F415680

General Info

Members Datasets Scaffolds Average Seq Length
343 186 686 195

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1562023|Ga0436365_1562023_375_926
Length 183
Sequence VPRTVVSCLGDSITEGSPYWDSRSRSGDPEGQWQHWAALVHPALEFRNFGIYGQRTDEILERFGEAAEGADVLIVQGGINDIAQGRPIEDAARNLETMVRRAQVPVAVCDVLPWNNGYPAKDAPIRALNERIHALGIPVLPFYATLEDPDAPGRMKPEWTNEDGDHPSIAGYRRLGESAFRLP

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 19.83
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1562023 3300039437 Bacteria 1346
2 Ga0070658_10359160 3300005327 Bacteria 1247
3 Ga0070683_100023360 3300005329 Bacteria 5530
4 Ga0070683_100040121 3300005329 Bacteria 4302
5 Ga0070683_100167646 3300005329 Unclassified 2084
6 Ga0070680_100009292 3300005336 Bacteria 7547
7 Ga0070680_100063295 3300005336 Bacteria 3030
8 Ga0070680_100103828 3300005336 Bacteria 2361
9 Ga0070680_100604953 3300005336 Bacteria 941
10 Ga0070682_100003613 3300005337 Bacteria 8572
11 Ga0070682_100025219 3300005337 Bacteria 3546
12 Ga0070682_100125060 3300005337 Bacteria 1732
13 Ga0070660_100033558 3300005339 Bacteria 3869
14 Ga0070660_101053931 3300005339 Bacteria 688
15 Ga0070661_100324287 3300005344 Bacteria 1203
16 Ga0070675_100372778 3300005354 Bacteria 1269
17 Ga0070674_100188817 3300005356 Bacteria 1584
18 Ga0070659_100008764 3300005366 Bacteria 7403
19 Ga0070659_100444437 3300005366 Bacteria 1099
20 Ga0070714_101395519 3300005435 Bacteria 684
21 Ga0070713_100587332 3300005436 Bacteria 1057
22 Ga0070711_100074366 3300005439 Bacteria 2403
23 Ga0070700_100251906 3300005441 Bacteria 1267
24 Ga0070663_100090702 3300005455 Bacteria 2264
25 Ga0070678_100004014 3300005456 Bacteria 8282
26 Ga0070678_100239031 3300005456 Bacteria 1518
27 Ga0070681_10025296 3300005458 Bacteria 5971
28 Ga0070681_10062918 3300005458 Bacteria 3683
29 Ga0070681_10106476 3300005458 Bacteria 2745
30 Ga0070681_10201754 3300005458 Bacteria 1907
31 Ga0068867_101075058 3300005459 Bacteria 733
32 Ga0070706_100805064 3300005467 Bacteria 870
33 Ga0070707_100692304 3300005468 Bacteria 982
34 Ga0070679_100000950 3300005530 Bacteria 25176
35 Ga0070679_100009551 3300005530 Bacteria 9176
36 Ga0070679_100024215 3300005530 Bacteria 5949
37 Ga0070679_100037712 3300005530 Bacteria 4802
38 Ga0070679_100098573 3300005530 Bacteria 2910
39 Ga0070684_100003591 3300005535 Bacteria 11673
40 Ga0070684_100017413 3300005535 Bacteria 5897
41 Ga0070684_101003314 3300005535 Bacteria 783
42 Ga0068853_100092260 3300005539 Bacteria 2664
43 Ga0070686_100254319 3300005544 Bacteria 1285
44 Ga0070693_100005563 3300005547 Bacteria 6064
45 Ga0070665_100084922 3300005548 Bacteria 3171
46 Ga0068855_100180662 3300005563 Bacteria 2385
47 Ga0068855_100185414 3300005563 Bacteria 2350
48 Ga0068856_100036810 3300005614 Bacteria 4798
49 Ga0068856_100054962 3300005614 Bacteria 3929
50 Ga0068856_100202414 3300005614 Bacteria 2000
51 Ga0068866_10460949 3300005718 Bacteria 833
52 Ga0068858_101231638 3300005842 Bacteria 736
53 Ga0081455_10002352 3300005937 Bacteria 22577
54 Ga0081538_10002093 3300005981 Bacteria 19904
55 Ga0075365_10086942 3300006038 Bacteria 2125
56 Ga0075364_10254633 3300006051 Unclassified 1193
57 Ga0070716_100219613 3300006173 Bacteria 1276
58 Ga0070712_100011865 3300006175 Bacteria 5537
59 Ga0075433_10123613 3300006852 Bacteria 2299
