F415717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 174 | 341 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300046616|Ga0495668_0044364|Ga0495668_0044364_120_965 |
| Length | 281 |
| Sequence | MAAIHDGEGLARAVQLGWCDAARRAAAGNLLAIGPHLMIGRRRLLQAVLALPLIAAERAPAGVDWNAWFKGWLLRDFGMIGYYAKDNAALIASGRPVDIVFMGDSITELWNDKRPGFFSAGRVDRGIGGQTSSQMVLRMFSDVVALKPKAVHIMAGTNDIAGNTGTMTARMTEDNIRAMVEIAQRHGIKVLLAPIPPAASFPWRSEVETRPRIAEINKWLEKYARQVGATWVDYRPVLDDGNGAMKQGLASDGVHPTEAGYDAMATVIEPILKRMLGRAHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.29 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 3.79 |
| Rhizosphere | 94.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002116 | 3300001979 | Bacteria | 9078 |
| 2 | JGI24737J22298_10000020 | 3300001990 | Bacteria | 46324 |
| 3 | JGI24737J22298_10001519 | 3300001990 | Bacteria | 8268 |
| 4 | JGI24738J21930_10000048 | 3300002075 | Bacteria | 24246 |
| 5 | JGI24744J21845_10029844 | 3300002077 | Unclassified | 1047 |
| 6 | rootL2_10383060 | 3300003322 | Bacteria | 1653 |
| 7 | Ga0070658_10000070 | 3300005327 | Bacteria | 98943 |
| 8 | Ga0070658_10000087 | 3300005327 | Bacteria | 85758 |
| 9 | Ga0070658_10316859 | 3300005327 | Bacteria | 1331 |
| 10 | Ga0070676_10334922 | 3300005328 | Bacteria | 1036 |
| 11 | Ga0070676_10401075 | 3300005328 | Unclassified | 954 |
| 12 | Ga0070683_100000466 | 3300005329 | Bacteria | 28378 |
| 13 | Ga0070683_100039160 | 3300005329 | Bacteria | 4350 |
| 14 | Ga0070690_100115428 | 3300005330 | Bacteria | 1796 |
| 15 | Ga0070670_100007698 | 3300005331 | Bacteria | 9159 |
| 16 | Ga0070670_100021260 | 3300005331 | Bacteria | 5583 |
| 17 | Ga0068869_100000043 | 3300005334 | Bacteria | 52392 |
| 18 | Ga0070666_10000190 | 3300005335 | Bacteria | 42241 |
| 19 | Ga0070680_100013806 | 3300005336 | Bacteria | 6300 |
| 20 | Ga0070682_100033436 | 3300005337 | Unclassified | 3124 |
| 21 | Ga0068868_100000957 | 3300005338 | Bacteria | 19654 |
| 22 | Ga0070660_100000084 | 3300005339 | Bacteria | 56611 |
| 23 | Ga0070660_100010511 | 3300005339 | Bacteria | 6540 |
| 24 | Ga0070660_100423490 | 3300005339 | Bacteria | 1102 |
| 25 | Ga0070689_100015984 | 3300005340 | Bacteria | 5486 |
| 26 | Ga0070691_10000243 | 3300005341 | Bacteria | 18635 |
| 27 | Ga0070661_100000050 | 3300005344 | Bacteria | 90752 |
| 28 | Ga0070661_100035757 | 3300005344 | Bacteria | 3609 |
| 29 | Ga0070661_100114836 | 3300005344 | Bacteria | 2013 |
| 30 | Ga0070692_10050462 | 3300005345 | Bacteria | 2161 |
| 31 | Ga0070668_100012011 | 3300005347 | Bacteria | 6451 |
| 32 | Ga0070675_100004988 | 3300005354 | Bacteria | 10133 |
| 33 | Ga0070671_100002187 | 3300005355 | Bacteria | 15099 |
| 34 | Ga0070673_100000354 | 3300005364 | Bacteria | 24130 |
| 35 | Ga0070673_100060942 | 3300005364 | Bacteria | 2992 |
| 36 | Ga0070673_100205477 | 3300005364 | Bacteria | 1698 |
| 37 | Ga0070659_100000117 | 3300005366 | Bacteria | 59483 |
| 38 | Ga0070659_100000463 | 3300005366 | Bacteria | 29968 |
| 39 | Ga0070659_100004291 | 3300005366 | Bacteria | 10176 |
| 40 | Ga0070659_100009542 | 3300005366 | Bacteria | 7132 |
| 41 | Ga0070667_100003563 | 3300005367 | Bacteria | 13259 |
| 42 | Ga0070714_100055025 | 3300005435 | Bacteria | 3401 |
| 43 | Ga0070714_100056872 | 3300005435 | Bacteria | 3346 |
| 44 | Ga0070714_100112089 | 3300005435 | Bacteria | 2417 |
| 45 | Ga0070663_100000295 | 3300005455 | Bacteria | 25535 |
| 46 | Ga0070663_100071326 | 3300005455 | Bacteria | 2528 |
| 47 | Ga0070663_100207633 | 3300005455 | Bacteria | 1532 |
| 48 | Ga0070662_100000025 | 3300005457 | Bacteria | 87144 |
| 49 | Ga0070662_100000754 | 3300005457 | Bacteria | 19853 |
| 50 | Ga0070662_100203475 | 3300005457 | Bacteria | 1572 |
| 51 | Ga0070662_100281061 | 3300005457 | Unclassified | 1347 |
| 52 | Ga0068867_100001136 | 3300005459 | Bacteria | 18183 |
| 53 | Ga0070679_100217877 | 3300005530 | Bacteria | 1871 |
| 54 | Ga0070684_100034038 | 3300005535 | Bacteria | 4354 |
| 55 | Ga0068853_100000061 | 3300005539 | Bacteria | 77461 |
| 56 | Ga0068853_100001421 | 3300005539 | Bacteria | 17280 |
| 57 | Ga0068853_100023528 | 3300005539 | Bacteria | 5159 |
| 58 | Ga0070672_100000380 | 3300005543 | Bacteria | 25710 |
| 59 | Ga0070672_100208277 | 3300005543 | Bacteria | 1637 |
| 60 | Ga0070693_100000099 | 3300005547 | Bacteria | 38227 |
| 61 | Ga0070665_100018531 | 3300005548 | Bacteria | 6976 |
| 62 | Ga0070665_100152191 | 3300005548 | Bacteria | 2316 |
| 63 | Ga0068855_100000326 | 3300005563 | Bacteria | 59175 |
| 64 | Ga0068855_100004003 | 3300005563 | Bacteria | 17987 |
| 65 | Ga0068855_100164850 | 3300005563 | Bacteria | 2513 |
| 66 | Ga0068855_100448538 | 3300005563 | Bacteria | 1408 |
| 67 | Ga0068855_100630129 | 3300005563 | Bacteria | 1154 |
| 68 | Ga0070664_100000012 | 3300005564 | Bacteria | 162011 |
| 69 | Ga0070664_100046793 | 3300005564 | Bacteria | 3655 |
| 70 | Ga0068857_100001277 | 3300005577 | Bacteria | 19756 |
| 71 | Ga0068854_100000414 | 3300005578 | Bacteria | 26795 |
| 72 | Ga0068854_100010995 | 3300005578 | Bacteria | 5874 |
| 73 | Ga0068854_100132997 | 3300005578 | Bacteria | 1901 |
| 74 | Ga0068856_100000552 | 3300005614 | Bacteria | 41305 |
| 75 | Ga0068856_100119246 | 3300005614 | Bacteria | 2639 |
| 76 | Ga0068856_100258045 | 3300005614 | Bacteria | 1758 |
| 77 | Ga0068852_100000798 | 3300005616 | Bacteria | 20761 |
| 78 | Ga0068852_100001871 | 3300005616 | Bacteria | 14319 |
| 79 | Ga0068852_100003753 | 3300005616 | Bacteria | 10652 |
| 80 | Ga0068859_100003855 | 3300005617 | Bacteria | 15323 |
| 81 | Ga0068859_100071314 | 3300005617 | Bacteria | 3510 |
| 82 | Ga0068864_100000181 | 3300005618 | Bacteria | 58221 |
| 83 | Ga0068864_100005111 | 3300005618 | Bacteria | 10750 |
| 84 | Ga0068866_10016012 | 3300005718 | Bacteria | 3343 |
| 85 | Ga0068851_10003152 | 3300005834 | Bacteria | 7313 |
| 86 | Ga0068851_10155937 | 3300005834 | Bacteria | 1251 |
| 87 | Ga0068851_10171815 | 3300005834 | Bacteria | 1196 |
| 88 | Ga0068870_10051221 | 3300005840 | Bacteria | 2185 |
