Bacteria 1667
203 Ga0451807_1799059 3300041486 Bacteria 1766
204 Ga0451839_1075084 3300041496 Bacteria 1118
205 Ga0451853_1488768 3300041512 Bacteria 639
206 Ga0439431_0094876 3300041997 Unclassified 816
207 Ga0439446_0005486 3300042156 Bacteria 3265
208 Ga0439434_0000292 3300042435 Bacteria 14336
209 Ga0439435_0011099 3300042436 Bacteria 2155
210 Ga0451577_0680098 3300042876 Bacteria 933
211 Ga0453683_0833732 3300044673 Unclassified 608
212 Ga0466965_0053969 3300044683 Bacteria 1998
213 Ga0466964_0390338 3300044706 Bacteria 725
214 Ga0466971_0632275 3300044719 Bacteria 535
215 Ga0466957_0052512 3300044842 Bacteria 2482
216 Ga0451576_0005086 3300045051 Bacteria 16671
217 Ga0451576_0035847 3300045051 Bacteria 5260
218 Ga0451576_0079010 3300045051 Bacteria 3423
219 Ga0451576_0515594 3300045051 Bacteria 1256
220 Ga0466967_0003571 3300045976 Bacteria 10200
221 Ga0495592_0091196 3300046454 Bacteria 2185
222 Ga0495641_0034233 3300046461 Bacteria 2403
223 Ga0495651_0082246 3300046462 Bacteria 2430
224 Ga0495582_0469453 3300046473 Bacteria 727
225 Ga0495582_0603043 3300046473 Unclassified 635
226 Ga0495662_0032193 3300046476 Bacteria 2533
227 Ga0495662_0179513 3300046476 Unclassified 1043
228 Ga0495664_0356346 3300046477 Bacteria 881
229 Ga0495584_0496111 3300046491 Unclassified 622
230 Ga0495608_0017435 3300046511 Bacteria 4966
231 Ga0495628_0122058 3300046516 Unclassified 1998
232 Ga0495628_0821041 3300046516 Unclassified 649
233 Ga0495630_0061504 3300046517 Bacteria 2820
234 Ga0495630_0497811 3300046517 Unclassified 934
235 Ga0495630_0507962 3300046517 Bacteria 924
236 Ga0495666_0071785 3300046526 Bacteria 1645
237 Ga0495642_0098807 3300046528 Bacteria 1241
238 Ga0495642_0135166 3300046528 Bacteria 1063
239 Ga0495640_0015776 3300046533 Bacteria 5670
240 Ga0495640_0812458 3300046533 Unclassified 557
241 Ga0495587_0208784 3300046536 Bacteria 1103
242 Ga0495621_0259144 3300046539 Bacteria 712
243 Ga0495645_0273044 3300046543 Bacteria 1115
244 Ga0495667_0046718 3300046559 Bacteria 2862
245 Ga0495667_0270413 3300046559 Unclassified 1080
246 Ga0495634_0054539 3300046642 Bacteria 2675
247 Ga0495635_0074487 3300046663 Bacteria 2326
248 Ga0495623_0081228 3300046679 Bacteria 2005
249 Ga0495658_0053268 3300046683 Bacteria 2298
250 Ga0495658_0101009 3300046683 Bacteria 1722
251 Ga0495669_0005537 3300046684 Bacteria 5267
252 Ga0495624_0077643 3300046690 Bacteria 2060
253 Ga0495600_0044651 3300046809 Bacteria 2891
254 Ga0495604_0014956 3300047317 Bacteria 6190
255 Ga0495604_0258444 3300047317 Bacteria 1185
256 Ga0495636_0001426 3300047318 Bacteria 9040
257 Ga0495680_0012214 3300047322 Bacteria 7573
258 Ga0495684_0352277 3300047471 Bacteria 1045
259 Ga0495684_0457355 3300047471 Bacteria 886