60 Ga0075433_10130043 3300006852 Bacteria 2237
61 Ga0075434_100035070 3300006871 Bacteria 4958
62 Ga0075434_100321793 3300006871 Bacteria 1567
63 Ga0068865_100249959 3300006881 Bacteria 1399
64 Ga0075435_100050922 3300007076 Bacteria 3334
65 Ga0105240_10159156 3300009093 Bacteria 2684
66 Ga0111539_10182087 3300009094 Bacteria 2454
67 Ga0105245_10004518 3300009098 Bacteria 12292
68 Ga0105245_10073748 3300009098 Bacteria 3104
69 Ga0105245_10698633 3300009098 Bacteria 1047
70 Ga0105243_10290443 3300009148 Bacteria 1477
71 Ga0105243_10539936 3300009148 Bacteria 1112
72 Ga0105237_10033237 3300009545 Bacteria 5225
73 Ga0105237_10081192 3300009545 Bacteria 3233
74 Ga0105238_10016197 3300009551 Bacteria 7544
75 Ga0105238_10069453 3300009551 Bacteria 3523
76 Ga0105249_10379494 3300009553 Bacteria 1439
77 Ga0105239_10181076 3300010375 Bacteria 2358
78 Ga0105239_10355406 3300010375 Bacteria 1654
79 Ga0105239_10763886 3300010375 Unclassified 1107
80 Ga0105239_11356372 3300010375 Unclassified 821
81 Ga0157373_10015894 3300013100 Bacteria 5494
82 Ga0157370_10098346 3300013104 Bacteria 2744
83 Ga0157370_10109333 3300013104 Bacteria 2584
84 Ga0157370_10893650 3300013104 Unclassified 806
85 Ga0157369_10131808 3300013105 Bacteria 2648
86 Ga0157369_10450854 3300013105 Bacteria 1332
87 Ga0163162_10472915 3300013306 Bacteria 1385
88 Ga0157372_10015441 3300013307 Bacteria 8184
89 Ga0157372_10245149 3300013307 Bacteria 2079
90 Ga0157372_10278394 3300013307 Bacteria 1945
91 Ga0157372_11814785 3300013307 Bacteria 701
92 Ga0157375_10377009 3300013308 Bacteria 1585
93 Ga0157375_10570488 3300013308 Bacteria 1292
94 Ga0157377_10200340 3300014745 Bacteria 1267
95 Ga0157376_10188231 3300014969 Unclassified 1891
96 Ga0157376_10553586 3300014969 Bacteria 1139
97 Ga0157376_10937296 3300014969 Bacteria 886
98 Ga0182007_10011693 3300015262 Bacteria 3408
99 Ga0206356_10054393 3300020070 Bacteria 1993
100 Ga0206353_10303684 3300020082 Bacteria 2033
101 Ga0206353_10871076 3300020082 Bacteria 3435
102 Ga0207685_10225676 3300025905 Unclassified 893
103 Ga0207705_10017685 3300025909 Bacteria 5100
104 Ga0207705_10655144 3300025909 Bacteria 816
105 Ga0207707_10004008 3300025912 Bacteria 13068
106 Ga0207707_10004433 3300025912 Bacteria 12371
107 Ga0207707_10011777 3300025912 Bacteria 7609
108 Ga0207707_10070087 3300025912 Bacteria 3055
109 Ga0207707_10147604 3300025912 Bacteria 2056
110 Ga0207695_10077346 3300025913 Bacteria 3380
111 Ga0207671_10238233 3300025914 Bacteria 1429
112 Ga0207671_10355011 3300025914 Bacteria 1163
113 Ga0207693_10006760 3300025915 Bacteria 9470
114 Ga0207660_10086070 3300025917 Bacteria 2320
115 Ga0207660_10335711 3300025917 Bacteria 1209
116 Ga0207660_10422056 3300025917 Bacteria 1076
117 Ga0207660_10508954 3300025917 Bacteria 977
118 Ga0207660_10545391 3300025917 Bacteria 943
119 Ga0207657_10001478 3300025919 Bacteria 25119
120 Ga0207657_10002441 3300025919 Bacteria 20078
121 Ga0207657_10072659 3300025919 Bacteria 2909
122 Ga0207649_10295425 3300025920 Bacteria 1183
123 Ga0207652_10010577 3300025921 Bacteria 7427
124 Ga0207652_10031678 3300025921 Bacteria 4443
125 Ga0207652_10047039 3300025921 Bacteria 3684
126 Ga0207652_10076754 3300025921 Bacteria 2914
127 Ga0207652_10458946 3300025921 Bacteria 1148
128 Ga0207694_10507144 3300025924 Bacteria 1010