| 89 | Ga0068863_100015205 | 3300005841 | Bacteria | 7395 |
| 90 | Ga0068863_100032851 | 3300005841 | Bacteria | 4944 |
| 91 | Ga0068858_100009555 | 3300005842 | Bacteria | 9252 |
| 92 | Ga0068858_100057853 | 3300005842 | Bacteria | 3583 |
| 93 | Ga0068860_100002079 | 3300005843 | Bacteria | 21111 |
| 94 | Ga0068862_100196124 | 3300005844 | Bacteria | 1819 |
| 95 | Ga0081539_10068042 | 3300005985 | Bacteria | 1923 |
| 96 | Ga0097621_100006011 | 3300006237 | Bacteria | 8579 |
| 97 | Ga0097621_100094166 | 3300006237 | Bacteria | 2511 |
| 98 | Ga0068871_100186316 | 3300006358 | Bacteria | 1786 |
| 99 | Ga0075428_100366736 | 3300006844 | Bacteria | 1545 |
| 100 | Ga0075431_100002685 | 3300006847 | Bacteria | 17242 |
| 101 | Ga0075429_100161232 | 3300006880 | Bacteria | 1964 |
| 102 | Ga0068865_100003204 | 3300006881 | Bacteria | 9801 |
| 103 | Ga0097620_100003855 | 3300006931 | Bacteria | 15323 |
| 104 | Ga0097620_100071313 | 3300006931 | Bacteria | 3510 |
| 105 | Ga0105240_10089604 | 3300009093 | Bacteria | 3762 |
| 106 | Ga0114129_10117872 | 3300009147 | Bacteria | 3657 |
| 107 | Ga0105241_10125022 | 3300009174 | Unclassified | 2076 |
| 108 | Ga0105248_10000256 | 3300009177 | Bacteria | 62138 |
| 109 | Ga0105248_10000258 | 3300009177 | Bacteria | 62009 |
| 110 | Ga0105248_10002873 | 3300009177 | Bacteria | 19111 |
| 111 | Ga0105237_10037162 | 3300009545 | Bacteria | 4923 |
| 112 | Ga0105238_10282553 | 3300009551 | Bacteria | 1641 |
| 113 | Ga0105239_10441754 | 3300010375 | Unclassified | 1475 |
| 114 | Ga0105246_10001846 | 3300011119 | Bacteria | 12718 |
| 115 | Ga0157373_10146130 | 3300013100 | Bacteria | 1663 |
| 116 | Ga0157373_10247795 | 3300013100 | Bacteria | 1260 |
| 117 | Ga0157371_10002034 | 3300013102 | Bacteria | 19934 |
| 118 | Ga0157371_10047082 | 3300013102 | Bacteria | 3065 |
| 119 | Ga0157371_10060270 | 3300013102 | Bacteria | 2691 |
| 120 | Ga0157370_10071368 | 3300013104 | Bacteria | 3276 |
| 121 | Ga0157369_10023360 | 3300013105 | Bacteria | 6887 |
| 122 | Ga0157369_10109208 | 3300013105 | Bacteria | 2941 |
| 123 | Ga0157369_10130688 | 3300013105 | Bacteria | 2661 |
| 124 | Ga0157374_10049727 | 3300013296 | Bacteria | 3895 |
| 125 | Ga0157378_10003594 | 3300013297 | Bacteria | 13726 |
| 126 | Ga0163162_10019623 | 3300013306 | Bacteria | 6636 |
| 127 | Ga0157372_10649377 | 3300013307 | Bacteria | 1229 |
| 128 | Ga0157372_10706260 | 3300013307 | Bacteria | 1173 |
| 129 | Ga0157375_10114619 | 3300013308 | Bacteria | 2797 |
| 130 | Ga0163163_10000222 | 3300014325 | Bacteria | 58432 |
| 131 | Ga0182008_10099320 | 3300014497 | Bacteria | 1438 |
| 132 | Ga0157377_10022226 | 3300014745 | Bacteria | 3346 |
| 133 | Ga0157379_10052259 | 3300014968 | Bacteria | 3650 |
| 134 | Ga0206353_11371531 | 3300020082 | Bacteria | 1390 |
| 135 | Ga0213875_10061567 | 3300021388 | Bacteria | 1755 |
| 136 | Ga0207697_10000007 | 3300025315 | Bacteria | 81785 |
| 137 | Ga0207656_10049741 | 3300025321 | Bacteria | 1808 |
| 138 | Ga0207656_10175425 | 3300025321 | Unclassified | 1026 |
| 139 | Ga0207688_10000318 | 3300025901 | Bacteria | 22194 |
| 140 | Ga0207647_10000052 | 3300025904 | Bacteria | 87651 |
| 141 | Ga0207647_10000769 | 3300025904 | Bacteria | 25007 |
| 142 | Ga0207647_10014842 | 3300025904 | Bacteria | 5358 |
| 143 | Ga0207647_10016896 | 3300025904 | Bacteria | 4970 |
| 144 | Ga0207647_10180146 | 3300025904 | Bacteria | 1228 |
| 145 | Ga0207645_10088344 | 3300025907 | Bacteria | 1992 |
| 146 | Ga0207645_10383984 | 3300025907 | Bacteria | 943 |
| 147 | Ga0207643_10101228 | 3300025908 | Bacteria | 1690 |
| 148 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 149 | Ga0207705_10012198 | 3300025909 | Bacteria | 6210 |
| 150 | Ga0207705_10049462 | 3300025909 | Bacteria | 3025 |
| 151 | Ga0207705_10056423 | 3300025909 | Bacteria | 2832 |
| 152 | Ga0207705_10087162 | 3300025909 | Bacteria | 2282 |
| 153 | Ga0207695_10047166 | 3300025913 | Bacteria | 4562 |
| 154 | Ga0207671_10110720 | 3300025914 | Bacteria | 2089 |
| 155 | Ga0207660_10009285 | 3300025917 | Bacteria | 6366 |
| 156 | Ga0207660_10029320 | 3300025917 | Bacteria | 3773 |
| 157 | Ga0207657_10000028 | 3300025919 | Bacteria | 141576 |
| 158 | Ga0207657_10000605 | 3300025919 | Bacteria | 38131 |
| 159 | Ga0207657_10014846 | 3300025919 | Bacteria | 7581 |
| 160 | Ga0207657_10016011 | 3300025919 | Bacteria | 7239 |
| 161 | Ga0207657_10097363 | 3300025919 | Bacteria | 2446 |
| 162 | Ga0207649_10003630 | 3300025920 | Bacteria | 8430 |
| 163 | Ga0207649_10053041 | 3300025920 | Bacteria | 2518 |
| 164 | Ga0207649_10336424 | 3300025920 | Bacteria | 1113 |
| 165 | Ga0207652_10031764 | 3300025921 | Bacteria | 4435 |
| 166 | Ga0207652_10328658 | 3300025921 | Bacteria | 1380 |
| 167 | Ga0207694_10121466 | 3300025924 | Bacteria | 2086 |
| 168 | Ga0207650_10005913 | 3300025925 | Bacteria | 8348 |
| 169 | Ga0207650_10033407 | 3300025925 | Bacteria | 3726 |
| 170 | Ga0207659_10071010 | 3300025926 | Bacteria | 2541 |
| 171 | Ga0207687_10001728 | 3300025927 | Bacteria | 15048 |
| 172 | Ga0207664_10205663 | 3300025929 | Bacteria | 1701 |
| 173 | Ga0207664_10212728 | 3300025929 | Bacteria | 1673 |
| 174 | Ga0207644_10004904 | 3300025931 | Bacteria | 8721 |
| 175 | Ga0207644_10463416 | 3300025931 | Bacteria | 1042 |
| 176 | Ga0207690_10000042 | 3300025932 | Bacteria | 120002 |
| 177 | Ga0207690_10004121 | 3300025932 | Bacteria | 8586 |
| 178 | Ga0207690_10004722 | 3300025932 | Bacteria | 8047 |
| 179 | Ga0207690_10008822 | 3300025932 | Bacteria | 5985 |
| 180 | Ga0207690_10015598 | 3300025932 | Bacteria | 4607 |
| 181 | Ga0207690_10052444 | 3300025932 | Bacteria | 2732 |
| 182 | Ga0207690_10245236 | 3300025932 | Bacteria | 1381 |
| 183 | Ga0207706_10000029 | 3300025933 | Bacteria | 146113 |
| 184 | Ga0207706_10000705 | 3300025933 | Bacteria | 34845 |
| 185 | Ga0207706_10066684 | 3300025933 | Bacteria | 3168 |
| 186 | Ga0207706_10177649 | 3300025933 | Bacteria | 1870 |
| 187 | Ga0207706_10226513 | 3300025933 | Unclassified | 1636 |
