F415717

General Info

Members Datasets Scaffolds Average Seq Length
343 174 341 248

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0044364|Ga0495668_0044364_120_965
Length 281
Sequence MAAIHDGEGLARAVQLGWCDAARRAAAGNLLAIGPHLMIGRRRLLQAVLALPLIAAERAPAGVDWNAWFKGWLLRDFGMIGYYAKDNAALIASGRPVDIVFMGDSITELWNDKRPGFFSAGRVDRGIGGQTSSQMVLRMFSDVVALKPKAVHIMAGTNDIAGNTGTMTARMTEDNIRAMVEIAQRHGIKVLLAPIPPAASFPWRSEVETRPRIAEINKWLEKYARQVGATWVDYRPVLDDGNGAMKQGLASDGVHPTEAGYDAMATVIEPILKRMLGRAHA

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.29
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 3.79
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002116 3300001979 Bacteria 9078
2 JGI24737J22298_10000020 3300001990 Bacteria 46324
3 JGI24737J22298_10001519 3300001990 Bacteria 8268
4 JGI24738J21930_10000048 3300002075 Bacteria 24246
5 JGI24744J21845_10029844 3300002077 Unclassified 1047
6 rootL2_10383060 3300003322 Bacteria 1653
7 Ga0070658_10000070 3300005327 Bacteria 98943
8 Ga0070658_10000087 3300005327 Bacteria 85758
9 Ga0070658_10316859 3300005327 Bacteria 1331
10 Ga0070676_10334922 3300005328 Bacteria 1036
11 Ga0070676_10401075 3300005328 Unclassified 954
12 Ga0070683_100000466 3300005329 Bacteria 28378
13 Ga0070683_100039160 3300005329 Bacteria 4350
14 Ga0070690_100115428 3300005330 Bacteria 1796
15 Ga0070670_100007698 3300005331 Bacteria 9159
16 Ga0070670_100021260 3300005331 Bacteria 5583
17 Ga0068869_100000043 3300005334 Bacteria 52392
18 Ga0070666_10000190 3300005335 Bacteria 42241
19 Ga0070680_100013806 3300005336 Bacteria 6300
20 Ga0070682_100033436 3300005337 Unclassified 3124
21 Ga0068868_100000957 3300005338 Bacteria 19654
22 Ga0070660_100000084 3300005339 Bacteria 56611
23 Ga0070660_100010511 3300005339 Bacteria 6540
24 Ga0070660_100423490 3300005339 Bacteria 1102
25 Ga0070689_100015984 3300005340 Bacteria 5486
26 Ga0070691_10000243 3300005341 Bacteria 18635
27 Ga0070661_100000050 3300005344 Bacteria 90752
28 Ga0070661_100035757 3300005344 Bacteria 3609
29 Ga0070661_100114836 3300005344 Bacteria 2013
30 Ga0070692_10050462 3300005345 Bacteria 2161
31 Ga0070668_100012011 3300005347 Bacteria 6451
32 Ga0070675_100004988 3300005354 Bacteria 10133
33 Ga0070671_100002187 3300005355 Bacteria 15099
34 Ga0070673_100000354 3300005364 Bacteria 24130
35 Ga0070673_100060942 3300005364 Bacteria 2992
36 Ga0070673_100205477 3300005364 Bacteria 1698
37 Ga0070659_100000117 3300005366 Bacteria 59483
38 Ga0070659_100000463 3300005366 Bacteria 29968
39 Ga0070659_100004291 3300005366 Bacteria 10176
40 Ga0070659_100009542 3300005366 Bacteria 7132
41 Ga0070667_100003563 3300005367 Bacteria 13259
42 Ga0070714_100055025 3300005435 Bacteria 3401
43 Ga0070714_100056872 3300005435 Bacteria 3346
44 Ga0070714_100112089 3300005435 Bacteria 2417
45 Ga0070663_100000295 3300005455 Bacteria 25535
46 Ga0070663_100071326 3300005455 Bacteria 2528
47 Ga0070663_100207633 3300005455 Bacteria 1532
48 Ga0070662_100000025 3300005457 Bacteria 87144
49 Ga0070662_100000754 3300005457 Bacteria 19853
50 Ga0070662_100203475 3300005457 Bacteria 1572
51 Ga0070662_100281061 3300005457 Unclassified 1347
52 Ga0068867_100001136 3300005459 Bacteria 18183
53 Ga0070679_100217877 3300005530 Bacteria 1871
54 Ga0070684_100034038 3300005535 Bacteria 4354
55 Ga0068853_100000061 3300005539 Bacteria 77461
56 Ga0068853_100001421 3300005539 Bacteria 17280
57 Ga0068853_100023528 3300005539 Bacteria 5159
58 Ga0070672_100000380 3300005543 Bacteria 25710
59 Ga0070672_100208277 3300005543 Bacteria 1637
60 Ga0070693_100000099 3300005547 Bacteria 38227
61 Ga0070665_100018531 3300005548 Bacteria 6976
62 Ga0070665_100152191 3300005548 Bacteria 2316
63 Ga0068855_100000326 3300005563 Bacteria 59175
64 Ga0068855_100004003 3300005563 Bacteria 17987
65 Ga0068855_100164850 3300005563 Bacteria 2513
66 Ga0068855_100448538 3300005563 Bacteria 1408
67 Ga0068855_100630129 3300005563 Bacteria 1154
68 Ga0070664_100000012 3300005564 Bacteria 162011
69 Ga0070664_100046793 3300005564 Bacteria 3655
70 Ga0068857_100001277 3300005577 Bacteria 19756
71 Ga0068854_100000414 3300005578 Bacteria 26795
72 Ga0068854_100010995 3300005578 Bacteria 5874
73 Ga0068854_100132997 3300005578 Bacteria 1901
74 Ga0068856_100000552 3300005614 Bacteria 41305
75 Ga0068856_100119246 3300005614 Bacteria 2639
76 Ga0068856_100258045 3300005614 Bacteria 1758
77 Ga0068852_100000798 3300005616 Bacteria 20761
78 Ga0068852_100001871 3300005616 Bacteria 14319
79 Ga0068852_100003753 3300005616 Bacteria 10652
80 Ga0068859_100003855 3300005617 Bacteria 15323
81 Ga0068859_100071314 3300005617 Bacteria 3510
82 Ga0068864_100000181 3300005618 Bacteria 58221
83 Ga0068864_100005111 3300005618 Bacteria 10750
84 Ga0068866_10016012 3300005718 Bacteria 3343
85 Ga0068851_10003152 3300005834 Bacteria 7313
86 Ga0068851_10155937 3300005834 Bacteria 1251
87 Ga0068851_10171815 3300005834 Bacteria 1196
88 Ga0068870_10051221 3300005840 Bacteria 2185
89 Ga0068863_100015205 3300005841 Bacteria 7395