129 Ga0207659_10325076 3300025926 Bacteria 1270
130 Ga0207687_10014888 3300025927 Bacteria 5094
131 Ga0207687_10082870 3300025927 Bacteria 2321
132 Ga0207687_10638851 3300025927 Bacteria 900
133 Ga0207700_10118996 3300025928 Bacteria 2138
134 Ga0207700_10595264 3300025928 Bacteria 984
135 Ga0207664_10047491 3300025929 Bacteria 3373
136 Ga0207664_10076787 3300025929 Bacteria 2705
137 Ga0207644_10121123 3300025931 Unclassified 1992
138 Ga0207690_10067222 3300025932 Bacteria 2457
139 Ga0207704_10128483 3300025938 Bacteria 1750
140 Ga0207665_10435899 3300025939 Bacteria 1003
141 Ga0207661_10035358 3300025944 Bacteria 3892
142 Ga0207661_10366327 3300025944 Bacteria 1302
143 Ga0207679_10361104 3300025945 Bacteria 1269
144 Ga0207667_10111863 3300025949 Bacteria 2816
145 Ga0207667_10173685 3300025949 Bacteria 2214
146 Ga0207712_10241368 3300025961 Bacteria 1455
147 Ga0207678_10095669 3300026067 Bacteria 2538
148 Ga0207678_10145476 3300026067 Bacteria 2023
149 Ga0207708_10278649 3300026075 Bacteria 1354
150 Ga0207702_10031934 3300026078 Bacteria 4392
151 Ga0207674_10028737 3300026116 Bacteria 5865
152 Ga0207675_100125239 3300026118 Bacteria 2434
153 Ga0207683_10002141 3300026121 Bacteria 17338
154 Ga0268266_10058355 3300028379 Bacteria 3323
155 Ga0265340_10094748 3300031247 Bacteria 1392
156 Ga0265316_10094443 3300031344 Unclassified 2278
157 Ga0265313_10014011 3300031595 Bacteria 4773
158 Ga0265313_10186006 3300031595 Bacteria 871
159 Ga0265342_10035715 3300031712 Bacteria 3040
160 Ga0373944_0009796 3300035089 Bacteria 2605
161 Ga0373945_0019464 3300035116 Bacteria 2318
162 Ga0373943_0000138 3300035170 Bacteria 27619
163 Ga0373943_0001883 3300035170 Bacteria 9485
164 Ga0373946_0005779 3300035171 Bacteria 4476
165 Ga0373935_0057206 3300035692 Bacteria 2488
166 Ga0373947_0004021 3300035725 Bacteria 8639
167 Ga0373947_0033011 3300035725 Bacteria 3054
168 Ga0373947_0058017 3300035725 Bacteria 2344
169 Ga0395900_0030084 3300037418 Bacteria 5574
170 Ga0395900_0049716 3300037418 Bacteria 4320
171 Ga0395900_0878579 3300037418 Bacteria 821
172 Ga0395898_0075431 3300037466 Bacteria 3257
173 Ga0395898_0397117 3300037466 Bacteria 1315
174 Ga0395901_0244374 3300038443 Bacteria 1871
175 Ga0395901_0283350 3300038443 Bacteria 1721
176 Ga0395901_1198275 3300038443 Bacteria 725
177 Ga0450905_003142 3300042142 Bacteria 2160
178 Ga0466961_0046054 3300044693 Bacteria 2790
179 Ga0466963_0009526 3300044694 Bacteria 5850
180 Ga0466968_0003170 3300044735 Bacteria 6070
181 Ga0466959_0323788 3300045049 Unclassified 1053
182 Ga0466967_0006025 3300045976 Bacteria 8520
183 Ga0466967_0014576 3300045976 Bacteria 6129
184 Ga0466967_0019498 3300045976 Bacteria 5454
185 Ga0466967_0059149 3300045976 Bacteria 3391
186 Ga0466967_0173815 3300045976 Bacteria 2028
187 Ga0466967_0319999 3300045976 Bacteria 1496
188 Ga0466967_0533401 3300045976 Bacteria 1154
189 Ga0466967_0637036 3300045976 Bacteria 1054
190 Ga0466967_1161817 3300045976 Bacteria 769
191 Ga0466967_1397677 3300045976 Bacteria 697
192 Ga0466967_1624381 3300045976 Unclassified 644
193 Ga0495592_0066036 3300046454 Bacteria 2648
194 Ga0495603_0157262 3300046455 Unclassified 1319
195 Ga0495629_0017675 3300046459 Bacteria 5111
196 Ga0495629_0154695 3300046459 Unclassified 1594
197 Ga0495629_0162819 3300046459 Bacteria 1549