| 188 | Ga0207706_10311382 | 3300025933 | Bacteria | 1371 |
| 189 | Ga0207704_10002264 | 3300025938 | Bacteria | 8644 |
| 190 | Ga0207691_10001179 | 3300025940 | Bacteria | 25979 |
| 191 | Ga0207691_10087741 | 3300025940 | Bacteria | 2791 |
| 192 | Ga0207711_10000055 | 3300025941 | Bacteria | 136126 |
| 193 | Ga0207711_10000236 | 3300025941 | Bacteria | 59308 |
| 194 | Ga0207711_10005106 | 3300025941 | Bacteria | 11125 |
| 195 | Ga0207711_10588256 | 3300025941 | Bacteria | 1038 |
| 196 | Ga0207689_10000014 | 3300025942 | Bacteria | 122534 |
| 197 | Ga0207661_10002322 | 3300025944 | Bacteria | 13109 |
| 198 | Ga0207661_10074482 | 3300025944 | Bacteria | 2782 |
| 199 | Ga0207661_10716026 | 3300025944 | Bacteria | 921 |
| 200 | Ga0207679_10000092 | 3300025945 | Bacteria | 78331 |
| 201 | Ga0207679_10028494 | 3300025945 | Bacteria | 3876 |
| 202 | Ga0207679_10034079 | 3300025945 | Bacteria | 3590 |
| 203 | Ga0207667_10003943 | 3300025949 | Bacteria | 18261 |
| 204 | Ga0207667_10040823 | 3300025949 | Bacteria | 4938 |
| 205 | Ga0207667_10057585 | 3300025949 | Bacteria | 4079 |
| 206 | Ga0207667_10061069 | 3300025949 | Bacteria | 3944 |
| 207 | Ga0207667_10061381 | 3300025949 | Bacteria | 3932 |
| 208 | Ga0207667_10366954 | 3300025949 | Bacteria | 1468 |
| 209 | Ga0207667_10436608 | 3300025949 | Bacteria | 1331 |
| 210 | Ga0207651_10000658 | 3300025960 | Bacteria | 14705 |
| 211 | Ga0207651_10062157 | 3300025960 | Bacteria | 2601 |
| 212 | Ga0207668_10007132 | 3300025972 | Bacteria | 6634 |
| 213 | Ga0207640_10000404 | 3300025981 | Bacteria | 27391 |
| 214 | Ga0207658_10088299 | 3300025986 | Bacteria | 2396 |
| 215 | Ga0207677_10002334 | 3300026023 | Bacteria | 9959 |
| 216 | Ga0207703_10000933 | 3300026035 | Bacteria | 28397 |
| 217 | Ga0207703_10313243 | 3300026035 | Bacteria | 1435 |
| 218 | Ga0207639_10011266 | 3300026041 | Bacteria | 6204 |
| 219 | Ga0207639_10058905 | 3300026041 | Bacteria | 2956 |
| 220 | Ga0207639_10161898 | 3300026041 | Bacteria | 1886 |
| 221 | Ga0207639_10182092 | 3300026041 | Bacteria | 1788 |
| 222 | Ga0207678_10002375 | 3300026067 | Bacteria | 17077 |
| 223 | Ga0207678_10035928 | 3300026067 | Bacteria | 4313 |
| 224 | Ga0207702_10000581 | 3300026078 | Bacteria | 40736 |
| 225 | Ga0207702_10152993 | 3300026078 | Bacteria | 2100 |
| 226 | Ga0207702_10215918 | 3300026078 | Bacteria | 1785 |
| 227 | Ga0207641_10001015 | 3300026088 | Bacteria | 28538 |
| 228 | Ga0207641_10124452 | 3300026088 | Bacteria | 2306 |
| 229 | Ga0207641_10408670 | 3300026088 | Bacteria | 1305 |
| 230 | Ga0207648_10002058 | 3300026089 | Bacteria | 21922 |
| 231 | Ga0207676_10001627 | 3300026095 | Bacteria | 16557 |
| 232 | Ga0207674_10000244 | 3300026116 | Bacteria | 67590 |
| 233 | Ga0207674_10000324 | 3300026116 | Bacteria | 60949 |
| 234 | Ga0207674_10058998 | 3300026116 | Bacteria | 3885 |
| 235 | Ga0207675_100231023 | 3300026118 | Bacteria | 1785 |
| 236 | Ga0207698_10000394 | 3300026142 | Bacteria | 25237 |
| 237 | Ga0207698_10016448 | 3300026142 | Bacteria | 4986 |
| 238 | Ga0207698_10052764 | 3300026142 | Bacteria | 3117 |
| 239 | Ga0268266_10089523 | 3300028379 | Unclassified | 2695 |
| 240 | Ga0268265_10175326 | 3300028380 | Bacteria | 1837 |
| 241 | Ga0268264_10005146 | 3300028381 | Bacteria | 11082 |
| 242 | Ga0373954_0017143 | 3300035118 | Bacteria | 3249 |
| 243 | Ga0373960_0025387 | 3300035121 | Unclassified | 1611 |
| 244 | Ga0373943_0003608 | 3300035170 | Bacteria | 7041 |
| 245 | Ga0373955_0162589 | 3300035172 | Bacteria | 1318 |
| 246 | Ga0373933_0103076 | 3300035724 | Bacteria | 1772 |
| 247 | Ga0373947_0014235 | 3300035725 | Bacteria | 4562 |
| 248 | Ga0373937_0057127 | 3300036401 | Bacteria | 3584 |
| 249 | Ga0373925_0003697 | 3300037068 | Bacteria | 11750 |
| 250 | Ga0395899_0022345 | 3300037312 | Bacteria | 4796 |
| 251 | Ga0395899_0041066 | 3300037312 | Bacteria | 3457 |
| 252 | Ga0395899_0060441 | 3300037312 | Bacteria | 2792 |
| 253 | Ga0395900_0001516 | 3300037418 | Bacteria | 27574 |
| 254 | Ga0395900_0004238 | 3300037418 | Bacteria | 15223 |
| 255 | Ga0395900_0012249 | 3300037418 | Bacteria | 8768 |
| 256 | Ga0395900_0015624 | 3300037418 | Bacteria | 7738 |
| 257 | Ga0395900_0015888 | 3300037418 | Bacteria | 7668 |
| 258 | Ga0395900_0029255 | 3300037418 | Bacteria | 5651 |
| 259 | Ga0395900_0108310 | 3300037418 | Bacteria | 2854 |
| 260 | Ga0395900_0157338 | 3300037418 | Bacteria | 2320 |
| 261 | Ga0395900_0223346 | 3300037418 | Bacteria | 1897 |
| 262 | Ga0395900_0336548 | 3300037418 | Unclassified | 1486 |
| 263 | Ga0395900_0494918 | 3300037418 | Bacteria | 1173 |
| 264 | Ga0395900_0674470 | 3300037418 | Bacteria | 969 |
| 265 | Ga0395900_0890985 | 3300037418 | Unclassified | 813 |
| 266 | Ga0395898_0015681 | 3300037466 | Bacteria | 7765 |
| 267 | Ga0395898_0018469 | 3300037466 | Bacteria | 7110 |
| 268 | Ga0395898_0037493 | 3300037466 | Bacteria | 4808 |
| 269 | Ga0395898_0093418 | 3300037466 | Bacteria | 2891 |
| 270 | Ga0395898_0134680 | 3300037466 | Bacteria | 2365 |
| 271 | Ga0395898_0181855 | 3300037466 | Bacteria | 2009 |
| 272 | Ga0395898_0381870 | 3300037466 | Unclassified | 1343 |
| 273 | Ga0395898_0752787 | 3300037466 | Bacteria | 915 |
| 274 | Ga0395905_0000690 | 3300037471 | Bacteria | 44713 |
| 275 | Ga0395905_0002967 | 3300037471 | Bacteria | 18445 |
| 276 | Ga0395905_0014458 | 3300037471 | Bacteria | 7535 |
| 277 | Ga0395905_0016529 | 3300037471 | Bacteria | 7014 |
| 278 | Ga0395905_0022450 | 3300037471 | Bacteria | 5968 |
| 279 | Ga0395905_0028987 | 3300037471 | Bacteria | 5217 |
| 280 | Ga0395905_0036349 | 3300037471 | Bacteria | 4625 |
| 281 | Ga0395905_0047348 | 3300037471 | Bacteria | 4030 |
| 282 | Ga0395905_0057845 | 3300037471 | Bacteria | 3626 |
| 283 | Ga0395905_0091069 | 3300037471 | Bacteria | 2859 |
| 284 | Ga0395905_0104371 | 3300037471 | Bacteria | 2661 |
| 285 | Ga0395905_0225684 | 3300037471 | Bacteria | 1752 |
| 286 | Ga0395905_0354468 | 3300037471 | Bacteria | 1359 |