90 Ga0068863_100032851 3300005841 Bacteria 4944
91 Ga0068858_100009555 3300005842 Bacteria 9252
92 Ga0068858_100057853 3300005842 Bacteria 3583
93 Ga0068860_100002079 3300005843 Bacteria 21111
94 Ga0068862_100196124 3300005844 Bacteria 1819
95 Ga0081539_10068042 3300005985 Bacteria 1923
96 Ga0097621_100006011 3300006237 Bacteria 8579
97 Ga0097621_100094166 3300006237 Bacteria 2511
98 Ga0068871_100186316 3300006358 Bacteria 1786
99 Ga0075428_100366736 3300006844 Bacteria 1545
100 Ga0075431_100002685 3300006847 Bacteria 17242
101 Ga0075429_100161232 3300006880 Bacteria 1964
102 Ga0068865_100003204 3300006881 Bacteria 9801
103 Ga0097620_100003855 3300006931 Bacteria 15323
104 Ga0097620_100071313 3300006931 Bacteria 3510
105 Ga0105240_10089604 3300009093 Bacteria 3762
106 Ga0114129_10117872 3300009147 Bacteria 3657
107 Ga0105241_10125022 3300009174 Unclassified 2076
108 Ga0105248_10000256 3300009177 Bacteria 62138
109 Ga0105248_10000258 3300009177 Bacteria 62009
110 Ga0105248_10002873 3300009177 Bacteria 19111
111 Ga0105237_10037162 3300009545 Bacteria 4923
112 Ga0105238_10282553 3300009551 Bacteria 1641
113 Ga0105239_10441754 3300010375 Unclassified 1475
114 Ga0105246_10001846 3300011119 Bacteria 12718
115 Ga0157373_10146130 3300013100 Bacteria 1663
116 Ga0157373_10247795 3300013100 Bacteria 1260
117 Ga0157371_10002034 3300013102 Bacteria 19934
118 Ga0157371_10047082 3300013102 Bacteria 3065
119 Ga0157371_10060270 3300013102 Bacteria 2691
120 Ga0157370_10071368 3300013104 Bacteria 3276
121 Ga0157369_10023360 3300013105 Bacteria 6887
122 Ga0157369_10109208 3300013105 Bacteria 2941
123 Ga0157369_10130688 3300013105 Bacteria 2661
124 Ga0157374_10049727 3300013296 Bacteria 3895
125 Ga0157378_10003594 3300013297 Bacteria 13726
126 Ga0163162_10019623 3300013306 Bacteria 6636
127 Ga0157372_10649377 3300013307 Bacteria 1229
128 Ga0157372_10706260 3300013307 Bacteria 1173
129 Ga0157375_10114619 3300013308 Bacteria 2797
130 Ga0163163_10000222 3300014325 Bacteria 58432
131 Ga0182008_10099320 3300014497 Bacteria 1438
132 Ga0157377_10022226 3300014745 Bacteria 3346
133 Ga0157379_10052259 3300014968 Bacteria 3650
134 Ga0206353_11371531 3300020082 Bacteria 1390
135 Ga0213875_10061567 3300021388 Bacteria 1755
136 Ga0207697_10000007 3300025315 Bacteria 81785
137 Ga0207656_10049741 3300025321 Bacteria 1808
138 Ga0207656_10175425 3300025321 Unclassified 1026
139 Ga0207688_10000318 3300025901 Bacteria 22194
140 Ga0207647_10000052 3300025904 Bacteria 87651
141 Ga0207647_10000769 3300025904 Bacteria 25007
142 Ga0207647_10014842 3300025904 Bacteria 5358
143 Ga0207647_10016896 3300025904 Bacteria 4970
144 Ga0207647_10180146 3300025904 Bacteria 1228
145 Ga0207645_10088344 3300025907 Bacteria 1992
146 Ga0207645_10383984 3300025907 Bacteria 943
147 Ga0207643_10101228 3300025908 Bacteria 1690
148 Ga0207705_10000002 3300025909 Bacteria 2046852
149 Ga0207705_10012198 3300025909 Bacteria 6210
150 Ga0207705_10049462 3300025909 Bacteria 3025
151 Ga0207705_10056423 3300025909 Bacteria 2832
152 Ga0207705_10087162 3300025909 Bacteria 2282
153 Ga0207695_10047166 3300025913 Bacteria 4562
154 Ga0207671_10110720 3300025914 Bacteria 2089
155 Ga0207660_10009285 3300025917 Bacteria 6366
156 Ga0207660_10029320 3300025917 Bacteria 3773
157 Ga0207657_10000028 3300025919 Bacteria 141576
158 Ga0207657_10000605 3300025919 Bacteria 38131
159 Ga0207657_10014846 3300025919 Bacteria 7581
160 Ga0207657_10016011 3300025919 Bacteria 7239
161 Ga0207657_10097363 3300025919 Bacteria 2446
162 Ga0207649_10003630 3300025920 Bacteria 8430
163 Ga0207649_10053041 3300025920 Bacteria 2518
164 Ga0207649_10336424 3300025920 Bacteria 1113
165 Ga0207652_10031764 3300025921 Bacteria 4435
166 Ga0207652_10328658 3300025921 Bacteria 1380
167 Ga0207694_10121466 3300025924 Bacteria 2086
168 Ga0207650_10005913 3300025925 Bacteria 8348
169 Ga0207650_10033407 3300025925 Bacteria 3726
170 Ga0207659_10071010 3300025926 Bacteria 2541
171 Ga0207687_10001728 3300025927 Bacteria 15048
172 Ga0207664_10205663 3300025929 Bacteria 1701
173 Ga0207664_10212728 3300025929 Bacteria 1673
174 Ga0207644_10004904 3300025931 Bacteria 8721
175 Ga0207644_10463416 3300025931 Bacteria 1042
176 Ga0207690_10000042 3300025932 Bacteria 120002
177 Ga0207690_10004121 3300025932 Bacteria 8586
178 Ga0207690_10004722 3300025932 Bacteria 8047
179 Ga0207690_10008822 3300025932 Bacteria 5985
180 Ga0207690_10015598 3300025932 Bacteria 4607
181 Ga0207690_10052444 3300025932 Bacteria 2732
182 Ga0207690_10245236 3300025932 Bacteria 1381
183 Ga0207706_10000029 3300025933 Bacteria 146113
184 Ga0207706_10000705 3300025933 Bacteria 34845
185 Ga0207706_10066684 3300025933 Bacteria 3168
186 Ga0207706_10177649 3300025933 Bacteria 1870
187 Ga0207706_10226513 3300025933 Unclassified 1636
188 Ga0207706_10311382 3300025933 Bacteria 1371
189 Ga0207704_10002264 3300025938 Bacteria 8644
190 Ga0207691_10001179 3300025940 Bacteria 25979
191 Ga0207691_10087741 3300025940 Bacteria 2791