198 Ga0495641_0000345 3300046461 Bacteria 38081
199 Ga0495651_0069144 3300046462 Bacteria 2690
200 Ga0495651_0622363 3300046462 Unclassified 679
201 Ga0495653_0045103 3300046463 Bacteria 3419
202 Ga0495582_0000703 3300046473 Bacteria 18466
203 Ga0495639_0008687 3300046475 Bacteria 4355
204 Ga0495662_0000116 3300046476 Bacteria 30019
205 Ga0495664_0021736 3300046477 Bacteria 3707
206 Ga0495608_0057228 3300046511 Bacteria 2573
207 Ga0495630_0018782 3300046517 Bacteria 5079
208 Ga0495630_0347928 3300046517 Bacteria 1134
209 Ga0495652_0321590 3300046529 Bacteria 1117
210 Ga0495665_0230244 3300046531 Bacteria 957
211 Ga0495640_0070293 3300046533 Bacteria 2352
212 Ga0495586_0042827 3300046535 Bacteria 2438
213 Ga0495587_0142518 3300046536 Bacteria 1367
214 Ga0495645_0078004 3300046543 Bacteria 2381
215 Ga0495667_0056271 3300046559 Bacteria 2586
216 Ga0495656_0102599 3300046615 Bacteria 1325
217 Ga0495634_0004864 3300046642 Bacteria 10411
218 Ga0495634_0130105 3300046642 Bacteria 1605
219 Ga0495635_0022627 3300046663 Bacteria 4380
220 Ga0495588_0311361 3300046674 Bacteria 828
221 Ga0495657_0086785 3300046675 Bacteria 2015
222 Ga0495599_0210152 3300046678 Bacteria 1193
223 Ga0495647_0000893 3300046681 Bacteria 8934
224 Ga0495647_0009238 3300046681 Bacteria 3334
225 Ga0495647_0122994 3300046681 Archaea 1093
226 Ga0495658_0000830 3300046683 Bacteria 16569
227 Ga0495658_0192428 3300046683 Bacteria 1269
228 Ga0495613_0001439 3300046689 Bacteria 18178
229 Ga0495613_0094547 3300046689 Bacteria 2162
230 Ga0495624_0077451 3300046690 Bacteria 2062
231 Ga0495670_0063599 3300046691 Bacteria 1858
232 Ga0495600_0003646 3300046809 Bacteria 9084
233 Ga0495581_0001135 3300047315 Bacteria 14578
234 Ga0495674_0252676 3300047319 Bacteria 1450
235 Ga0495676_0007504 3300047321 Bacteria 10004
236 Ga0495676_0111955 3300047321 Bacteria 2001
237 Ga0495684_0017150 3300047471 Bacteria 5577
238 Ga0495593_0001727 3300047673 Bacteria 12939
239 Ga0495602_0187665 3300048088 Bacteria 1588
240 Ga0495614_0006047 3300048089 Bacteria 5442
241 Ga0496100_0002015 3300048903 Bacteria 10164
242 Ga0496100_0014486 3300048903 Bacteria 4578
243 Ga0496100_0018754 3300048903 Bacteria 4112
244 Ga0496101_0015861 3300048904 Bacteria 5085
245 Ga0496101_0131494 3300048904 Bacteria 1900
246 Ga0496101_0148845 3300048904 Unclassified 1789
247 Ga0496102_0002683 3300048905 Bacteria 15134
248 Ga0496102_0008414 3300048905 Bacteria 8841
249 Ga0496102_0090857 3300048905 Bacteria 2826
250 Ga0496102_0415642 3300048905 Bacteria 1263
251 Ga0496102_0771861 3300048905 Unclassified 884
252 Ga0496103_0021636 3300048906 Bacteria 3870
253 Ga0496103_0097659 3300048906 Unclassified 1857
254 Ga0496103_0198514 3300048906 Bacteria 1290
255 Ga0496104_0010174 3300048907 Bacteria 8395
256 Ga0496104_0027649 3300048907 Bacteria 5251
257 Ga0496104_0042566 3300048907 Bacteria 4263
258 Ga0496104_0172949 3300048907 Bacteria 2070
259 Ga0496105_0000284 3300048908 Bacteria 33428
260 Ga0496105_0000974 3300048908 Bacteria 19699
261 Ga0496105_0016818 3300048908 Bacteria 5848
262 Ga0496105_0041085 3300048908 Bacteria 3812
263 Ga0496105_0047433 3300048908 Unclassified 3545
264 Ga0496105_0154205 3300048908 Bacteria 1887
265 Ga0496106_0000302 3300048909 Bacteria 34606
266 Ga0496106_0006436 3300048909 Bacteria 8695