260 Ga0495593_0092565 3300047673 Unclassified 1556
261 Ga0501298_007537 3300049521 Bacteria 1806
262 Ga0501298_142893 3300049521 Unclassified 580
263 Ga0501299_100533 3300049522 Unclassified 671
264 Ga0501032_0891440 3300049569 Unclassified 560
265 Ga0501033_0409456 3300049570 Bacteria 945
266 Ga0501036_0000184 3300049572 Bacteria 41502
267 Ga0501037_0031011 3300049573 Bacteria 3947
268 Ga0501038_0001603 3300049574 Bacteria 20986
269 Ga0501038_0185978 3300049574 Bacteria 1674
270 Ga0501038_0715501 3300049574 Bacteria 749
271 Ga0501039_0000053 3300049575 Bacteria 94861
272 Ga0501040_0001174 3300049576 Bacteria 16665
273 Ga0501040_0208739 3300049576 Bacteria 1388
274 Ga0501040_1091563 3300049576 Unclassified 579
275 Ga0501041_0000118 3300049577 Bacteria 33545
276 Ga0501041_0123510 3300049577 Bacteria 1610
277 Ga0501042_0000120 3300049578 Bacteria 33485
278 Ga0501042_0159917 3300049578 Bacteria 1625
279 Ga0501043_0003283 3300049579 Bacteria 13329
280 Ga0501046_0003828 3300049580 Bacteria 13767
281 Ga0501046_0784207 3300049580 Unclassified 668
282 Ga0501047_0282241 3300049581 Bacteria 1505
283 Ga0501048_0004450 3300049582 Bacteria 10671
284 Ga0501048_0057121 3300049582 Bacteria 2768
285 Ga0501048_0840375 3300049582 Bacteria 660
286 Ga0501067_0573820 3300049583 Unclassified 632
287 Ga0501069_0138591 3300049585 Bacteria 1395
288 Ga0501069_0212044 3300049585 Bacteria 1124
289 Ga0501071_0006143 3300049587 Bacteria 7783
290 Ga0501071_0152290 3300049587 Bacteria 1726
291 Ga0501071_0163964 3300049587 Bacteria 1662
292 Ga0501071_1433584 3300049587 Unclassified 533
293 Ga0501072_0000147 3300049588 Bacteria 52765
294 Ga0501072_0151273 3300049588 Bacteria 1850
295 Ga0501073_0111831 3300049589 Bacteria 1894
296 Ga0501074_0005551 3300049590 Bacteria 9069
297 Ga0501074_0906562 3300049590 Unclassified 620
298 Ga0501075_0000662 3300049591 Bacteria 21182
299 Ga0501076_0000265 3300049592 Bacteria 32365
300 Ga0501077_0000448 3300049593 Bacteria 24957
301 Ga0501077_0096819 3300049593 Bacteria 1870
302 Ga0501079_0000132 3300049741 Bacteria 40276
303 Ga0501079_0136046 3300049741 Bacteria 1913
304 Ga0501080_0002706 3300049742 Bacteria 15539
305 Ga0501081_0001294 3300049743 Bacteria 15236
306 Ga0501081_0045402 3300049743 Bacteria 3017
307 Ga0501083_0057523 3300049744 Bacteria 2603
308 Ga0501035_0009718 3300049822 Bacteria 8947
309 Ga0501045_0006249 3300049824 Bacteria 8243
310 Ga0501045_0377989 3300049824 Bacteria 1054
311 nmdc:mga05p37_356431_c1 3300050507 Bacteria 1721
312 nmdc:mga05p37_812768_c1 3300050507 Unclassified 1021
313 nmdc:mga09592_14829_c1 3300050508 Bacteria 6361
314 nmdc:mga08y16_531599_c1 3300050511 Bacteria 1192
315 nmdc:mga08y16_71254_c1 3300050511 Bacteria 3622