192 Ga0207711_10000055 3300025941 Bacteria 136126
193 Ga0207711_10000236 3300025941 Bacteria 59308
194 Ga0207711_10005106 3300025941 Bacteria 11125
195 Ga0207711_10588256 3300025941 Bacteria 1038
196 Ga0207689_10000014 3300025942 Bacteria 122534
197 Ga0207661_10002322 3300025944 Bacteria 13109
198 Ga0207661_10074482 3300025944 Bacteria 2782
199 Ga0207661_10716026 3300025944 Bacteria 921
200 Ga0207679_10000092 3300025945 Bacteria 78331
201 Ga0207679_10028494 3300025945 Bacteria 3876
202 Ga0207679_10034079 3300025945 Bacteria 3590
203 Ga0207667_10003943 3300025949 Bacteria 18261
204 Ga0207667_10040823 3300025949 Bacteria 4938
205 Ga0207667_10057585 3300025949 Bacteria 4079
206 Ga0207667_10061069 3300025949 Bacteria 3944
207 Ga0207667_10061381 3300025949 Bacteria 3932
208 Ga0207667_10366954 3300025949 Bacteria 1468
209 Ga0207667_10436608 3300025949 Bacteria 1331
210 Ga0207651_10000658 3300025960 Bacteria 14705
211 Ga0207651_10062157 3300025960 Bacteria 2601
212 Ga0207668_10007132 3300025972 Bacteria 6634
213 Ga0207640_10000404 3300025981 Bacteria 27391
214 Ga0207658_10088299 3300025986 Bacteria 2396
215 Ga0207677_10002334 3300026023 Bacteria 9959
216 Ga0207703_10000933 3300026035 Bacteria 28397
217 Ga0207703_10313243 3300026035 Bacteria 1435
218 Ga0207639_10011266 3300026041 Bacteria 6204
219 Ga0207639_10058905 3300026041 Bacteria 2956
220 Ga0207639_10161898 3300026041 Bacteria 1886
221 Ga0207639_10182092 3300026041 Bacteria 1788
222 Ga0207678_10002375 3300026067 Bacteria 17077
223 Ga0207678_10035928 3300026067 Bacteria 4313
224 Ga0207702_10000581 3300026078 Bacteria 40736
225 Ga0207702_10152993 3300026078 Bacteria 2100
226 Ga0207702_10215918 3300026078 Bacteria 1785
227 Ga0207641_10001015 3300026088 Bacteria 28538
228 Ga0207641_10124452 3300026088 Bacteria 2306
229 Ga0207641_10408670 3300026088 Bacteria 1305
230 Ga0207648_10002058 3300026089 Bacteria 21922
231 Ga0207676_10001627 3300026095 Bacteria 16557
232 Ga0207674_10000244 3300026116 Bacteria 67590
233 Ga0207674_10000324 3300026116 Bacteria 60949
234 Ga0207674_10058998 3300026116 Bacteria 3885
235 Ga0207675_100231023 3300026118 Bacteria 1785
236 Ga0207698_10000394 3300026142 Bacteria 25237
237 Ga0207698_10016448 3300026142 Bacteria 4986
238 Ga0207698_10052764 3300026142 Bacteria 3117
239 Ga0268266_10089523 3300028379 Unclassified 2695
240 Ga0268265_10175326 3300028380 Bacteria 1837
241 Ga0268264_10005146 3300028381 Bacteria 11082
242 Ga0373954_0017143 3300035118 Bacteria 3249
243 Ga0373960_0025387 3300035121 Unclassified 1611
244 Ga0373943_0003608 3300035170 Bacteria 7041
245 Ga0373955_0162589 3300035172 Bacteria 1318
246 Ga0373933_0103076 3300035724 Bacteria 1772
247 Ga0373947_0014235 3300035725 Bacteria 4562
248 Ga0373937_0057127 3300036401 Bacteria 3584
249 Ga0373925_0003697 3300037068 Bacteria 11750
250 Ga0395899_0022345 3300037312 Bacteria 4796
251 Ga0395899_0041066 3300037312 Bacteria 3457
252 Ga0395899_0060441 3300037312 Bacteria 2792
253 Ga0395900_0001516 3300037418 Bacteria 27574
254 Ga0395900_0004238 3300037418 Bacteria 15223
255 Ga0395900_0012249 3300037418 Bacteria 8768
256 Ga0395900_0015624 3300037418 Bacteria 7738
257 Ga0395900_0015888 3300037418 Bacteria 7668
258 Ga0395900_0029255 3300037418 Bacteria 5651
259 Ga0395900_0108310 3300037418 Bacteria 2854
260 Ga0395900_0157338 3300037418 Bacteria 2320
261 Ga0395900_0223346 3300037418 Bacteria 1897
262 Ga0395900_0336548 3300037418 Unclassified 1486
263 Ga0395900_0494918 3300037418 Bacteria 1173
264 Ga0395900_0674470 3300037418 Bacteria 969
265 Ga0395900_0890985 3300037418 Unclassified 813
266 Ga0395898_0015681 3300037466 Bacteria 7765
267 Ga0395898_0018469 3300037466 Bacteria 7110
268 Ga0395898_0037493 3300037466 Bacteria 4808
269 Ga0395898_0093418 3300037466 Bacteria 2891
270 Ga0395898_0134680 3300037466 Bacteria 2365
271 Ga0395898_0181855 3300037466 Bacteria 2009
272 Ga0395898_0381870 3300037466 Unclassified 1343
273 Ga0395898_0752787 3300037466 Bacteria 915
274 Ga0395905_0000690 3300037471 Bacteria 44713
275 Ga0395905_0002967 3300037471 Bacteria 18445
276 Ga0395905_0014458 3300037471 Bacteria 7535
277 Ga0395905_0016529 3300037471 Bacteria 7014
278 Ga0395905_0022450 3300037471 Bacteria 5968
279 Ga0395905_0028987 3300037471 Bacteria 5217
280 Ga0395905_0036349 3300037471 Bacteria 4625
281 Ga0395905_0047348 3300037471 Bacteria 4030
282 Ga0395905_0057845 3300037471 Bacteria 3626
283 Ga0395905_0091069 3300037471 Bacteria 2859
284 Ga0395905_0104371 3300037471 Bacteria 2661
285 Ga0395905_0225684 3300037471 Bacteria 1752
286 Ga0395905_0354468 3300037471 Bacteria 1359
287 Ga0395905_0366547 3300037471 Bacteria 1333
288 Ga0395905_0486333 3300037471 Bacteria 1134
289 Ga0395905_0563164 3300037471 Bacteria 1041
290 Ga0436364_0272427 3300037853 Bacteria 4097
291 Ga0395901_0002415 3300038443 Bacteria 18964
292 Ga0395901_0008840 3300038443 Bacteria 10195
293 Ga0395901_0017304 3300038443 Bacteria 7357
294 Ga0395901_0035231 3300038443 Bacteria 5171