267 Ga0496106_0015456 3300048909 Bacteria 5650
268 Ga0496106_0044986 3300048909 Bacteria 3315
269 Ga0496106_0126332 3300048909 Bacteria 2003
270 Ga0496107_0000356 3300048910 Bacteria 24934
271 Ga0496107_0176695 3300048910 Bacteria 1585
272 Ga0496107_0192060 3300048910 Bacteria 1517
273 Ga0496107_0491161 3300048910 Unclassified 911
274 Ga0496108_0000458 3300048911 Bacteria 32618
275 Ga0496108_0001127 3300048911 Bacteria 20904
276 Ga0496108_0007607 3300048911 Bacteria 8773
277 Ga0496108_1089529 3300048911 Unclassified 679
278 Ga0496109_0001285 3300048912 Bacteria 20840
279 Ga0496109_0002098 3300048912 Bacteria 16579
280 Ga0496109_0009853 3300048912 Bacteria 8156
281 Ga0496109_0026834 3300048912 Bacteria 5137
282 Ga0496109_0320725 3300048912 Bacteria 1462
283 Ga0496110_0000283 3300048913 Bacteria 33130
284 Ga0496110_0015847 3300048913 Bacteria 6285
285 Ga0496110_0016878 3300048913 Bacteria 6101
286 Ga0496110_0023216 3300048913 Bacteria 5274
287 Ga0496110_0129918 3300048913 Bacteria 2274
288 Ga0496110_0274072 3300048913 Bacteria 1536
289 Ga0496111_0008355 3300048914 Bacteria 6845
290 Ga0496111_0030488 3300048914 Bacteria 3835
291 Ga0496111_0148321 3300048914 Bacteria 1739
292 Ga0496112_0019047 3300048915 Bacteria 6471
293 Ga0496112_0027061 3300048915 Bacteria 5528
294 Ga0496112_0157253 3300048915 Unclassified 2240
295 Ga0496112_0813334 3300048915 Bacteria 859
296 Ga0496114_0000639 3300048917 Bacteria 25783
297 Ga0496114_0000926 3300048917 Bacteria 21961
298 Ga0496114_0001869 3300048917 Bacteria 15968
299 Ga0496114_0033389 3300048917 Bacteria 4240
300 Ga0496114_0057068 3300048917 Bacteria 3259
301 Ga0496114_0094625 3300048917 Bacteria 2541
302 Ga0496114_0176120 3300048917 Bacteria 1866
303 Ga0496114_0360854 3300048917 Bacteria 1285
304 Ga0496114_0943371 3300048917 Unclassified 745
305 Ga0496115_0028491 3300048918 Bacteria 4378
306 Ga0496115_0048468 3300048918 Bacteria 3398
307 Ga0496115_0137238 3300048918 Bacteria 2017
308 Ga0496115_0431508 3300048918 Bacteria 1066
309 Ga0501034_0065822 3300049571 Bacteria 3638
310 Ga0501038_0564862 3300049574 Bacteria 864
311 Ga0501039_0547676 3300049575 Bacteria 908
312 Ga0501040_0213472 3300049576 Unclassified 1372
313 Ga0501040_0220995 3300049576 Bacteria 1348
314 Ga0501046_0043757 3300049580 Bacteria 3564
315 Ga0501067_0014385 3300049583 Bacteria 4381
316 Ga0501067_0078044 3300049583 Bacteria 1835
317 Ga0501067_0256419 3300049583 Bacteria 974
318 Ga0501069_0033278 3300049585 Bacteria 2839
319 Ga0501069_0087112 3300049585 Bacteria 1764
320 Ga0501070_0113519 3300049586 Bacteria 2239
321 Ga0501070_0183873 3300049586 Bacteria 1719
322 Ga0501074_0666738 3300049590 Unclassified 734
323 Ga0501076_0201211 3300049592 Unclassified 1626
324 Ga0501077_0184902 3300049593 Unclassified 1324
325 Ga0501079_0068656 3300049741 Bacteria 2736
326 Ga0501079_0243691 3300049741 Bacteria 1405
327 Ga0501080_0418003 3300049742 Bacteria 1205
328 Ga0501083_0471194 3300049744 Bacteria 817
329 nmdc:mga00v17_356747_c1 3300050491 Unclassified 950
330 nmdc:mga0yw44_122628_c1 3300050492 Bacteria 1675
331 nmdc:mga08y16_351725_c1 3300050511 Unclassified 1513
332 nmdc:mga0n895_343729_c1 3300050512 Bacteria 1511
333 nmdc:mga0n895_50426_c1 3300050512 Bacteria 4080
334 nmdc:mga0rr50_27191_c1 3300050513 Bacteria 4001
335 nmdc:mga0a205_159840_c1 3300050515 Bacteria 2150