316 nmdc:mga0n895_134_c1 3300050512 Bacteria 44336
317 nmdc:mga0n895_220914_c1 3300050512 Bacteria 1924
318 nmdc:mga0n895_500_c1 3300050512 Bacteria 26537
319 nmdc:mga0rr50_21373_c1 3300050513 Bacteria 4416
320 nmdc:mga0rr50_215483_c1 3300050513 Unclassified 1584
321 nmdc:mga0rr50_304183_c1 3300050513 Bacteria 1334
322 nmdc:mga0rr50_37291_c1 3300050513 Bacteria 3508
323 nmdc:mga0rr50_468687_c1 3300050513 Bacteria 1069
324 nmdc:mga0rr50_480_c1 3300050513 Bacteria 21155
325 nmdc:mga0rr50_61673_c1 3300050513 Bacteria 2826
326 nmdc:mga08x19_18822_c1 3300050514 Bacteria 4233
327 nmdc:mga08x19_22776_c1 3300050514 Bacteria 3881
328 nmdc:mga08x19_281_c1 3300050514 Bacteria 38370
329 nmdc:mga08x19_3513_c1 3300050514 Bacteria 9330
330 nmdc:mga08x19_39289_c1 3300050514 Bacteria 3008
331 nmdc:mga08x19_7408_c1 3300050514 Bacteria 6516
332 nmdc:mga08x19_80909_c1 3300050514 Bacteria 2133
333 nmdc:mga0a205_1444938_c1 3300050515 Unclassified 536
334 nmdc:mga0a205_156136_c1 3300050515 Bacteria 874
335 nmdc:mga0a205_402_c1 3300050515 Bacteria 33084
336 nmdc:mga0a205_6981_c1 3300050515 Bacteria 10211
337 Ga0495595_0163989 3300053084 Bacteria 1098
338 Ga0495619_0296069 3300053085 Bacteria 1121
339 Ga0501084_0000260 3300054114 Bacteria 39924
340 Ga0501084_0137976 3300054114 Bacteria 2053
341 Ga0590075_099234 3300059424 Unclassified 758
342 Ga0590077_093253 3300059426 Unclassified 700
343 Ga0530510_0000174 3300061734 Bacteria 39084
344 Ga0501067_0136833
345 Ga0070690_100018649
346 Ga0070690_101275272
347 Ga0068869_100377770
348 Ga0068869_100378234
349 Ga0070680_100151757
350 Ga0070680_100543969
351 Ga0070680_101891701
352 Ga0070682_101809028
353 Ga0070689_100104622
354 Ga0070689_100722506
355 Ga0070691_10093968
356 Ga0070691_10333180
357 Ga0070691_10646606
358 Ga0070673_100025550
359 Ga0070673_100802908
360 Ga0070711_100301610
361 Ga0070711_100613387
362 Ga0070705_100085669
363 Ga0070705_100352949
364 Ga0070705_100548121
365 Ga0070700_100217170
366 Ga0070700_100287343
367 Ga0070700_100351698
368 Ga0070700_100706448
369 Ga0070700_100998034
370 Ga0070694_100046093
371 Ga0070694_100100462
372 Ga0070694_100126481
373 Ga0070694_100200704
374 Ga0070681_10000421
375 Ga0070681_10342347
376 Ga0070681_10390946
377 Ga0070706_100648846
378 Ga0070707_100473282
379 Ga0070699_100029853
380 Ga0070699_100433373
381 Ga0070679_100237724
382 Ga0070684_100010544
383 Ga0070697_100029278
384 Ga0070697_100970006
385 Ga0070686_100008556
386 Ga0070686_100358240
387 Ga0070686_101145261
388 Ga0070695_100000952
389 Ga0070695_100024514
390 Ga0070695_100029054
391 Ga0070695_100200443
392 Ga0070696_100012777
393 Ga0070696_100140226
394 Ga0070696_100361299
395 Ga0070696_100384855
396 Ga0070696_100672688
397 Ga0070693_100189528
398 Ga0070693_101094907