295 Ga0395901_0043857 3300038443 Bacteria 4639
296 Ga0395901_0068233 3300038443 Bacteria 3705
297 Ga0395901_0299524 3300038443 Bacteria 1667
298 Ga0395901_0302506 3300038443 Bacteria 1658
299 Ga0395901_1015344 3300038443 Bacteria 804
300 Ga0439455_0017692 3300042012 Bacteria 1664
301 Ga0466966_0059736 3300044684 Bacteria 2407
302 Ga0466966_0141419 3300044684 Unclassified 1470
303 Ga0466961_0037917 3300044693 Bacteria 3092
304 Ga0466961_0079881 3300044693 Bacteria 2071
305 Ga0466961_0085045 3300044693 Bacteria 2000
306 Ga0466961_0261455 3300044693 Bacteria 1061
307 Ga0466964_0015028 3300044706 Bacteria 2949
308 Ga0466968_0003640 3300044735 Bacteria 5713
309 Ga0466970_0151013 3300044765 Unclassified 1282
310 Ga0466957_0066426 3300044842 Bacteria 2223
311 Ga0466959_0111740 3300045049 Unclassified 1949
312 Ga0466959_0166412 3300045049 Bacteria 1548
313 Ga0466958_0192227 3300045836 Bacteria 1297
314 Ga0466967_0010171 3300045976 Bacteria 7037
315 Ga0466967_0134302 3300045976 Bacteria 2300
316 Ga0466967_0180981 3300045976 Bacteria 1988
317 Ga0466967_0296263 3300045976 Bacteria 1555
318 Ga0466967_0305694 3300045976 Bacteria 1531
319 Ga0495621_0050338 3300046539 Bacteria 1489
320 Ga0495668_0044364 3300046616 Bacteria 2471
321 Ga0495623_0027424 3300046679 Bacteria 3665
322 Ga0495602_0127086 3300048088 Bacteria 2040
323 Ga0496100_0068172 3300048903 Bacteria 2365
324 Ga0496101_0036612 3300048904 Bacteria 3476
325 Ga0496106_0007658 3300048909 Bacteria 7991
326 Ga0496107_0009885 3300048910 Bacteria 6616
327 Ga0496107_0043069 3300048910 Bacteria 3243
328 Ga0496107_0217737 3300048910 Unclassified 1420
329 Ga0496108_0017496 3300048911 Bacteria 5864
330 Ga0496109_0000617 3300048912 Bacteria 29636
331 Ga0496110_0003274 3300048913 Bacteria 12352
332 Ga0496111_0002692 3300048914 Bacteria 10794
333 Ga0496112_0000133 3300048915 Bacteria 46286
334 Ga0496112_0058328 3300048915 Bacteria 3801
335 Ga0496125_0112103 3300048928 Bacteria 1972
336 Ga0501074_0128951 3300049590 Bacteria 1810
337 Ga0501080_0040203 3300049742 Bacteria 4363
338 nmdc:mga09592_12850_c1 3300050508 Bacteria 6826
339 nmdc:mga06r32_1695_c1 3300050510 Bacteria 19855
340 Ga0495612_0158654 3300053078 Bacteria 987
341 Ga0500645_002148 3300053730 Bacteria 9046

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0111740 Ga0466959_0111740_340_1056 230
2 3300035172 Ga0373955_0162589 Ga0373955_0162589_39_737 232
3 3300044684 Ga0466966_0141419 Ga0466966_0141419_256_972 232
4 iso_pu_bacteria 2599185359 2600226610 232
5 iso_pu_bacteria 2818991466 2819713118 232
6 3300053730 Ga0500645_002148 Ga0500645_002148_1687_2448 235
7 3300048928 Ga0496125_0112103 Ga0496125_0112103_776_1495 236
8 3300005327 Ga0070658_10000070 Ga0070658_1000007038 237
9 3300021388 Ga0213875_10061567 Ga0213875_100615672 237
10 3300025909 Ga0207705_10000002 Ga0207705_10000002987 237
11 3300025919 Ga0207657_10000605 Ga0207657_1000060522 237
12 3300037853 Ga0436364_0272427 Ga0436364_0272427_1962_2705 237
13 3300005327 Ga0070658_10316859 Ga0070658_103168592 238
14 3300005328 Ga0070676_10334922 Ga0070676_103349222 238
15 3300005530 Ga0070679_100217877 Ga0070679_1002178772 238
16 3300005548 Ga0070665_100152191 Ga0070665_1001521912 238
17 3300005834 Ga0068851_10155937 Ga0068851_101559372 238
18 3300006844 Ga0075428_100366736 Ga0075428_1003667361 238
19 3300006847 Ga0075431_100002685 Ga0075431_1000026854 238
20 3300006880 Ga0075429_100161232 Ga0075429_1001612323 238
21 3300009147 Ga0114129_10117872 Ga0114129_101178722 238
22 3300013102 Ga0157371_10047082 Ga0157371_100470823 238
23 3300025907 Ga0207645_10383984 Ga0207645_103839841 238
24 3300025909 Ga0207705_10087162 Ga0207705_100871622 238
25 3300025921 Ga0207652_10031764 Ga0207652_100317642 238
26 3300025931 Ga0207644_10463416 Ga0207644_104634162 238
27 3300025941 Ga0207711_10588256 Ga0207711_105882562 238
28 3300026067 Ga0207678_10035928 Ga0207678_100359283 238
29 3300048915 Ga0496112_0058328 Ga0496112_0058328_2230_2979 238
30 3300050508 nmdc:mga09592_12850_c1 nmdc:mga09592_12850_c1_4044_4769 238
31 3300050510 nmdc:mga06r32_1695_c1 nmdc:mga06r32_1695_c1_12933_13658 238
32 3300026041 Ga0207639_10161898 Ga0207639_101618982 239
33 3300003322 rootL2_10383060 rootL2_103830602 240
34 3300005366 Ga0070659_100009542 Ga0070659_10000954210 240
35 3300009174 Ga0105241_10125022 Ga0105241_101250222 241
36 3300009177 Ga0105248_10000258 Ga0105248_1000025816 241
37 3300013296 Ga0157374_10049727 Ga0157374_100497272 241
38 3300014325 Ga0163163_10000222 Ga0163163_100002229 241
39 3300014968 Ga0157379_10052259 Ga0157379_100522592 241
40 3300035121 Ga0373960_0025387 Ga0373960_0025387_353_1078 241
41 3300037418 Ga0395900_0494918 Ga0395900_0494918_63_788 241
42 3300037466 Ga0395898_0134680 Ga0395898_0134680_383_1108 241
43 3300037471 Ga0395905_0104371 Ga0395905_0104371_1899_2624 241
44 3300038443 Ga0395901_0043857 Ga0395901_0043857_1536_2261 241
45 3300038443 Ga0395901_1015344 Ga0395901_1015344_63_788 241