336 nmdc:mga0a205_639452_c1 3300050515 Unclassified 915
337 Ga0495595_0063281 3300053084 Bacteria 1736
338 Ga0495619_0006985 3300053085 Bacteria 7145
339 Ga0500566_0270228 3300053094 Bacteria 816
340 Ga0501082_0124861 3300060353 Unclassified 2232
341 Ga0501082_0388505 3300060353 Bacteria 1218
342 Ga0530510_0458643 3300061734 Bacteria 964
343 Ga0530510_0471333 3300061734 Bacteria 950
344 Ga0436365_1562023
345 Ga0070658_10359160
346 Ga0070683_100023360
347 Ga0070683_100040121
348 Ga0070683_100167646
349 Ga0070680_100009292
350 Ga0070680_100063295
351 Ga0070680_100103828
352 Ga0070680_100604953
353 Ga0070682_100003613
354 Ga0070682_100025219
355 Ga0070682_100125060
356 Ga0070660_100033558
357 Ga0070660_101053931
358 Ga0070661_100324287
359 Ga0070675_100372778
360 Ga0070674_100188817
361 Ga0070659_100008764
362 Ga0070659_100444437
363 Ga0070714_101395519
364 Ga0070713_100587332
365 Ga0070711_100074366
366 Ga0070700_100251906
367 Ga0070663_100090702
368 Ga0070678_100004014
369 Ga0070678_100239031
370 Ga0070681_10025296
371 Ga0070681_10062918
372 Ga0070681_10106476
373 Ga0070681_10201754
374 Ga0068867_101075058
375 Ga0070706_100805064
376 Ga0070707_100692304
377 Ga0070679_100000950
378 Ga0070679_100009551
379 Ga0070679_100024215
380 Ga0070679_100037712
381 Ga0070679_100098573
382 Ga0070684_100003591
383 Ga0070684_100017413
384 Ga0070684_101003314
385 Ga0068853_100092260
386 Ga0070686_100254319
387 Ga0070693_100005563
388 Ga0070665_100084922
389 Ga0068855_100180662
390 Ga0068855_100185414
391 Ga0068856_100036810
392 Ga0068856_100054962
393 Ga0068856_100202414
394 Ga0068866_10460949
395 Ga0068858_101231638
396 Ga0081455_10002352
397 Ga0081538_10002093
398 Ga0075365_10086942
399 Ga0075364_10254633
400 Ga0070716_100219613
401 Ga0070712_100011865
402 Ga0075433_10123613
403 Ga0075433_10130043
404 Ga0075434_100035070
405 Ga0075434_100321793
406 Ga0068865_100249959
407 Ga0075435_100050922
408 Ga0105240_10159156
409 Ga0111539_10182087
410 Ga0105245_10004518
411 Ga0105245_10073748
412 Ga0105245_10698633
413 Ga0105243_10290443
414 Ga0105243_10539936
415 Ga0105237_10033237
416 Ga0105237_10081192
417 Ga0105238_10016197
418 Ga0105238_10069453
419 Ga0105249_10379494
420 Ga0105239_10181076
421 Ga0105239_10355406
422 Ga0105239_10763886
423 Ga0105239_11356372
424 Ga0157373_10015894
425 Ga0157370_10098346
426 Ga0157370_10109333
427 Ga0157370_10893650
428 Ga0157369_10131808
429 Ga0157369_10450854
430 Ga0163162_10472915
431 Ga0157372_10015441
432 Ga0157372_10245149
433 Ga0157372_10278394
434 Ga0157372_11814785
435 Ga0157375_10377009
436 Ga0157375_10570488
437 Ga0157377_10200340
438 Ga0157376_10188231
439 Ga0157376_10553586
440 Ga0157376_10937296
441 Ga0182007_10011693
442 Ga0206356_10054393
443 Ga0206353_10303684
444 Ga0206353_10871076
445 Ga0207685_10225676
446 Ga0207705_10017685
447 Ga0207705_10655144
448 Ga0207707_10004008
449 Ga0207707_10004433
450 Ga0207707_10011777
451 Ga0207707_10070087
452 Ga0207707_10147604
453 Ga0207695_10077346
454 Ga0207671_10238233
455 Ga0207671_10355011
456 Ga0207693_10006760
457 Ga0207660_10086070
458 Ga0207660_10335711
459 Ga0207660_10422056
460 Ga0207660_10508954
461 Ga0207660_10545391
462 Ga0207657_10001478
463 Ga0207657_10002441
464 Ga0207657_10072659
465 Ga0207649_10295425
466 Ga0207652_10010577