399 Ga0070704_100159471
400 Ga0068855_100132713
401 Ga0070664_100579591
402 Ga0068856_100609440
403 Ga0070702_100113098
404 Ga0070702_100183465
405 Ga0070702_100296617
406 Ga0070702_101271051
407 Ga0068859_101264898
408 Ga0068864_100019992
409 Ga0068864_100367396
410 Ga0068863_100191202
411 Ga0068863_100681145
412 Ga0068858_100181382
413 Ga0068858_100878987
414 Ga0068860_100106659
415 Ga0068862_101078160
416 Ga0081539_10000188
417 Ga0070717_11023695
418 Ga0070716_101017498
419 Ga0097621_100022287
420 Ga0097621_102299435
421 Ga0068871_100001395
422 Ga0075430_101219950
423 Ga0075433_10002531
424 Ga0075433_10023400
425 Ga0075433_10349318
426 Ga0075433_10725038
427 Ga0075434_100000204
428 Ga0075434_100000459
429 Ga0075434_100006775
430 Ga0075434_100181410
431 Ga0075434_100486284
432 Ga0075429_100161777
433 Ga0075436_100000090
434 Ga0075436_100004588
435 Ga0075436_100009613
436 Ga0075436_100018129
437 Ga0075436_100043849
438 Ga0075436_100186892
439 Ga0075436_100455367
440 Ga0075436_101182241
441 Ga0097620_101265100
442 Ga0075435_100005884
443 Ga0075435_100007989
444 Ga0075435_100013641
445 Ga0075435_100079112
446 Ga0075435_100138516
447 Ga0075435_100681841
448 Ga0075435_100689897
449 Ga0075435_101108187
450 Ga0111539_10044485
451 Ga0111539_10055992
452 Ga0111539_12139989
453 Ga0114129_10395969
454 Ga0114129_10766704
455 Ga0105248_11111761
456 Ga0105248_11628160
457 Ga0157369_10855976
458 Ga0157374_11542640
459 Ga0157372_10182189
460 Ga0157379_12680819
461 Ga0157376_10082893
462 Ga0207692_10114224
463 Ga0207707_10000483
464 Ga0207707_10312290
465 Ga0207707_10646178
466 Ga0207663_10824218
467 Ga0207660_10122613
468 Ga0207662_10130453
469 Ga0207652_10197552
470 Ga0207646_10171183
471 Ga0207664_10059823
472 Ga0207665_11305107
473 Ga0207711_10873655
474 Ga0207689_10147771
475 Ga0207667_10497496
476 Ga0207651_10620566
477 Ga0207677_10951020
478 Ga0207703_10159212
479 Ga0207703_10757961
480 Ga0207639_10855425
481 Ga0207708_10180883
482 Ga0207708_10245324
483 Ga0207702_10487720
484 Ga0207702_10498681
485 Ga0207641_10722034
486 Ga0207676_10173658
487 Ga0207698_10587023
488 Ga0209967_1000777
489 Ga0209981_1016355
490 Ga0209995_1002764
491 Ga0209968_1001624
492 Ga0209999_1002363
493 Ga0207428_10210927
494 Ga0207428_10507050
495 Ga0268265_10331780
496 Ga0268264_10468629
497 Ga0307408_100083865
498 Ga0307408_100685963
499 Ga0307408_101111901
500 Ga0307408_102022975
501 Ga0307416_101679282
502 Ga0373930_0027912
503 Ga0373948_0032567
504 Ga0373959_0102240
505 Ga0373959_0108987
506 Ga0373928_0033481
507 Ga0373934_0339937
508 Ga0373951_0063860
509 Ga0373923_0010963
510 Ga0373932_0037743
511 Ga0373932_0262280
512 Ga0373936_0006933
513 Ga0373939_0006848
514 Ga0373939_0262494