46 3300048910 Ga0496107_0217737 Ga0496107_0217737_422_1147 241
47 3300005985 Ga0081539_10068042 Ga0081539_100680422 242
48 3300006237 Ga0097621_100094166 Ga0097621_1000941663 242
49 3300006358 Ga0068871_100186316 Ga0068871_1001863162 242
50 3300014497 Ga0182008_10099320 Ga0182008_100993202 242
51 3300035170 Ga0373943_0003608 Ga0373943_0003608_1425_2162 242
52 3300035725 Ga0373947_0014235 Ga0373947_0014235_876_1613 242
53 3300037068 Ga0373925_0003697 Ga0373925_0003697_2057_2794 242
54 3300037312 Ga0395899_0041066 Ga0395899_0041066_1360_2097 242
55 3300037312 Ga0395899_0060441 Ga0395899_0060441_1755_2492 242
56 3300037418 Ga0395900_0001516 Ga0395900_0001516_8997_9734 242
57 3300037418 Ga0395900_0015888 Ga0395900_0015888_4042_4779 242
58 3300037418 Ga0395900_0157338 Ga0395900_0157338_1103_1840 242
59 3300037418 Ga0395900_0336548 Ga0395900_0336548_151_888 242
60 3300037418 Ga0395900_0890985 Ga0395900_0890985_46_783 242
61 3300037466 Ga0395898_0018469 Ga0395898_0018469_1732_2469 242
62 3300037466 Ga0395898_0037493 Ga0395898_0037493_1072_1809 242
63 3300037466 Ga0395898_0381870 Ga0395898_0381870_385_1122 242
64 3300037471 Ga0395905_0002967 Ga0395905_0002967_6985_7722 242
65 3300037471 Ga0395905_0028987 Ga0395905_0028987_2711_3448 242
66 3300037471 Ga0395905_0047348 Ga0395905_0047348_1025_1762 242
67 3300037471 Ga0395905_0225684 Ga0395905_0225684_707_1441 242
68 3300038443 Ga0395901_0035231 Ga0395901_0035231_1080_1817 242
69 3300044684 Ga0466966_0059736 Ga0466966_0059736_1492_2229 242
70 3300044693 Ga0466961_0037917 Ga0466961_0037917_1232_2005 242
71 3300044693 Ga0466961_0079881 Ga0466961_0079881_403_1134 242
72 3300044693 Ga0466961_0085045 Ga0466961_0085045_450_1187 242
73 3300044693 Ga0466961_0261455 Ga0466961_0261455_304_1041 242
74 3300044765 Ga0466970_0151013 Ga0466970_0151013_339_1076 242
75 3300044842 Ga0466957_0066426 Ga0466957_0066426_826_1563 242
76 3300045836 Ga0466958_0192227 Ga0466958_0192227_384_1121 242
77 3300045976 Ga0466967_0180981 Ga0466967_0180981_590_1327 242
78 3300045976 Ga0466967_0305694 Ga0466967_0305694_162_899 242
79 3300005329 Ga0070683_100039160 Ga0070683_1000391608 243
80 3300005336 Ga0070680_100013806 Ga0070680_1000138062 243
81 3300005341 Ga0070691_10000243 Ga0070691_100002438 243
82 3300005344 Ga0070661_100035757 Ga0070661_1000357572 243
83 3300005435 Ga0070714_100112089 Ga0070714_1001120893 243
84 3300005455 Ga0070663_100071326 Ga0070663_1000713262 243
85 3300005455 Ga0070663_100207633 Ga0070663_1002076332 243
86 3300005535 Ga0070684_100034038 Ga0070684_1000340382 243
87 3300005578 Ga0068854_100010995 Ga0068854_1000109952 243
88 3300005834 Ga0068851_10171815 Ga0068851_101718152 243
89 3300009093 Ga0105240_10089604 Ga0105240_100896042 243
90 3300009545 Ga0105237_10037162 Ga0105237_100371627 243
91 3300009551 Ga0105238_10282553 Ga0105238_102825532 243
92 3300013105 Ga0157369_10130688 Ga0157369_101306882 243
93 3300025321 Ga0207656_10049741 Ga0207656_100497412 243
94 3300025904 Ga0207647_10000769 Ga0207647_1000076911 243
95 3300025909 Ga0207705_10049462 Ga0207705_100494622 243
96 3300025913 Ga0207695_10047166 Ga0207695_100471662 243
97 3300025914 Ga0207671_10110720 Ga0207671_101107203 243
98 3300025919 Ga0207657_10097363 Ga0207657_100973632 243
99 3300025920 Ga0207649_10053041 Ga0207649_100530412 243
100 3300025924 Ga0207694_10121466 Ga0207694_101214661 243
101 3300025932 Ga0207690_10008822 Ga0207690_100088222 243
102 3300025933 Ga0207706_10311382 Ga0207706_103113822 243
103 3300025945 Ga0207679_10028494 Ga0207679_100284944 243
104 3300025949 Ga0207667_10061069 Ga0207667_100610693 243
105 3300025949 Ga0207667_10061381 Ga0207667_100613813 243
106 3300026041 Ga0207639_10058905 Ga0207639_100589052 243
107 3300026078 Ga0207702_10152993 Ga0207702_101529932 243
108 3300026078 Ga0207702_10215918 Ga0207702_102159182 243
109 3300026116 Ga0207674_10058998 Ga0207674_100589985 243
110 3300026142 Ga0207698_10052764 Ga0207698_100527643 243
111 3300037312 Ga0395899_0022345 Ga0395899_0022345_2407_3147 243
112 3300037418 Ga0395900_0223346 Ga0395900_0223346_889_1629 243
113 3300037466 Ga0395898_0015681 Ga0395898_0015681_4661_5401 243
114 3300037471 Ga0395905_0016529 Ga0395905_0016529_2634_3374 243
115 3300044706 Ga0466964_0015028 Ga0466964_0015028_1623_2363 243
116 3300044735 Ga0466968_0003640 Ga0466968_0003640_3619_4359 243
117 3300045049 Ga0466959_0166412 Ga0466959_0166412_171_911 243
118 3300045976 Ga0466967_0134302 Ga0466967_0134302_916_1656 243
119 3300046539 Ga0495621_0050338 Ga0495621_0050338_721_1464 243
120 3300046616 Ga0495668_0044364 Ga0495668_0044364_120_965 243
121 3300005457 Ga0070662_100203475 Ga0070662_1002034752 247
122 3300025933 Ga0207706_10177649 Ga0207706_101776493 247
123 3300005327 Ga0070658_10000087 Ga0070658_1000008743 248
124 3300005329 Ga0070683_100000466 Ga0070683_1000004666 248
125 3300005331 Ga0070670_100021260 Ga0070670_1000212602 248
126 3300005335 Ga0070666_10000190 Ga0070666_1000019014 248
127 3300005337 Ga0070682_100033436 Ga0070682_1000334362 248