467 Ga0207652_10031678
468 Ga0207652_10047039
469 Ga0207652_10076754
470 Ga0207652_10458946
471 Ga0207694_10507144
472 Ga0207659_10325076
473 Ga0207687_10014888
474 Ga0207687_10082870
475 Ga0207687_10638851
476 Ga0207700_10118996
477 Ga0207700_10595264
478 Ga0207664_10047491
479 Ga0207664_10076787
480 Ga0207644_10121123
481 Ga0207690_10067222
482 Ga0207704_10128483
483 Ga0207665_10435899
484 Ga0207661_10035358
485 Ga0207661_10366327
486 Ga0207679_10361104
487 Ga0207667_10111863
488 Ga0207667_10173685
489 Ga0207712_10241368
490 Ga0207678_10095669
491 Ga0207678_10145476
492 Ga0207708_10278649
493 Ga0207702_10031934
494 Ga0207674_10028737
495 Ga0207675_100125239
496 Ga0207683_10002141
497 Ga0268266_10058355
498 Ga0265340_10094748
499 Ga0265316_10094443
500 Ga0265313_10014011
501 Ga0265313_10186006
502 Ga0265342_10035715
503 Ga0373944_0009796
504 Ga0373945_0019464
505 Ga0373943_0000138
506 Ga0373943_0001883
507 Ga0373946_0005779
508 Ga0373935_0057206
509 Ga0373947_0004021
510 Ga0373947_0033011
511 Ga0373947_0058017
512 Ga0395900_0030084
513 Ga0395900_0049716
514 Ga0395900_0878579
515 Ga0395898_0075431
516 Ga0395898_0397117
517 Ga0395901_0244374
518 Ga0395901_0283350
519 Ga0395901_1198275
520 Ga0450905_003142
521 Ga0466961_0046054
522 Ga0466963_0009526
523 Ga0466968_0003170
524 Ga0466959_0323788
525 Ga0466967_0006025
526 Ga0466967_0014576
527 Ga0466967_0019498
528 Ga0466967_0059149
529 Ga0466967_0173815
530 Ga0466967_0319999
531 Ga0466967_0533401
532 Ga0466967_0637036
533 Ga0466967_1161817
534 Ga0466967_1397677
535 Ga0466967_1624381
536 Ga0495592_0066036
537 Ga0495603_0157262
538 Ga0495629_0017675
539 Ga0495629_0154695
540 Ga0495629_0162819
541 Ga0495641_0000345
542 Ga0495651_0069144
543 Ga0495651_0622363
544 Ga0495653_0045103
545 Ga0495582_0000703
546 Ga0495639_0008687
547 Ga0495662_0000116
548 Ga0495664_0021736
549 Ga0495608_0057228
550 Ga0495630_0018782
551 Ga0495630_0347928
552 Ga0495652_0321590
553 Ga0495665_0230244
554 Ga0495640_0070293
555 Ga0495586_0042827
556 Ga0495587_0142518
557 Ga0495645_0078004
558 Ga0495667_0056271
559 Ga0495656_0102599
560 Ga0495634_0004864
561 Ga0495634_0130105
562 Ga0495635_0022627
563 Ga0495588_0311361
564 Ga0495657_0086785
565 Ga0495599_0210152
566 Ga0495647_0000893
567 Ga0495647_0009238
568 Ga0495647_0122994
569 Ga0495658_0000830
570 Ga0495658_0192428
571 Ga0495613_0001439
572 Ga0495613_0094547
573 Ga0495624_0077451
574 Ga0495670_0063599
575 Ga0495600_0003646
576 Ga0495581_0001135
577 Ga0495674_0252676
578 Ga0495676_0007504
579 Ga0495676_0111955
580 Ga0495684_0017150
581 Ga0495593_0001727
582 Ga0495602_0187665
583 Ga0495614_0006047
584 Ga0496100_0002015
585 Ga0496100_0014486
586 Ga0496100_0018754
587 Ga0496101_0015861
588 Ga0496101_0131494
589 Ga0496101_0148845
590 Ga0496102_0002683
591 Ga0496102_0008414
592 Ga0496102_0090857
593 Ga0496102_0415642
594 Ga0496102_0771861
595 Ga0496103_0021636
596 Ga0496103_0097659
597 Ga0496103_0198514
598 Ga0496104_0010174
599 Ga0496104_0027649
600 Ga0496104_0042566
601 Ga0496104_0172949
602 Ga0496105_0000284
603 Ga0496105_0000974
604 Ga0496105_0016818
605 Ga0496105_0041085
606 Ga0496105_0047433
607 Ga0496105_0154205
608 Ga0496106_0000302
609 Ga0496106_0006436
610 Ga0496106_0015456
611 Ga0496106_0044986
612 Ga0496106_0126332
613 Ga0496107_0000356
614 Ga0496107_0176695