515 Ga0373941_0008758
516 Ga0373945_0003831
517 Ga0373953_0489412
518 Ga0373956_0025979
519 Ga0373957_0172763
520 Ga0373960_0004788
521 Ga0373946_0012814
522 Ga0373955_0590581
523 Ga0373942_0012824
524 Ga0373942_0020044
525 Ga0373961_0017719
526 Ga0373961_0112570
527 Ga0373962_0028251
528 Ga0373924_0024593
529 Ga0373924_0132918
530 Ga0373924_0176603
531 Ga0373924_0341400
532 Ga0373931_0008329
533 Ga0373931_0020465
534 Ga0373931_0021189
535 Ga0373935_0364538
536 Ga0373927_0336510
537 Ga0373933_0004693
538 Ga0373933_0051790
539 Ga0373933_0203272
540 Ga0373947_0021621
541 Ga0373937_0025458
542 Ga0373937_0037082
543 Ga0373937_0298882
544 Ga0373937_0766760
545 Ga0436360_1369309
546 Ga0451807_1799059
547 Ga0451839_1075084
548 Ga0451853_1488768
549 Ga0439431_0094876
550 Ga0439446_0005486
551 Ga0439434_0000292
552 Ga0439435_0011099
553 Ga0451577_0680098
554 Ga0453683_0833732
555 Ga0466965_0053969
556 Ga0466964_0390338
557 Ga0466971_0632275
558 Ga0466957_0052512
559 Ga0451576_0005086
560 Ga0451576_0035847
561 Ga0451576_0079010
562 Ga0451576_0515594
563 Ga0466967_0003571
564 Ga0495592_0091196
565 Ga0495641_0034233
566 Ga0495651_0082246
567 Ga0495582_0469453
568 Ga0495582_0603043
569 Ga0495662_0032193
570 Ga0495662_0179513
571 Ga0495664_0356346
572 Ga0495584_0496111
573 Ga0495608_0017435
574 Ga0495628_0122058
575 Ga0495628_0821041
576 Ga0495630_0061504
577 Ga0495630_0497811
578 Ga0495630_0507962
579 Ga0495666_0071785
580 Ga0495642_0098807
581 Ga0495642_0135166
582 Ga0495640_0015776
583 Ga0495640_0812458
584 Ga0495587_0208784
585 Ga0495621_0259144
586 Ga0495645_0273044
587 Ga0495667_0046718
588 Ga0495667_0270413
589 Ga0495634_0054539
590 Ga0495635_0074487
591 Ga0495623_0081228
592 Ga0495658_0053268
593 Ga0495658_0101009
594 Ga0495669_0005537
595 Ga0495624_0077643
596 Ga0495600_0044651
597 Ga0495604_0014956
598 Ga0495604_0258444
599 Ga0495636_0001426
600 Ga0495680_0012214
601 Ga0495684_0352277
602 Ga0495684_0457355
603 Ga0495593_0092565
604 Ga0501298_007537
605 Ga0501298_142893
606 Ga0501299_100533
607 Ga0501032_0891440
608 Ga0501033_0409456
609 Ga0501036_0000184
610 Ga0501037_0031011
611 Ga0501038_0001603
612 Ga0501038_0185978
613 Ga0501038_0715501
614 Ga0501039_0000053
615 Ga0501040_0001174
616 Ga0501040_0208739
617 Ga0501040_1091563
618 Ga0501041_0000118
619 Ga0501041_0123510
620 Ga0501042_0000120
621 Ga0501042_0159917
622 Ga0501043_0003283
623 Ga0501046_0003828
624 Ga0501046_0784207
625 Ga0501047_0282241
626 Ga0501048_0004450
627 Ga0501048_0057121
628 Ga0501048_0840375
629 Ga0501067_0573820
630 Ga0501069_0138591
631 Ga0501069_0212044
632 Ga0501071_0006143
633 Ga0501071_0152290
634 Ga0501071_0163964
635 Ga0501071_1433584
636 Ga0501072_0000147
637 Ga0501072_0151273
638 Ga0501073_0111831