128 3300005339 Ga0070660_100000084 Ga0070660_10000008411 248
129 3300005344 Ga0070661_100000050 Ga0070661_10000005033 248
130 3300005355 Ga0070671_100002187 Ga0070671_1000021878 248
131 3300005366 Ga0070659_100000117 Ga0070659_10000011710 248
132 3300005455 Ga0070663_100000295 Ga0070663_1000002957 248
133 3300005457 Ga0070662_100000025 Ga0070662_10000002551 248
134 3300005539 Ga0068853_100000061 Ga0068853_10000006144 248
135 3300005547 Ga0070693_100000099 Ga0070693_1000000999 248
136 3300005548 Ga0070665_100018531 Ga0070665_1000185314 248
137 3300005563 Ga0068855_100000326 Ga0068855_10000032633 248
138 3300005563 Ga0068855_100164850 Ga0068855_1001648502 248
139 3300005563 Ga0068855_100630129 Ga0068855_1006301292 248
140 3300005564 Ga0070664_100000012 Ga0070664_10000001253 248
141 3300005578 Ga0068854_100132997 Ga0068854_1001329972 248
142 3300005614 Ga0068856_100000552 Ga0068856_10000055214 248
143 3300005614 Ga0068856_100258045 Ga0068856_1002580452 248
144 3300005616 Ga0068852_100001871 Ga0068852_1000018719 248
145 3300005617 Ga0068859_100071314 Ga0068859_1000713142 248
146 3300005834 Ga0068851_10003152 Ga0068851_100031523 248
147 3300005841 Ga0068863_100032851 Ga0068863_1000328515 248
148 3300005842 Ga0068858_100057853 Ga0068858_1000578534 248
149 3300005844 Ga0068862_100196124 Ga0068862_1001961242 248
150 3300006931 Ga0097620_100071313 Ga0097620_1000713132 248
151 3300025919 Ga0207657_10000028 Ga0207657_1000002872 248
152 3300025920 Ga0207649_10003630 Ga0207649_100036302 248
153 3300025925 Ga0207650_10033407 Ga0207650_100334074 248
154 3300025931 Ga0207644_10004904 Ga0207644_100049044 248
155 3300025932 Ga0207690_10000042 Ga0207690_1000004221 248
156 3300025932 Ga0207690_10015598 Ga0207690_100155982 248
157 3300025933 Ga0207706_10000029 Ga0207706_1000002977 248
158 3300025941 Ga0207711_10000236 Ga0207711_1000023616 248
159 3300025944 Ga0207661_10002322 Ga0207661_100023228 248
160 3300025945 Ga0207679_10000092 Ga0207679_1000009242 248
161 3300025949 Ga0207667_10057585 Ga0207667_100575852 248
162 3300026035 Ga0207703_10313243 Ga0207703_103132432 248
163 3300026067 Ga0207678_10002375 Ga0207678_100023752 248
164 3300026078 Ga0207702_10000581 Ga0207702_1000058113 248
165 3300026088 Ga0207641_10124452 Ga0207641_101244522 248
166 3300026088 Ga0207641_10408670 Ga0207641_104086701 248
167 3300026116 Ga0207674_10000324 Ga0207674_1000032430 248
168 3300026118 Ga0207675_100231023 Ga0207675_1002310232 248
169 3300026142 Ga0207698_10016448 Ga0207698_100164482 248
170 3300028379 Ga0268266_10089523 Ga0268266_100895233 248
171 3300028380 Ga0268265_10175326 Ga0268265_101753262 248
172 3300037471 Ga0395905_0036349 Ga0395905_0036349_2307_3053 248
173 3300037471 Ga0395905_0563164 Ga0395905_0563164_232_978 248
174 3300045976 Ga0466967_0010171 Ga0466967_0010171_3867_4613 248
175 3300045976 Ga0466967_0296263 Ga0466967_0296263_203_949 248
176 3300049590 Ga0501074_0128951 Ga0501074_0128951_850_1596 248
177 3300049742 Ga0501080_0040203 Ga0501080_0040203_1714_2460 248
178 3300001990 JGI24737J22298_10001519 JGI24737J22298_100015194 249
179 3300005364 Ga0070673_100205477 Ga0070673_1002054771 249
180 3300005366 Ga0070659_100004291 Ga0070659_1000042913 249
181 3300005539 Ga0068853_100023528 Ga0068853_1000235284 249
182 3300025904 Ga0207647_10014842 Ga0207647_100148423 249
183 3300025904 Ga0207647_10180146 Ga0207647_101801461 249
184 3300025932 Ga0207690_10004121 Ga0207690_100041213 249
185 3300025933 Ga0207706_10066684 Ga0207706_100666842 249
186 3300026041 Ga0207639_10182092 Ga0207639_101820922 249
187 3300035118 Ga0373954_0017143 Ga0373954_0017143_955_1704 249
188 3300035724 Ga0373933_0103076 Ga0373933_0103076_164_913 249
189 3300036401 Ga0373937_0057127 Ga0373937_0057127_2684_3433 249
190 3300037418 Ga0395900_0004238 Ga0395900_0004238_1576_2325 249
191 3300037418 Ga0395900_0029255 Ga0395900_0029255_287_1036 249
192 3300037418 Ga0395900_0674470 Ga0395900_0674470_135_893 249
193 3300037466 Ga0395898_0093418 Ga0395898_0093418_1055_1804 249
194 3300037471 Ga0395905_0000690 Ga0395905_0000690_13555_14304 249
195 3300037471 Ga0395905_0022450 Ga0395905_0022450_435_1184 249
196 3300037471 Ga0395905_0057845 Ga0395905_0057845_1433_2182 249
197 3300037471 Ga0395905_0091069 Ga0395905_0091069_1056_1805 249
198 3300037471 Ga0395905_0486333 Ga0395905_0486333_210_959 249
199 3300038443 Ga0395901_0008840 Ga0395901_0008840_4494_5243 249
200 3300038443 Ga0395901_0017304 Ga0395901_0017304_1729_2478 249
201 3300038443 Ga0395901_0068233 Ga0395901_0068233_1381_2130 249
202 3300038443 Ga0395901_0299524 Ga0395901_0299524_184_933 249
203 3300038443 Ga0395901_0302506 Ga0395901_0302506_740_1489 249
204 3300042012 Ga0439455_0017692 Ga0439455_0017692_708_1457 249
205 3300046679 Ga0495623_0027424 Ga0495623_0027424_737_1486 249
206 3300048088 Ga0495602_0127086 Ga0495602_0127086_408_1157 249
207 3300048910 Ga0496107_0043069 Ga0496107_0043069_401_1159 249
208 3300053078 Ga0495612_0158654 Ga0495612_0158654_103_852 249
209 3300001979 JGI24740J21852_10002116 JGI24740J21852_100021163 250
210 3300001990 JGI24737J22298_10000020 JGI24737J22298_1000002043 250
211 3300002075 JGI24738J21930_10000048 JGI24738J21930_1000004811 250
212 3300002077 JGI24744J21845_10029844 JGI24744J21845_100298442 250
213 3300005328 Ga0070676_10401075 Ga0070676_104010751 250
214 3300005330 Ga0070690_100115428 Ga0070690_1001154282 250
215 3300005331 Ga0070670_100007698 Ga0070670_1000076985 250
216 3300005334 Ga0068869_100000043 Ga0068869_1000000437 250
217 3300005338 Ga0068868_100000957 Ga0068868_10000095719 250
218 3300005339 Ga0070660_100010511 Ga0070660_1000105112 250
219 3300005339 Ga0070660_100423490 Ga0070660_1004234902 250
220 3300005340 Ga0070689_100015984 Ga0070689_1000159846 250
221 3300005344 Ga0070661_100114836 Ga0070661_1001148363 250
222 3300005345 Ga0070692_10050462 Ga0070692_100504622 250
223 3300005347 Ga0070668_100012011 Ga0070668_1000120115 250
224 3300005354 Ga0070675_100004988 Ga0070675_1000049887 250
225 3300005364 Ga0070673_100000354 Ga0070673_10000035418 250
226 3300005364 Ga0070673_100060942 Ga0070673_1000609422 250
227 3300005366 Ga0070659_100000463 Ga0070659_1000004636 250
228 3300005367 Ga0070667_100003563 Ga0070667_1000035634 250
229 3300005435 Ga0070714_100055025 Ga0070714_1000550254 250
230 3300005435 Ga0070714_100056872 Ga0070714_1000568722 250
231 3300005457 Ga0070662_100000754 Ga0070662_10000075418 250
232 3300005457 Ga0070662_100281061 Ga0070662_1002810612 250
233 3300005459 Ga0068867_100001136 Ga0068867_10000113613 250
234 3300005539 Ga0068853_100001421 Ga0068853_1000014212 250
235 3300005543 Ga0070672_100000380 Ga0070672_1000003806 250
236 3300005543 Ga0070672_100208277 Ga0070672_1002082772 250
237 3300005563 Ga0068855_100004003 Ga0068855_10000400313 250
238 3300005563 Ga0068855_100448538 Ga0068855_1004485382 250
239 3300005564 Ga0070664_100046793 Ga0070664_1000467933 250
240 3300005577 Ga0068857_100001277 Ga0068857_1000012776 250
241 3300005578 Ga0068854_100000414 Ga0068854_10000041413 250
242 3300005614 Ga0068856_100119246 Ga0068856_1001192462 250
243 3300005616 Ga0068852_100000798 Ga0068852_10000079818 250
244 3300005616 Ga0068852_100003753 Ga0068852_1000037537 250
245 3300005617 Ga0068859_100003855 Ga0068859_1000038557 250
246 3300005618 Ga0068864_100000181 Ga0068864_10000018150 250
247 3300005618 Ga0068864_100005111 Ga0068864_1000051116 250
248 3300005718 Ga0068866_10016012 Ga0068866_100160124 250
249 3300005840 Ga0068870_10051221 Ga0068870_100512212 250
250 3300005841 Ga0068863_100015205 Ga0068863_1000152052 250
251 3300005842 Ga0068858_100009555 Ga0068858_1000095557 250
252 3300005843 Ga0068860_100002079 Ga0068860_1000020794 250
253 3300006237 Ga0097621_100006011 Ga0097621_1000060113 250
254 3300006881 Ga0068865_100003204 Ga0068865_10000320410 250
255 3300006931 Ga0097620_100003855 Ga0097620_1000038557 250
256 3300009177 Ga0105248_10000256 Ga0105248_1000025660 250
257 3300009177 Ga0105248_10002873 Ga0105248_100028736 250
258 3300010375 Ga0105239_10441754 Ga0105239_104417542 250
259 3300011119 Ga0105246_10001846 Ga0105246_100018465 250
260 3300013100 Ga0157373_10146130 Ga0157373_101461302 250
261 3300013100 Ga0157373_10247795 Ga0157373_102477952 250
262 3300013102 Ga0157371_10002034 Ga0157371_100020346 250
263 3300013102 Ga0157371_10060270 Ga0157371_100602702 250
264 3300013104 Ga0157370_10071368 Ga0157370_100713684 250
265 3300013105 Ga0157369_10023360 Ga0157369_100233605 250
266 3300013105 Ga0157369_10109208 Ga0157369_101092082 250
267 3300013297 Ga0157378_10003594 Ga0157378_1000359413 250
268 3300013306 Ga0163162_10019623 Ga0163162_100196232 250
269 3300013307 Ga0157372_10649377 Ga0157372_106493772 250
270 3300013307 Ga0157372_10706260 Ga0157372_107062602 250
271 3300013308 Ga0157375_10114619 Ga0157375_101146192 250
272 3300014745 Ga0157377_10022226 Ga0157377_100222262 250
273 3300020082 Ga0206353_11371531 Ga0206353_113715312 250
274 3300025315 Ga0207697_10000007 Ga0207697_1000000777 250
275 3300025321 Ga0207656_10175425 Ga0207656_101754252 250
276 3300025901 Ga0207688_10000318 Ga0207688_100003184 250
277 3300025904 Ga0207647_10000052 Ga0207647_100000526 250
278 3300025904 Ga0207647_10016896 Ga0207647_100168964 250
279 3300025907 Ga0207645_10088344 Ga0207645_100883441 250
280 3300025908 Ga0207643_10101228 Ga0207643_101012282 250
281 3300025909 Ga0207705_10012198 Ga0207705_100121982 250
282 3300025909 Ga0207705_10056423 Ga0207705_100564234 250
283 3300025917 Ga0207660_10009285 Ga0207660_100092854 250
284 3300025917 Ga0207660_10029320 Ga0207660_100293202 250
285 3300025919 Ga0207657_10014846 Ga0207657_100148463 250
286 3300025919 Ga0207657_10016011 Ga0207657_100160116 250
287 3300025920 Ga0207649_10336424 Ga0207649_103364242 250
288 3300025921 Ga0207652_10328658 Ga0207652_103286582 250
289 3300025925 Ga0207650_10005913 Ga0207650_100059134 250
290 3300025926 Ga0207659_10071010 Ga0207659_100710102 250
291 3300025927 Ga0207687_10001728 Ga0207687_100017286 250