615 Ga0496107_0192060
616 Ga0496107_0491161
617 Ga0496108_0000458
618 Ga0496108_0001127
619 Ga0496108_0007607
620 Ga0496108_1089529
621 Ga0496109_0001285
622 Ga0496109_0002098
623 Ga0496109_0009853
624 Ga0496109_0026834
625 Ga0496109_0320725
626 Ga0496110_0000283
627 Ga0496110_0015847
628 Ga0496110_0016878
629 Ga0496110_0023216
630 Ga0496110_0129918
631 Ga0496110_0274072
632 Ga0496111_0008355
633 Ga0496111_0030488
634 Ga0496111_0148321
635 Ga0496112_0019047
636 Ga0496112_0027061
637 Ga0496112_0157253
638 Ga0496112_0813334
639 Ga0496114_0000639
640 Ga0496114_0000926
641 Ga0496114_0001869
642 Ga0496114_0033389
643 Ga0496114_0057068
644 Ga0496114_0094625
645 Ga0496114_0176120
646 Ga0496114_0360854
647 Ga0496114_0943371
648 Ga0496115_0028491
649 Ga0496115_0048468
650 Ga0496115_0137238
651 Ga0496115_0431508
652 Ga0501034_0065822
653 Ga0501038_0564862
654 Ga0501039_0547676
655 Ga0501040_0213472
656 Ga0501040_0220995
657 Ga0501046_0043757
658 Ga0501067_0014385
659 Ga0501067_0078044
660 Ga0501067_0256419
661 Ga0501069_0033278
662 Ga0501069_0087112
663 Ga0501070_0113519
664 Ga0501070_0183873
665 Ga0501074_0666738
666 Ga0501076_0201211
667 Ga0501077_0184902
668 Ga0501079_0068656
669 Ga0501079_0243691
670 Ga0501080_0418003
671 Ga0501083_0471194
672 nmdc:mga00v17_356747_c1
673 nmdc:mga0yw44_122628_c1
674 nmdc:mga08y16_351725_c1
675 nmdc:mga0n895_343729_c1
676 nmdc:mga0n895_50426_c1
677 nmdc:mga0rr50_27191_c1
678 nmdc:mga0a205_159840_c1
679 nmdc:mga0a205_639452_c1
680 Ga0495595_0063281
681 Ga0495619_0006985
682 Ga0500566_0270228
683 Ga0501082_0124861
684 Ga0501082_0388505
685 Ga0530510_0458643
686 Ga0530510_0471333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

8

174

0.81

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

6

179

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rsh-assembly3.cif.gz_C structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2 0.878 3 179
7tog-assembly1.cif.gz_A crystal structure of carbohydrate esterase pbeacxe, apoenzyme 0.8558 2 183
4rsh-assembly3.cif.gz_C structure of a putative lipolytic protein of g-d-s-l family from desulfitobacterium hafniense dcb-2 0.8404 3 179
7tog-assembly1.cif.gz_A crystal structure of carbohydrate esterase pbeacxe, apoenzyme 0.8385 2 183
4rw0-assembly2.cif.gz_B crystal structure of a member of the lipolytic protein g-d-s-l family from veillonella parvula dsm 2008 0.8165 4 178
ID Description Score Start End Superfamily
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8609 3 179 3.40.50.1110
4rshA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8238 3 179 3.40.50.1110
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8091 4 179 3.40.50.1110
1yzfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7918 1 180 3.40.50.1110
2hsjB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7845 2 179 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A538K4D8-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9713 2 185 GO:0004622
AF-A0A7J9YNV5-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9709 2 180 GO:0004622
AF-A0A7W1GJ37-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.9706 4 179
AF-A0A7W0UDS1-F1-model_v4 SGNH hydrolase-type esterase domain-containing protein 0.97 2 149
AF-A0A7W0ANF9-F1-model_v4 SGNH/GDSL hydrolase family protein 0.9617 3 185 GO:0004622

Map