| 287 | Ga0395905_0366547 | 3300037471 | Bacteria | 1333 |
| 288 | Ga0395905_0486333 | 3300037471 | Bacteria | 1134 |
| 289 | Ga0395905_0563164 | 3300037471 | Bacteria | 1041 |
| 290 | Ga0436364_0272427 | 3300037853 | Bacteria | 4097 |
| 291 | Ga0395901_0002415 | 3300038443 | Bacteria | 18964 |
| 292 | Ga0395901_0008840 | 3300038443 | Bacteria | 10195 |
| 293 | Ga0395901_0017304 | 3300038443 | Bacteria | 7357 |
| 294 | Ga0395901_0035231 | 3300038443 | Bacteria | 5171 |
| 295 | Ga0395901_0043857 | 3300038443 | Bacteria | 4639 |
| 296 | Ga0395901_0068233 | 3300038443 | Bacteria | 3705 |
| 297 | Ga0395901_0299524 | 3300038443 | Bacteria | 1667 |
| 298 | Ga0395901_0302506 | 3300038443 | Bacteria | 1658 |
| 299 | Ga0395901_1015344 | 3300038443 | Bacteria | 804 |
| 300 | Ga0439455_0017692 | 3300042012 | Bacteria | 1664 |
| 301 | Ga0466966_0059736 | 3300044684 | Bacteria | 2407 |
| 302 | Ga0466966_0141419 | 3300044684 | Unclassified | 1470 |
| 303 | Ga0466961_0037917 | 3300044693 | Bacteria | 3092 |
| 304 | Ga0466961_0079881 | 3300044693 | Bacteria | 2071 |
| 305 | Ga0466961_0085045 | 3300044693 | Bacteria | 2000 |
| 306 | Ga0466961_0261455 | 3300044693 | Bacteria | 1061 |
| 307 | Ga0466964_0015028 | 3300044706 | Bacteria | 2949 |
| 308 | Ga0466968_0003640 | 3300044735 | Bacteria | 5713 |
| 309 | Ga0466970_0151013 | 3300044765 | Unclassified | 1282 |
| 310 | Ga0466957_0066426 | 3300044842 | Bacteria | 2223 |
| 311 | Ga0466959_0111740 | 3300045049 | Unclassified | 1949 |
| 312 | Ga0466959_0166412 | 3300045049 | Bacteria | 1548 |
| 313 | Ga0466958_0192227 | 3300045836 | Bacteria | 1297 |
| 314 | Ga0466967_0010171 | 3300045976 | Bacteria | 7037 |
| 315 | Ga0466967_0134302 | 3300045976 | Bacteria | 2300 |
| 316 | Ga0466967_0180981 | 3300045976 | Bacteria | 1988 |
| 317 | Ga0466967_0296263 | 3300045976 | Bacteria | 1555 |
| 318 | Ga0466967_0305694 | 3300045976 | Bacteria | 1531 |
| 319 | Ga0495621_0050338 | 3300046539 | Bacteria | 1489 |
| 320 | Ga0495668_0044364 | 3300046616 | Bacteria | 2471 |
| 321 | Ga0495623_0027424 | 3300046679 | Bacteria | 3665 |
| 322 | Ga0495602_0127086 | 3300048088 | Bacteria | 2040 |
| 323 | Ga0496100_0068172 | 3300048903 | Bacteria | 2365 |
| 324 | Ga0496101_0036612 | 3300048904 | Bacteria | 3476 |
| 325 | Ga0496106_0007658 | 3300048909 | Bacteria | 7991 |
| 326 | Ga0496107_0009885 | 3300048910 | Bacteria | 6616 |
| 327 | Ga0496107_0043069 | 3300048910 | Bacteria | 3243 |
| 328 | Ga0496107_0217737 | 3300048910 | Unclassified | 1420 |
| 329 | Ga0496108_0017496 | 3300048911 | Bacteria | 5864 |
| 330 | Ga0496109_0000617 | 3300048912 | Bacteria | 29636 |
| 331 | Ga0496110_0003274 | 3300048913 | Bacteria | 12352 |
| 332 | Ga0496111_0002692 | 3300048914 | Bacteria | 10794 |
| 333 | Ga0496112_0000133 | 3300048915 | Bacteria | 46286 |
| 334 | Ga0496112_0058328 | 3300048915 | Bacteria | 3801 |
| 335 | Ga0496125_0112103 | 3300048928 | Bacteria | 1972 |
| 336 | Ga0501074_0128951 | 3300049590 | Bacteria | 1810 |
| 337 | Ga0501080_0040203 | 3300049742 | Bacteria | 4363 |
| 338 | nmdc:mga09592_12850_c1 | 3300050508 | Bacteria | 6826 |
| 339 | nmdc:mga06r32_1695_c1 | 3300050510 | Bacteria | 19855 |
| 340 | Ga0495612_0158654 | 3300053078 | Bacteria | 987 |
| 341 | Ga0500645_002148 | 3300053730 | Bacteria | 9046 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0111740 | Ga0466959_0111740_340_1056 | 230 |
| 2 | 3300035172 | Ga0373955_0162589 | Ga0373955_0162589_39_737 | 232 |
| 3 | 3300044684 | Ga0466966_0141419 | Ga0466966_0141419_256_972 | 232 |
| 4 | iso_pu_bacteria | 2599185359 | 2600226610 | 232 |
| 5 | iso_pu_bacteria | 2818991466 | 2819713118 | 232 |
| 6 | 3300053730 | Ga0500645_002148 | Ga0500645_002148_1687_2448 | 235 |
| 7 | 3300048928 | Ga0496125_0112103 | Ga0496125_0112103_776_1495 | 236 |
| 8 | 3300005327 | Ga0070658_10000070 | Ga0070658_1000007038 | 237 |
| 9 | 3300021388 | Ga0213875_10061567 | Ga0213875_100615672 | 237 |
| 10 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002987 | 237 |
| 11 | 3300025919 | Ga0207657_10000605 | Ga0207657_1000060522 | 237 |
| 12 | 3300037853 | Ga0436364_0272427 | Ga0436364_0272427_1962_2705 | 237 |
| 13 | 3300005327 | Ga0070658_10316859 | Ga0070658_103168592 | 238 |
| 14 | 3300005328 | Ga0070676_10334922 | Ga0070676_103349222 | 238 |
| 15 | 3300005530 | Ga0070679_100217877 | Ga0070679_1002178772 | 238 |
| 16 | 3300005548 | Ga0070665_100152191 | Ga0070665_1001521912 | 238 |
| 17 | 3300005834 | Ga0068851_10155937 | Ga0068851_101559372 | 238 |
| 18 | 3300006844 | Ga0075428_100366736 | Ga0075428_1003667361 | 238 |
| 19 | 3300006847 | Ga0075431_100002685 | Ga0075431_1000026854 | 238 |
| 20 | 3300006880 | Ga0075429_100161232 | Ga0075429_1001612323 | 238 |
| 21 | 3300009147 | Ga0114129_10117872 | Ga0114129_101178722 | 238 |
| 22 | 3300013102 | Ga0157371_10047082 | Ga0157371_100470823 | 238 |
| 23 | 3300025907 | Ga0207645_10383984 | Ga0207645_103839841 | 238 |
| 24 | 3300025909 | Ga0207705_10087162 | Ga0207705_100871622 | 238 |
| 25 | 3300025921 | Ga0207652_10031764 | Ga0207652_100317642 | 238 |
| 26 | 3300025931 | Ga0207644_10463416 | Ga0207644_104634162 | 238 |
| 27 | 3300025941 | Ga0207711_10588256 | Ga0207711_105882562 | 238 |
| 28 | 3300026067 | Ga0207678_10035928 | Ga0207678_100359283 | 238 |
| 29 | 3300048915 | Ga0496112_0058328 | Ga0496112_0058328_2230_2979 | 238 |
| 30 | 3300050508 | nmdc:mga09592_12850_c1 | nmdc:mga09592_12850_c1_4044_4769 | 238 |
| 31 | 3300050510 | nmdc:mga06r32_1695_c1 | nmdc:mga06r32_1695_c1_12933_13658 | 238 |
| 32 | 3300026041 | Ga0207639_10161898 | Ga0207639_101618982 | 239 |
| 33 | 3300003322 | rootL2_10383060 | rootL2_103830602 | 240 |
| 34 | 3300005366 | Ga0070659_100009542 | Ga0070659_10000954210 | 240 |
| 35 | 3300009174 | Ga0105241_10125022 | Ga0105241_101250222 | 241 |
| 36 | 3300009177 | Ga0105248_10000258 | Ga0105248_1000025816 | 241 |
| 37 | 3300013296 | Ga0157374_10049727 | Ga0157374_100497272 | 241 |
| 38 | 3300014325 | Ga0163163_10000222 | Ga0163163_100002229 | 241 |