292 3300025929 Ga0207664_10205663 Ga0207664_102056632 250
293 3300025929 Ga0207664_10212728 Ga0207664_102127282 250
294 3300025932 Ga0207690_10004722 Ga0207690_100047222 250
295 3300025932 Ga0207690_10052444 Ga0207690_100524442 250
296 3300025932 Ga0207690_10245236 Ga0207690_102452362 250
297 3300025933 Ga0207706_10000705 Ga0207706_1000070527 250
298 3300025933 Ga0207706_10226513 Ga0207706_102265132 250
299 3300025938 Ga0207704_10002264 Ga0207704_100022642 250
300 3300025940 Ga0207691_10001179 Ga0207691_1000117920 250
301 3300025940 Ga0207691_10087741 Ga0207691_100877413 250
302 3300025941 Ga0207711_10000055 Ga0207711_1000005532 250
303 3300025941 Ga0207711_10005106 Ga0207711_100051066 250
304 3300025942 Ga0207689_10000014 Ga0207689_10000014112 250
305 3300025944 Ga0207661_10074482 Ga0207661_100744822 250
306 3300025944 Ga0207661_10716026 Ga0207661_107160261 250
307 3300025945 Ga0207679_10034079 Ga0207679_100340793 250
308 3300025949 Ga0207667_10003943 Ga0207667_1000394319 250
309 3300025949 Ga0207667_10040823 Ga0207667_100408232 250
310 3300025949 Ga0207667_10366954 Ga0207667_103669542 250
311 3300025949 Ga0207667_10436608 Ga0207667_104366082 250
312 3300025960 Ga0207651_10000658 Ga0207651_100006586 250
313 3300025960 Ga0207651_10062157 Ga0207651_100621572 250
314 3300025972 Ga0207668_10007132 Ga0207668_100071325 250
315 3300025981 Ga0207640_10000404 Ga0207640_100004042 250
316 3300025986 Ga0207658_10088299 Ga0207658_100882992 250
317 3300026023 Ga0207677_10002334 Ga0207677_100023346 250
318 3300026035 Ga0207703_10000933 Ga0207703_100009336 250
319 3300026041 Ga0207639_10011266 Ga0207639_100112664 250
320 3300026088 Ga0207641_10001015 Ga0207641_100010156 250
321 3300026089 Ga0207648_10002058 Ga0207648_1000205818 250
322 3300026095 Ga0207676_10001627 Ga0207676_1000162711 250
323 3300026116 Ga0207674_10000244 Ga0207674_1000024460 250
324 3300026142 Ga0207698_10000394 Ga0207698_100003945 250
325 3300028381 Ga0268264_10005146 Ga0268264_100051466 250
326 3300037418 Ga0395900_0012249 Ga0395900_0012249_969_1721 250
327 3300037418 Ga0395900_0015624 Ga0395900_0015624_6347_7099 250
328 3300037418 Ga0395900_0108310 Ga0395900_0108310_1130_1882 250
329 3300037466 Ga0395898_0181855 Ga0395898_0181855_97_849 250
330 3300037466 Ga0395898_0752787 Ga0395898_0752787_98_850 250
331 3300037471 Ga0395905_0014458 Ga0395905_0014458_2506_3258 250
332 3300037471 Ga0395905_0354468 Ga0395905_0354468_531_1283 250
333 3300037471 Ga0395905_0366547 Ga0395905_0366547_404_1156 250
334 3300038443 Ga0395901_0002415 Ga0395901_0002415_5481_6233 250
335 3300048903 Ga0496100_0068172 Ga0496100_0068172_896_1663 250
336 3300048904 Ga0496101_0036612 Ga0496101_0036612_293_1060 250
337 3300048909 Ga0496106_0007658 Ga0496106_0007658_3210_3977 250
338 3300048910 Ga0496107_0009885 Ga0496107_0009885_356_1123 250
339 3300048911 Ga0496108_0017496 Ga0496108_0017496_3135_3902 250
340 3300048912 Ga0496109_0000617 Ga0496109_0000617_21930_22697 250
341 3300048913 Ga0496110_0003274 Ga0496110_0003274_3391_4158 250
342 3300048914 Ga0496111_0002692 Ga0496111_0002692_505_1272 250
343 3300048915 Ga0496112_0000133 Ga0496112_0000133_8698_9465 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

101

263

0.9

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

99

268

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iyj-assembly1.cif.gz_B crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution 0.9277 46 246
3p94-assembly1.cif.gz_A crystal structure of a gdsl-like lipase (bdi_0976) from parabacteroides distasonis atcc 8503 at 1.93 a resolution 0.9247 47 246
3p94-assembly1.cif.gz_A crystal structure of a gdsl-like lipase (bdi_0976) from parabacteroides distasonis atcc 8503 at 1.93 a resolution 0.8946 47 246
4iyj-assembly1.cif.gz_B crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution 0.8938 46 246
4hf7-assembly1.cif.gz_A-2 crystal structure of a gdsl-like lipase (bt0569) from bacteroides thetaiotaomicron vpi-5482 at 1.77 a resolution 0.8878 47 245
ID Description Score Start End Superfamily
3p94D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.9153 47 246 3.40.50.1110
3p94D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8976 47 246 3.40.50.1110
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7974 68 246 3.40.50.1110
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7849 68 246 3.40.50.1110
af_Q9VXP4_1_222_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.773 25 250 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A520IBE4-F1-model_v4 GDSL family lipase 0.9526 123 250 GO:0004622
AF-A0A2W5N1M4-F1-model_v4 GDSL family lipase 0.952 54 245 GO:0004622
AF-A0A4Q2XK96-F1-model_v4 deleted 0.9495 148 249
AF-A0A3C0GMS1-F1-model_v4 Capsular biosynthesis protein 0.9465 137 247 GO:0004622
AF-J9GEG1-F1-model_v4 Lipolytic protein g-d-s-l family 0.944 129 245 GO:0004622

Feature Viewer

pLDDT pTM Quality
81.08 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map