639 Ga0501074_0005551
640 Ga0501074_0906562
641 Ga0501075_0000662
642 Ga0501076_0000265
643 Ga0501077_0000448
644 Ga0501077_0096819
645 Ga0501079_0000132
646 Ga0501079_0136046
647 Ga0501080_0002706
648 Ga0501081_0001294
649 Ga0501081_0045402
650 Ga0501083_0057523
651 Ga0501035_0009718
652 Ga0501045_0006249
653 Ga0501045_0377989
654 nmdc:mga05p37_356431_c1
655 nmdc:mga05p37_812768_c1
656 nmdc:mga09592_14829_c1
657 nmdc:mga08y16_531599_c1
658 nmdc:mga08y16_71254_c1
659 nmdc:mga0n895_134_c1
660 nmdc:mga0n895_220914_c1
661 nmdc:mga0n895_500_c1
662 nmdc:mga0rr50_21373_c1
663 nmdc:mga0rr50_215483_c1
664 nmdc:mga0rr50_304183_c1
665 nmdc:mga0rr50_37291_c1
666 nmdc:mga0rr50_468687_c1
667 nmdc:mga0rr50_480_c1
668 nmdc:mga0rr50_61673_c1
669 nmdc:mga08x19_18822_c1
670 nmdc:mga08x19_22776_c1
671 nmdc:mga08x19_281_c1
672 nmdc:mga08x19_3513_c1
673 nmdc:mga08x19_39289_c1
674 nmdc:mga08x19_7408_c1
675 nmdc:mga08x19_80909_c1
676 nmdc:mga0a205_1444938_c1
677 nmdc:mga0a205_156136_c1
678 nmdc:mga0a205_402_c1
679 nmdc:mga0a205_6981_c1
680 Ga0495595_0163989
681 Ga0495619_0296069
682 Ga0501084_0000260
683 Ga0501084_0137976
684 Ga0590075_099234
685 Ga0590077_093253
686 Ga0530510_0000174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wox-assembly1.cif.gz_A nmr solution structure of kany protein (ms6282) using two 4d-spectra 0.8625 78 117
8ey4-assembly1.cif.gz_A contact-dependent growth inhibition toxin-immunity protein complex from e. coli o32:h37 0.7592 72 101
5z4g-assembly2.cif.gz_B crystal structure of secretory abundant heat soluble protein 4 from ramazzottius varieornatus 0.7308 69 118
3rf9-assembly1.cif.gz_B x-ray structure of rlmn from escherichia coli 0.726 80 116
4pl1-assembly2.cif.gz_A x-ray crystal structure of c118a rlmn from escherichia coli with s-adenosylmethionine 0.7211 80 116
ID Description Score Start End Superfamily
af_I6XI16_7_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8345 78 117 3.30.530.20
af_A0A0R0FKB1_3_185_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8141 88 117 2.30.110.10
af_Q57989_212_292_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.7996 87 127 3.30.160.40
af_P36647_8_140_3.30.700.10 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin;Glycoprotein, Type 4 Pilin 0.7519 4 122 3.30.700.10
af_Q9P797_114_437_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7419 79 117 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1F4FGT0-F1-model_v4 Uncharacterized protein 0.9816 27 130
AF-A0A1F4FGT0-F1-model_v4 Uncharacterized protein 0.9544 27 130
AF-A0A1F3YQX7-F1-model_v4 Uncharacterized protein 0.9275 1 130
AF-A0A1F3YQX7-F1-model_v4 Uncharacterized protein 0.9207 1 130
AF-A0A1Q8DIP7-F1-model_v4 Pilin 0.8863 81 127 GO:0007155
GO:0009289

Map