| 39 | 3300014968 | Ga0157379_10052259 | Ga0157379_100522592 | 241 |
| 40 | 3300035121 | Ga0373960_0025387 | Ga0373960_0025387_353_1078 | 241 |
| 41 | 3300037418 | Ga0395900_0494918 | Ga0395900_0494918_63_788 | 241 |
| 42 | 3300037466 | Ga0395898_0134680 | Ga0395898_0134680_383_1108 | 241 |
| 43 | 3300037471 | Ga0395905_0104371 | Ga0395905_0104371_1899_2624 | 241 |
| 44 | 3300038443 | Ga0395901_0043857 | Ga0395901_0043857_1536_2261 | 241 |
| 45 | 3300038443 | Ga0395901_1015344 | Ga0395901_1015344_63_788 | 241 |
| 46 | 3300048910 | Ga0496107_0217737 | Ga0496107_0217737_422_1147 | 241 |
| 47 | 3300005985 | Ga0081539_10068042 | Ga0081539_100680422 | 242 |
| 48 | 3300006237 | Ga0097621_100094166 | Ga0097621_1000941663 | 242 |
| 49 | 3300006358 | Ga0068871_100186316 | Ga0068871_1001863162 | 242 |
| 50 | 3300014497 | Ga0182008_10099320 | Ga0182008_100993202 | 242 |
| 51 | 3300035170 | Ga0373943_0003608 | Ga0373943_0003608_1425_2162 | 242 |
| 52 | 3300035725 | Ga0373947_0014235 | Ga0373947_0014235_876_1613 | 242 |
| 53 | 3300037068 | Ga0373925_0003697 | Ga0373925_0003697_2057_2794 | 242 |
| 54 | 3300037312 | Ga0395899_0041066 | Ga0395899_0041066_1360_2097 | 242 |
| 55 | 3300037312 | Ga0395899_0060441 | Ga0395899_0060441_1755_2492 | 242 |
| 56 | 3300037418 | Ga0395900_0001516 | Ga0395900_0001516_8997_9734 | 242 |
| 57 | 3300037418 | Ga0395900_0015888 | Ga0395900_0015888_4042_4779 | 242 |
| 58 | 3300037418 | Ga0395900_0157338 | Ga0395900_0157338_1103_1840 | 242 |
| 59 | 3300037418 | Ga0395900_0336548 | Ga0395900_0336548_151_888 | 242 |
| 60 | 3300037418 | Ga0395900_0890985 | Ga0395900_0890985_46_783 | 242 |
| 61 | 3300037466 | Ga0395898_0018469 | Ga0395898_0018469_1732_2469 | 242 |
| 62 | 3300037466 | Ga0395898_0037493 | Ga0395898_0037493_1072_1809 | 242 |
| 63 | 3300037466 | Ga0395898_0381870 | Ga0395898_0381870_385_1122 | 242 |
| 64 | 3300037471 | Ga0395905_0002967 | Ga0395905_0002967_6985_7722 | 242 |
| 65 | 3300037471 | Ga0395905_0028987 | Ga0395905_0028987_2711_3448 | 242 |
| 66 | 3300037471 | Ga0395905_0047348 | Ga0395905_0047348_1025_1762 | 242 |
| 67 | 3300037471 | Ga0395905_0225684 | Ga0395905_0225684_707_1441 | 242 |
| 68 | 3300038443 | Ga0395901_0035231 | Ga0395901_0035231_1080_1817 | 242 |
| 69 | 3300044684 | Ga0466966_0059736 | Ga0466966_0059736_1492_2229 | 242 |
| 70 | 3300044693 | Ga0466961_0037917 | Ga0466961_0037917_1232_2005 | 242 |
| 71 | 3300044693 | Ga0466961_0079881 | Ga0466961_0079881_403_1134 | 242 |
| 72 | 3300044693 | Ga0466961_0085045 | Ga0466961_0085045_450_1187 | 242 |
| 73 | 3300044693 | Ga0466961_0261455 | Ga0466961_0261455_304_1041 | 242 |
| 74 | 3300044765 | Ga0466970_0151013 | Ga0466970_0151013_339_1076 | 242 |
| 75 | 3300044842 | Ga0466957_0066426 | Ga0466957_0066426_826_1563 | 242 |
| 76 | 3300045836 | Ga0466958_0192227 | Ga0466958_0192227_384_1121 | 242 |
| 77 | 3300045976 | Ga0466967_0180981 | Ga0466967_0180981_590_1327 | 242 |
| 78 | 3300045976 | Ga0466967_0305694 | Ga0466967_0305694_162_899 | 242 |
| 79 | 3300005329 | Ga0070683_100039160 | Ga0070683_1000391608 | 243 |
| 80 | 3300005336 | Ga0070680_100013806 | Ga0070680_1000138062 | 243 |
| 81 | 3300005341 | Ga0070691_10000243 | Ga0070691_100002438 | 243 |
| 82 | 3300005344 | Ga0070661_100035757 | Ga0070661_1000357572 | 243 |
| 83 | 3300005435 | Ga0070714_100112089 | Ga0070714_1001120893 | 243 |
| 84 | 3300005455 | Ga0070663_100071326 | Ga0070663_1000713262 | 243 |
| 85 | 3300005455 | Ga0070663_100207633 | Ga0070663_1002076332 | 243 |
| 86 | 3300005535 | Ga0070684_100034038 | Ga0070684_1000340382 | 243 |
| 87 | 3300005578 | Ga0068854_100010995 | Ga0068854_1000109952 | 243 |
| 88 | 3300005834 | Ga0068851_10171815 | Ga0068851_101718152 | 243 |
| 89 | 3300009093 | Ga0105240_10089604 | Ga0105240_100896042 | 243 |
| 90 | 3300009545 | Ga0105237_10037162 | Ga0105237_100371627 | 243 |
| 91 | 3300009551 | Ga0105238_10282553 | Ga0105238_102825532 | 243 |
| 92 | 3300013105 | Ga0157369_10130688 | Ga0157369_101306882 | 243 |
| 93 | 3300025321 | Ga0207656_10049741 | Ga0207656_100497412 | 243 |
| 94 | 3300025904 | Ga0207647_10000769 | Ga0207647_1000076911 | 243 |
| 95 | 3300025909 | Ga0207705_10049462 | Ga0207705_100494622 | 243 |
| 96 | 3300025913 | Ga0207695_10047166 | Ga0207695_100471662 | 243 |
| 97 | 3300025914 | Ga0207671_10110720 | Ga0207671_101107203 | 243 |
| 98 | 3300025919 | Ga0207657_10097363 | Ga0207657_100973632 | 243 |
| 99 | 3300025920 | Ga0207649_10053041 | Ga0207649_100530412 | 243 |
| 100 | 3300025924 | Ga0207694_10121466 | Ga0207694_101214661 | 243 |
| 101 | 3300025932 | Ga0207690_10008822 | Ga0207690_100088222 | 243 |
| 102 | 3300025933 | Ga0207706_10311382 | Ga0207706_103113822 | 243 |
| 103 | 3300025945 | Ga0207679_10028494 | Ga0207679_100284944 | 243 |
| 104 | 3300025949 | Ga0207667_10061069 | Ga0207667_100610693 | 243 |
| 105 | 3300025949 | Ga0207667_10061381 | Ga0207667_100613813 | 243 |
| 106 | 3300026041 | Ga0207639_10058905 | Ga0207639_100589052 | 243 |
| 107 | 3300026078 | Ga0207702_10152993 | Ga0207702_101529932 | 243 |
| 108 | 3300026078 | Ga0207702_10215918 | Ga0207702_102159182 | 243 |
| 109 | 3300026116 | Ga0207674_10058998 | Ga0207674_100589985 | 243 |
| 110 | 3300026142 | Ga0207698_10052764 | Ga0207698_100527643 | 243 |
| 111 | 3300037312 | Ga0395899_0022345 | Ga0395899_0022345_2407_3147 | 243 |
| 112 | 3300037418 | Ga0395900_0223346 | Ga0395900_0223346_889_1629 | 243 |
| 113 | 3300037466 | Ga0395898_0015681 | Ga0395898_0015681_4661_5401 | 243 |
| 114 | 3300037471 | Ga0395905_0016529 | Ga0395905_0016529_2634_3374 | 243 |
| 115 | 3300044706 | Ga0466964_0015028 | Ga0466964_0015028_1623_2363 | 243 |
| 116 | 3300044735 | Ga0466968_0003640 | Ga0466968_0003640_3619_4359 | 243 |
| 117 | 3300045049 | Ga0466959_0166412 | Ga0466959_0166412_171_911 | 243 |
| 118 | 3300045976 | Ga0466967_0134302 | Ga0466967_0134302_916_1656 | 243 |
| 119 | 3300046539 | Ga0495621_0050338 | Ga0495621_0050338_721_1464 | 243 |
| 120 | 3300046616 | Ga0495668_0044364 | Ga0495668_0044364_120_965 | 243 |
| 121 | 3300005457 | Ga0070662_100203475 | Ga0070662_1002034752 | 247 |
| 122 | 3300025933 | Ga0207706_10177649 | Ga0207706_101776493 | 247 |
| 123 | 3300005327 | Ga0070658_10000087 | Ga0070658_1000008743 | 248 |
| 124 | 3300005329 | Ga0070683_100000466 | Ga0070683_1000004666 | 248 |
| 125 | 3300005331 | Ga0070670_100021260 | Ga0070670_1000212602 | 248 |
| 126 | 3300005335 | Ga0070666_10000190 | Ga0070666_1000019014 | 248 |
| 127 | 3300005337 | Ga0070682_100033436 | Ga0070682_1000334362 | 248 |
| 128 | 3300005339 | Ga0070660_100000084 | Ga0070660_10000008411 | 248 |
| 129 | 3300005344 | Ga0070661_100000050 | Ga0070661_10000005033 | 248 |
| 130 | 3300005355 | Ga0070671_100002187 | Ga0070671_1000021878 | 248 |
| 131 | 3300005366 | Ga0070659_100000117 | Ga0070659_10000011710 | 248 |
| 132 | 3300005455 | Ga0070663_100000295 | Ga0070663_1000002957 | 248 |
| 133 | 3300005457 | Ga0070662_100000025 | Ga0070662_10000002551 | 248 |
| 134 | 3300005539 | Ga0068853_100000061 | Ga0068853_10000006144 | 248 |
| 135 | 3300005547 | Ga0070693_100000099 | Ga0070693_1000000999 | 248 |
| 136 | 3300005548 | Ga0070665_100018531 | Ga0070665_1000185314 | 248 |
| 137 | 3300005563 | Ga0068855_100000326 | Ga0068855_10000032633 | 248 |
| 138 | 3300005563 | Ga0068855_100164850 | Ga0068855_1001648502 | 248 |
| 139 | 3300005563 | Ga0068855_100630129 | Ga0068855_1006301292 | 248 |
| 140 | 3300005564 | Ga0070664_100000012 | Ga0070664_10000001253 | 248 |
| 141 | 3300005578 | Ga0068854_100132997 | Ga0068854_1001329972 | 248 |
| 142 | 3300005614 | Ga0068856_100000552 | Ga0068856_10000055214 | 248 |
| 143 | 3300005614 | Ga0068856_100258045 | Ga0068856_1002580452 | 248 |
| 144 | 3300005616 | Ga0068852_100001871 | Ga0068852_1000018719 | 248 |
| 145 | 3300005617 | Ga0068859_100071314 | Ga0068859_1000713142 | 248 |
| 146 | 3300005834 | Ga0068851_10003152 | Ga0068851_100031523 | 248 |
| 147 | 3300005841 | Ga0068863_100032851 | Ga0068863_1000328515 | 248 |
| 148 | 3300005842 | Ga0068858_100057853 | Ga0068858_1000578534 | 248 |
| 149 | 3300005844 | Ga0068862_100196124 | Ga0068862_1001961242 | 248 |
| 150 | 3300006931 | Ga0097620_100071313 | Ga0097620_1000713132 | 248 |
| 151 | 3300025919 | Ga0207657_10000028 | Ga0207657_1000002872 | 248 |
| 152 | 3300025920 | Ga0207649_10003630 | Ga0207649_100036302 | 248 |
| 153 | 3300025925 | Ga0207650_10033407 | Ga0207650_100334074 | 248 |
| 154 | 3300025931 | Ga0207644_10004904 | Ga0207644_100049044 | 248 |
| 155 | 3300025932 | Ga0207690_10000042 | Ga0207690_1000004221 | 248 |
| 156 | 3300025932 | Ga0207690_10015598 | Ga0207690_100155982 | 248 |
| 157 | 3300025933 | Ga0207706_10000029 | Ga0207706_1000002977 | 248 |
| 158 | 3300025941 | Ga0207711_10000236 | Ga0207711_1000023616 | 248 |
| 159 | 3300025944 | Ga0207661_10002322 | Ga0207661_100023228 | 248 |
| 160 | 3300025945 | Ga0207679_10000092 | Ga0207679_1000009242 | 248 |
| 161 | 3300025949 | Ga0207667_10057585 | Ga0207667_100575852 | 248 |
| 162 | 3300026035 | Ga0207703_10313243 | Ga0207703_103132432 | 248 |
| 163 | 3300026067 | Ga0207678_10002375 | Ga0207678_100023752 | 248 |
| 164 | 3300026078 | Ga0207702_10000581 | Ga0207702_1000058113 | 248 |
| 165 | 3300026088 | Ga0207641_10124452 | Ga0207641_101244522 | 248 |
| 166 | 3300026088 | Ga0207641_10408670 | Ga0207641_104086701 | 248 |
| 167 | 3300026116 | Ga0207674_10000324 | Ga0207674_1000032430 | 248 |
| 168 | 3300026118 | Ga0207675_100231023 | Ga0207675_1002310232 | 248 |
| 169 | 3300026142 | Ga0207698_10016448 | Ga0207698_100164482 | 248 |
| 170 | 3300028379 | Ga0268266_10089523 | Ga0268266_100895233 | 248 |
| 171 | 3300028380 | Ga0268265_10175326 | Ga0268265_101753262 | 248 |
| 172 | 3300037471 | Ga0395905_0036349 | Ga0395905_0036349_2307_3053 | 248 |
| 173 | 3300037471 | Ga0395905_0563164 | Ga0395905_0563164_232_978 | 248 |
| 174 | 3300045976 | Ga0466967_0010171 | Ga0466967_0010171_3867_4613 | 248 |
| 175 | 3300045976 | Ga0466967_0296263 | Ga0466967_0296263_203_949 | 248 |
| 176 | 3300049590 | Ga0501074_0128951 | Ga0501074_0128951_850_1596 | 248 |
| 177 | 3300049742 | Ga0501080_0040203 | Ga0501080_0040203_1714_2460 | 248 |
| 178 | 3300001990 | JGI24737J22298_10001519 | JGI24737J22298_100015194 | 249 |
| 179 | 3300005364 | Ga0070673_100205477 | Ga0070673_1002054771 | 249 |
| 180 | 3300005366 | Ga0070659_100004291 | Ga0070659_1000042913 | 249 |
| 181 | 3300005539 | Ga0068853_100023528 | Ga0068853_1000235284 | 249 |
| 182 | 3300025904 | Ga0207647_10014842 | Ga0207647_100148423 | 249 |
| 183 | 3300025904 | Ga0207647_10180146 | Ga0207647_101801461 | 249 |
| 184 | 3300025932 | Ga0207690_10004121 | Ga0207690_100041213 | 249 |
| 185 | 3300025933 | Ga0207706_10066684 | Ga0207706_100666842 | 249 |
| 186 | 3300026041 | Ga0207639_10182092 | Ga0207639_101820922 | 249 |
| 187 | 3300035118 | Ga0373954_0017143 | Ga0373954_0017143_955_1704 | 249 |
| 188 | 3300035724 | Ga0373933_0103076 | Ga0373933_0103076_164_913 | 249 |
| 189 | 3300036401 | Ga0373937_0057127 | Ga0373937_0057127_2684_3433 | 249 |
| 190 | 3300037418 | Ga0395900_0004238 | Ga0395900_0004238_1576_2325 | 249 |
| 191 | 3300037418 | Ga0395900_0029255 | Ga0395900_0029255_287_1036 | 249 |
| 192 | 3300037418 | Ga0395900_0674470 | Ga0395900_0674470_135_893 | 249 |
| 193 | 3300037466 | Ga0395898_0093418 | Ga0395898_0093418_1055_1804 | 249 |
| 194 | 3300037471 | Ga0395905_0000690 | Ga0395905_0000690_13555_14304 | 249 |
| 195 | 3300037471 | Ga0395905_0022450 | Ga0395905_0022450_435_1184 | 249 |
| 196 | 3300037471 | Ga0395905_0057845 | Ga0395905_0057845_1433_2182 | 249 |
| 197 | 3300037471 | Ga0395905_0091069 | Ga0395905_0091069_1056_1805 | 249 |
| 198 | 3300037471 | Ga0395905_0486333 | Ga0395905_0486333_210_959 | 249 |
| 199 | 3300038443 | Ga0395901_0008840 | Ga0395901_0008840_4494_5243 | 249 |
| 200 | 3300038443 | Ga0395901_0017304 | Ga0395901_0017304_1729_2478 | 249 |
| 201 | 3300038443 | Ga0395901_0068233 | Ga0395901_0068233_1381_2130 | 249 |
| 202 | 3300038443 | Ga0395901_0299524 | Ga0395901_0299524_184_933 | 249 |
| 203 | 3300038443 | Ga0395901_0302506 | Ga0395901_0302506_740_1489 | 249 |
| 204 | 3300042012 | Ga0439455_0017692 | Ga0439455_0017692_708_1457 | 249 |
| 205 | 3300046679 | Ga0495623_0027424 | Ga0495623_0027424_737_1486 | 249 |
| 206 | 3300048088 | Ga0495602_0127086 | Ga0495602_0127086_408_1157 | 249 |
| 207 | 3300048910 | Ga0496107_0043069 | Ga0496107_0043069_401_1159 | 249 |
| 208 | 3300053078 | Ga0495612_0158654 | Ga0495612_0158654_103_852 | 249 |
| 209 | 3300001979 | JGI24740J21852_10002116 | JGI24740J21852_100021163 | 250 |
| 210 | 3300001990 | JGI24737J22298_10000020 | JGI24737J22298_1000002043 | 250 |
| 211 | 3300002075 | JGI24738J21930_10000048 | JGI24738J21930_1000004811 | 250 |
| 212 | 3300002077 | JGI24744J21845_10029844 | JGI24744J21845_100298442 | 250 |
| 213 | 3300005328 | Ga0070676_10401075 | Ga0070676_104010751 | 250 |
| 214 | 3300005330 | Ga0070690_100115428 | Ga0070690_1001154282 | 250 |
| 215 | 3300005331 | Ga0070670_100007698 | Ga0070670_1000076985 | 250 |
| 216 | 3300005334 | Ga0068869_100000043 | Ga0068869_1000000437 | 250 |
| 217 | 3300005338 | Ga0068868_100000957 | Ga0068868_10000095719 | 250 |
| 218 | 3300005339 | Ga0070660_100010511 | Ga0070660_1000105112 | 250 |
| 219 | 3300005339 | Ga0070660_100423490 | Ga0070660_1004234902 | 250 |
| 220 | 3300005340 | Ga0070689_100015984 | Ga0070689_1000159846 | 250 |
| 221 | 3300005344 | Ga0070661_100114836 | Ga0070661_1001148363 | 250 |
| 222 | 3300005345 | Ga0070692_10050462 | Ga0070692_100504622 | 250 |
| 223 | 3300005347 | Ga0070668_100012011 | Ga0070668_1000120115 | 250 |
| 224 | 3300005354 | Ga0070675_100004988 | Ga0070675_1000049887 | 250 |
| 225 | 3300005364 | Ga0070673_100000354 | Ga0070673_10000035418 | 250 |
| 226 | 3300005364 | Ga0070673_100060942 | Ga0070673_1000609422 | 250 |
| 227 | 3300005366 | Ga0070659_100000463 | Ga0070659_1000004636 | 250 |
| 228 | 3300005367 | Ga0070667_100003563 | Ga0070667_1000035634 | 250 |
| 229 | 3300005435 | Ga0070714_100055025 | Ga0070714_1000550254 | 250 |
| 230 | 3300005435 | Ga0070714_100056872 | Ga0070714_1000568722 | 250 |
| 231 | 3300005457 | Ga0070662_100000754 | Ga0070662_10000075418 | 250 |
| 232 | 3300005457 | Ga0070662_100281061 | Ga0070662_1002810612 | 250 |
| 233 | 3300005459 | Ga0068867_100001136 | Ga0068867_10000113613 | 250 |
| 234 | 3300005539 | Ga0068853_100001421 | Ga0068853_1000014212 | 250 |
| 235 | 3300005543 | Ga0070672_100000380 | Ga0070672_1000003806 | 250 |
| 236 | 3300005543 | Ga0070672_100208277 | Ga0070672_1002082772 | 250 |
| 237 | 3300005563 | Ga0068855_100004003 | Ga0068855_10000400313 | 250 |
| 238 | 3300005563 | Ga0068855_100448538 | Ga0068855_1004485382 | 250 |
| 239 | 3300005564 | Ga0070664_100046793 | Ga0070664_1000467933 | 250 |
| 240 | 3300005577 | Ga0068857_100001277 | Ga0068857_1000012776 | 250 |
| 241 | 3300005578 | Ga0068854_100000414 | Ga0068854_10000041413 | 250 |
| 242 | 3300005614 | Ga0068856_100119246 | Ga0068856_1001192462 | 250 |
| 243 | 3300005616 | Ga0068852_100000798 | Ga0068852_10000079818 | 250 |
| 244 | 3300005616 | Ga0068852_100003753 | Ga0068852_1000037537 | 250 |
| 245 | 3300005617 | Ga0068859_100003855 | Ga0068859_1000038557 | 250 |
| 246 | 3300005618 | Ga0068864_100000181 | Ga0068864_10000018150 | 250 |
| 247 | 3300005618 | Ga0068864_100005111 | Ga0068864_1000051116 | 250 |
| 248 | 3300005718 | Ga0068866_10016012 | Ga0068866_100160124 | 250 |
| 249 | 3300005840 | Ga0068870_10051221 | Ga0068870_100512212 | 250 |
| 250 | 3300005841 | Ga0068863_100015205 | Ga0068863_1000152052 | 250 |
| 251 | 3300005842 | Ga0068858_100009555 | Ga0068858_1000095557 | 250 |
| 252 | 3300005843 | Ga0068860_100002079 | Ga0068860_1000020794 | 250 |
| 253 | 3300006237 | Ga0097621_100006011 | Ga0097621_1000060113 | 250 |
| 254 | 3300006881 | Ga0068865_100003204 | Ga0068865_10000320410 | 250 |
| 255 | 3300006931 | Ga0097620_100003855 | Ga0097620_1000038557 | 250 |
| 256 | 3300009177 | Ga0105248_10000256 | Ga0105248_1000025660 | 250 |
| 257 | 3300009177 | Ga0105248_10002873 | Ga0105248_100028736 | 250 |
| 258 | 3300010375 | Ga0105239_10441754 | Ga0105239_104417542 | 250 |
| 259 | 3300011119 | Ga0105246_10001846 | Ga0105246_100018465 | 250 |
| 260 | 3300013100 | Ga0157373_10146130 | Ga0157373_101461302 | 250 |
| 261 | 3300013100 | Ga0157373_10247795 | Ga0157373_102477952 | 250 |
| 262 | 3300013102 | Ga0157371_10002034 | Ga0157371_100020346 | 250 |
| 263 | 3300013102 | Ga0157371_10060270 | Ga0157371_100602702 | 250 |
| 264 | 3300013104 | Ga0157370_10071368 | Ga0157370_100713684 | 250 |
| 265 | 3300013105 | Ga0157369_10023360 | Ga0157369_100233605 | 250 |
| 266 | 3300013105 | Ga0157369_10109208 | Ga0157369_101092082 | 250 |
| 267 | 3300013297 | Ga0157378_10003594 | Ga0157378_1000359413 | 250 |
| 268 | 3300013306 | Ga0163162_10019623 | Ga0163162_100196232 | 250 |
| 269 | 3300013307 | Ga0157372_10649377 | Ga0157372_106493772 | 250 |
| 270 | 3300013307 | Ga0157372_10706260 | Ga0157372_107062602 | 250 |
| 271 | 3300013308 | Ga0157375_10114619 | Ga0157375_101146192 | 250 |
| 272 | 3300014745 | Ga0157377_10022226 | Ga0157377_100222262 | 250 |
| 273 | 3300020082 | Ga0206353_11371531 | Ga0206353_113715312 | 250 |
| 274 | 3300025315 | Ga0207697_10000007 | Ga0207697_1000000777 | 250 |
| 275 | 3300025321 | Ga0207656_10175425 | Ga0207656_101754252 | 250 |
| 276 | 3300025901 | Ga0207688_10000318 | Ga0207688_100003184 | 250 |
| 277 | 3300025904 | Ga0207647_10000052 | Ga0207647_100000526 | 250 |
| 278 | 3300025904 | Ga0207647_10016896 | Ga0207647_100168964 | 250 |
| 279 | 3300025907 | Ga0207645_10088344 | Ga0207645_100883441 | 250 |
| 280 | 3300025908 | Ga0207643_10101228 | Ga0207643_101012282 | 250 |
| 281 | 3300025909 | Ga0207705_10012198 | Ga0207705_100121982 | 250 |
| 282 | 3300025909 | Ga0207705_10056423 | Ga0207705_100564234 | 250 |
| 283 | 3300025917 | Ga0207660_10009285 | Ga0207660_100092854 | 250 |
| 284 | 3300025917 | Ga0207660_10029320 | Ga0207660_100293202 | 250 |
| 285 | 3300025919 | Ga0207657_10014846 | Ga0207657_100148463 | 250 |
| 286 | 3300025919 | Ga0207657_10016011 | Ga0207657_100160116 | 250 |
| 287 | 3300025920 | Ga0207649_10336424 | Ga0207649_103364242 | 250 |
| 288 | 3300025921 | Ga0207652_10328658 | Ga0207652_103286582 | 250 |
| 289 | 3300025925 | Ga0207650_10005913 | Ga0207650_100059134 | 250 |
| 290 | 3300025926 | Ga0207659_10071010 | Ga0207659_100710102 | 250 |
| 291 | 3300025927 | Ga0207687_10001728 | Ga0207687_100017286 | 250 |
| 292 | 3300025929 | Ga0207664_10205663 | Ga0207664_102056632 | 250 |
| 293 | 3300025929 | Ga0207664_10212728 | Ga0207664_102127282 | 250 |
| 294 | 3300025932 | Ga0207690_10004722 | Ga0207690_100047222 | 250 |
| 295 | 3300025932 | Ga0207690_10052444 | Ga0207690_100524442 | 250 |
| 296 | 3300025932 | Ga0207690_10245236 | Ga0207690_102452362 | 250 |
| 297 | 3300025933 | Ga0207706_10000705 | Ga0207706_1000070527 | 250 |
| 298 | 3300025933 | Ga0207706_10226513 | Ga0207706_102265132 | 250 |
| 299 | 3300025938 | Ga0207704_10002264 | Ga0207704_100022642 | 250 |
| 300 | 3300025940 | Ga0207691_10001179 | Ga0207691_1000117920 | 250 |
| 301 | 3300025940 | Ga0207691_10087741 | Ga0207691_100877413 | 250 |
| 302 | 3300025941 | Ga0207711_10000055 | Ga0207711_1000005532 | 250 |
| 303 | 3300025941 | Ga0207711_10005106 | Ga0207711_100051066 | 250 |
| 304 | 3300025942 | Ga0207689_10000014 | Ga0207689_10000014112 | 250 |
| 305 | 3300025944 | Ga0207661_10074482 | Ga0207661_100744822 | 250 |
| 306 | 3300025944 | Ga0207661_10716026 | Ga0207661_107160261 | 250 |
| 307 | 3300025945 | Ga0207679_10034079 | Ga0207679_100340793 | 250 |
| 308 | 3300025949 | Ga0207667_10003943 | Ga0207667_1000394319 | 250 |
| 309 | 3300025949 | Ga0207667_10040823 | Ga0207667_100408232 | 250 |
| 310 | 3300025949 | Ga0207667_10366954 | Ga0207667_103669542 | 250 |
| 311 | 3300025949 | Ga0207667_10436608 | Ga0207667_104366082 | 250 |
| 312 | 3300025960 | Ga0207651_10000658 | Ga0207651_100006586 | 250 |
| 313 | 3300025960 | Ga0207651_10062157 | Ga0207651_100621572 | 250 |
| 314 | 3300025972 | Ga0207668_10007132 | Ga0207668_100071325 | 250 |
| 315 | 3300025981 | Ga0207640_10000404 | Ga0207640_100004042 | 250 |
| 316 | 3300025986 | Ga0207658_10088299 | Ga0207658_100882992 | 250 |
| 317 | 3300026023 | Ga0207677_10002334 | Ga0207677_100023346 | 250 |
| 318 | 3300026035 | Ga0207703_10000933 | Ga0207703_100009336 | 250 |
| 319 | 3300026041 | Ga0207639_10011266 | Ga0207639_100112664 | 250 |
| 320 | 3300026088 | Ga0207641_10001015 | Ga0207641_100010156 | 250 |
| 321 | 3300026089 | Ga0207648_10002058 | Ga0207648_1000205818 | 250 |
| 322 | 3300026095 | Ga0207676_10001627 | Ga0207676_1000162711 | 250 |
| 323 | 3300026116 | Ga0207674_10000244 | Ga0207674_1000024460 | 250 |
| 324 | 3300026142 | Ga0207698_10000394 | Ga0207698_100003945 | 250 |
| 325 | 3300028381 | Ga0268264_10005146 | Ga0268264_100051466 | 250 |
| 326 | 3300037418 | Ga0395900_0012249 | Ga0395900_0012249_969_1721 | 250 |
| 327 | 3300037418 | Ga0395900_0015624 | Ga0395900_0015624_6347_7099 | 250 |
| 328 | 3300037418 | Ga0395900_0108310 | Ga0395900_0108310_1130_1882 | 250 |
| 329 | 3300037466 | Ga0395898_0181855 | Ga0395898_0181855_97_849 | 250 |
| 330 | 3300037466 | Ga0395898_0752787 | Ga0395898_0752787_98_850 | 250 |
| 331 | 3300037471 | Ga0395905_0014458 | Ga0395905_0014458_2506_3258 | 250 |
| 332 | 3300037471 | Ga0395905_0354468 | Ga0395905_0354468_531_1283 | 250 |
| 333 | 3300037471 | Ga0395905_0366547 | Ga0395905_0366547_404_1156 | 250 |
| 334 | 3300038443 | Ga0395901_0002415 | Ga0395901_0002415_5481_6233 | 250 |
| 335 | 3300048903 | Ga0496100_0068172 | Ga0496100_0068172_896_1663 | 250 |
| 336 | 3300048904 | Ga0496101_0036612 | Ga0496101_0036612_293_1060 | 250 |
| 337 | 3300048909 | Ga0496106_0007658 | Ga0496106_0007658_3210_3977 | 250 |
| 338 | 3300048910 | Ga0496107_0009885 | Ga0496107_0009885_356_1123 | 250 |
| 339 | 3300048911 | Ga0496108_0017496 | Ga0496108_0017496_3135_3902 | 250 |
| 340 | 3300048912 | Ga0496109_0000617 | Ga0496109_0000617_21930_22697 | 250 |
| 341 | 3300048913 | Ga0496110_0003274 | Ga0496110_0003274_3391_4158 | 250 |
| 342 | 3300048914 | Ga0496111_0002692 | Ga0496111_0002692_505_1272 | 250 |
| 343 | 3300048915 | Ga0496112_0000133 | Ga0496112_0000133_8698_9465 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4iyj-assembly1.cif.gz_B | crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution | 0.9277 | 46 | 246 |
| 3p94-assembly1.cif.gz_A | crystal structure of a gdsl-like lipase (bdi_0976) from parabacteroides distasonis atcc 8503 at 1.93 a resolution | 0.9247 | 47 | 246 |
| 3p94-assembly1.cif.gz_A | crystal structure of a gdsl-like lipase (bdi_0976) from parabacteroides distasonis atcc 8503 at 1.93 a resolution | 0.8946 | 47 | 246 |
| 4iyj-assembly1.cif.gz_B | crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution | 0.8938 | 46 | 246 |
| 4hf7-assembly1.cif.gz_A-2 | crystal structure of a gdsl-like lipase (bt0569) from bacteroides thetaiotaomicron vpi-5482 at 1.77 a resolution | 0.8878 | 47 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3p94D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.9153 | 47 | 246 | 3.40.50.1110 |
| 3p94D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.8976 | 47 | 246 | 3.40.50.1110 |
| 4rshA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.7974 | 68 | 246 | 3.40.50.1110 |
| 4rshA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.7849 | 68 | 246 | 3.40.50.1110 |
| af_Q9VXP4_1_222_3.40.50.1110 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase | 0.773 | 25 | 250 | 3.40.50.1110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520IBE4-F1-model_v4 | GDSL family lipase | 0.9526 | 123 | 250 |
GO:0004622
|
| AF-A0A2W5N1M4-F1-model_v4 | GDSL family lipase | 0.952 | 54 | 245 |
GO:0004622
|
| AF-A0A4Q2XK96-F1-model_v4 | deleted | 0.9495 | 148 | 249 |
|
| AF-A0A3C0GMS1-F1-model_v4 | Capsular biosynthesis protein | 0.9465 | 137 | 247 |
GO:0004622
|
| AF-J9GEG1-F1-model_v4 | Lipolytic protein g-d-s-l family | 0.944 | 129 | 245 |
GO:0004622
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar