F415550

General Info

Members Datasets Scaffolds Average Seq Length
343 247 686 255

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10538531|Ga0105245_105385312
Length 266
Sequence VGRRLDEELTMAATQVIRSEWTKIRSVASTVWTLSLAVVVTVALGVLISALSNHEFDNMSRGDRLSFDPTFVSFAGMTLGQLAMIVFGVLVVSNEYSTGMIRTSLAAVPQRGTFLFSKIAVAAGLSLAVGMVTSFVTFFLGQAMLGSHRASLEDSGVLRAVIGGGLYMTLIAVFSMGVATMLRSPMLSLGILMPFFFLISNILGNVSATKKIGRYLPDQAGSRVMQVVTRIDDDTPYGPWGGFAIMALWTAAALAGGYLLLKQRDA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
48 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
49 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
54 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
55 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
56 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
57 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
58 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
59 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
60 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
164 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
165 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
169 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
170 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
173 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
174 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
175 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
176 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
177 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
178 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
179 2643221548 Streptomyces sp. Root55 Isolate Unclassified
180 2643221578 Streptomyces sp. Root63 Isolate Unclassified
181 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
182 2643221647 Streptomyces sp. Root369 Isolate Unclassified
183 2643221670 Streptomyces sp. Root431 Isolate Unclassified
184 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
185 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
186 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
187 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
188 2643221714 Streptomyces sp. Root264 Isolate Unclassified
189 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
190 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
191 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
192 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
193 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
194 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
195 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
196 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
197 2808606448 Streptomyces sp. 193411 Isolate Unclassified
198 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
199 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
200 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
201 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
202 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
203 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
204 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
205 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
206 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
207 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
208 2862574272 Streptomyces sp. AcE210 Isolate Nodule
209 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
210 2867428634 Streptomyces sp. RP5T Isolate Unclassified
211 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
212 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
213 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
214 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
215 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
216 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
217 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
218 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
219 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
220 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
221 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
222 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
223 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
224 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
225 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
226 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
227 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
228 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
229 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
230 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
231 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
232 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
233 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
234 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
235 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
236 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
237 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
238 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
239 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
240 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
241 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
242 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
243 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
244 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
245 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
246 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
247 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.55
Metatranscriptomes 0.29
Isolates 22.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.96
Nodule 1.17
Rhizoplane 0.58
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10538531 3300009098 Bacteria 1188
2 JGI24737J22298_10013068 3300001990 Bacteria 2705
3 JGI24738J21930_10027825 3300002075 Bacteria 1158
4 rootH2_10125958 3300003320 Bacteria 1236
5 rootH1_10014918 3300003323 Bacteria 3985
6 rootH1_10050643 3300003323 Bacteria 2075
7 JGI25160J50197_1025278 3300003354 Bacteria 1665
8 Ga0006562J51391_1088469 3300003578 Bacteria 5800
9 Ga0068855_100501147 3300005563 Bacteria 1319
10 Ga0068856_100449925 3300005614 Bacteria 1309
11 Ga0081455_10092627 3300005937 Bacteria 2445
12 Ga0075370_10132865 3300006353 Bacteria 1453
13 Ga0099826_10068081 3300006948 Bacteria 2275
14 Ga0105251_10018747 3300009011 Bacteria 3670
15 Ga0105245_10796880 3300009098 Bacteria 983
16 Ga0105243_10179760 3300009148 Bacteria 1839
17 Ga0105246_10002359 3300011119 Bacteria 11394
18 Ga0157369_10223294 3300013105 Bacteria 1971
19 Ga0182008_10001523 3300014497 Bacteria 15449
20 Ga0182007_10001711 3300015262 Bacteria 11578
21 Ga0183367_1002 3300015688 Bacteria 1101531
22 Ga0209758_1002043 3300025297 Bacteria 21643
23 Ga0207426_1001450 3300025302 Bacteria 19608
24 Ga0207696_1030742 3300025711 Bacteria 1629
25 Ga0207687_10522986 3300025927 Bacteria 992
26 Ga0207709_10033275 3300025935 Bacteria 3025
27 Ga0207667_10135836 3300025949 Bacteria 2532
28 Ga0207702_10191749 3300026078 Bacteria 1889
29 Ga0209371_1011596 3300027312 Bacteria 2607
30 Ga0209813_10027698 3300027866 Bacteria 1647
31 Ga0307517_10003614 3300028786 Bacteria 24021
32 Ga0307515_10004012 3300028794 Bacteria 30728
33 Ga0307515_10067530 3300028794 Bacteria 4929
34 Ga0307515_10124781 3300028794 Bacteria 2886
35 Ga0268256_1002847 3300030500 Bacteria 8336
36 Ga0307511_10002529 3300030521 Bacteria 19097
37 Ga0307511_10044086 3300030521 Bacteria 3712
38 Ga0307512_10002762 3300030522 Bacteria 21451
39 Ga0307513_10066430 3300031456 Bacteria 3789
40 Ga0307513_10110901 3300031456 Bacteria 2737
41 Ga0307509_10027300 3300031507 Bacteria 6352
42 Ga0307509_10044840 3300031507 Bacteria 4774
43 Ga0307509_10047585 3300031507 Bacteria 4612
44 Ga0307508_10054955 3300031616 Bacteria 3528
45 Ga0307514_10054236 3300031649 Bacteria 3089
46 Ga0307514_10110100 3300031649 Bacteria 1953
47 Ga0307516_10001694 3300031730 Bacteria 30318
48 Ga0307516_10019922 3300031730 Bacteria 6934
49 Ga0307415_100894508 3300032126 Bacteria 818
50 Ga0307507_10040869 3300033179 Bacteria 4651
51 Ga0307507_10049349 3300033179 Bacteria 4079
52 Ga0307510_10045906 3300033180 Bacteria 4706
53 Ga0307510_10076655 3300033180 Bacteria 3286
54 Ga0307510_10093744 3300033180 Bacteria 2832
55 Ga0307510_10130232 3300033180 Bacteria 2192
56 Ga0395900_0115516 3300037418 Bacteria 2754
57 Ga0395898_0104500 3300037466 Bacteria 2716
58 Ga0395898_0298464 3300037466 Bacteria 1537
59 Ga0395901_0014818 3300038443 Bacteria 7921
60 Ga0439436_0000429 3300041404 Bacteria 10621
61 Ga0439439_0008528 3300041406 Bacteria 2424
62 Ga0451833_1176889 3300041491 Bacteria 823
63 Ga0451837_0024477 3300041494 Bacteria 1917
64 Ga0451841_1228942 3300041498 Bacteria 1855
65 Ga0451853_1805508 3300041512 Bacteria 3531
66 Ga0439433_0000632 3300041999 Bacteria 6730
67 Ga0439448_0044426 3300042005 Bacteria 1444
68 Ga0439449_0003102 3300042007 Bacteria 6474
69 Ga0439449_0034160 3300042007 Bacteria 1893
70 Ga0439449_0092693 3300042007 Bacteria 1115
71 Ga0439455_0005163 3300042012 Bacteria 2635
72 Ga0439457_000481 3300042014 Bacteria 11518
73 Ga0439457_002452 3300042014 Bacteria 5292
74 Ga0439462_0006078 3300042015 Bacteria 2992
75 Ga0450894_002902 3300042131 Bacteria 2276
76 Ga0450903_000635 3300042138 Bacteria 7106
77 Ga0450903_008143 3300042138 Bacteria 1717
78 Ga0439458_0000385 3300042157 Bacteria 11121
79 Ga0466969_0015675 3300044656 Bacteria 3971
80 Ga0466965_0071463 3300044683 Bacteria 1746
81 Ga0466966_0003594 3300044684 Bacteria 10234
82 Ga0466961_0107697 3300044693 Bacteria 1754
83 Ga0466963_0004224 3300044694 Bacteria 8332
84 Ga0466963_0070981 3300044694 Bacteria 2343
85 Ga0466968_0066158 3300044735 Bacteria 1565
86 Ga0466970_0023578 3300044765 Bacteria 3215
87 Ga0466957_0022241 3300044842 Bacteria 3739
88 Ga0466960_0040587 3300044901 Bacteria 2201
89 Ga0466959_0024425 3300045049 Bacteria 4477
90 Ga0466967_0025305 3300045976 Bacteria 4892
91 Ga0466967_0076172 3300045976 Bacteria 3017
92 Ga0495617_010342 3300046452 Bacteria 3196
93 Ga0495627_021671 3300046453 Bacteria 2127
94 Ga0495592_0078561 3300046454 Bacteria 2390
95 Ga0495603_0000638 3300046455 Bacteria 19717
96 Ga0495603_0001879 3300046455 Bacteria 12388
97 Ga0495603_0003236 3300046455 Bacteria 9701
98 Ga0495603_0010259 3300046455 Bacteria 5670
99 Ga0495603_0077806 3300046455 Bacteria 1945
100 Ga0495590_0020064 3300046457 Bacteria 2376
101 Ga0495629_0001217 3300046459 Bacteria 20212
102 Ga0495629_0003212 3300046459 Bacteria 12366
103 Ga0495629_0016554 3300046459 Bacteria 5292
104 Ga0495629_0038474 3300046459 Bacteria 3369
105 Ga0495629_0381478 3300046459 Bacteria 959
106 Ga0495638_0176742 3300046460 Bacteria 1221
107 Ga0495641_0095158 3300046461 Bacteria 1330
108 Ga0495651_0000989 3300046462 Bacteria 22069
109 Ga0495653_0050418 3300046463 Bacteria 3202
110 Ga0495653_0318406 3300046463 Bacteria 1009
111 Ga0495582_0010514 3300046473 Bacteria 5091
112 Ga0495582_0062558 3300046473 Bacteria 2056
113 Ga0495605_0097323 3300046474 Bacteria 1356
114 Ga0495662_0000804 3300046476 Bacteria 15227
115 Ga0495662_0002565 3300046476 Bacteria 9170
116 Ga0495662_0017322 3300046476 Bacteria 3486
117 Ga0495664_0001534 3300046477 Bacteria 12218
118 Ga0495594_0001615 3300046499 Bacteria 11732
119 Ga0495594_0004360 3300046499 Bacteria 7275
120 Ga0495594_0096080 3300046499 Bacteria 1664
121 Ga0495607_0169131 3300046501 Bacteria 1105
122 Ga0495583_0019462 3300046506 Bacteria 3543
123 Ga0495606_0016910 3300046507 Bacteria 5537
124 Ga0495606_0063108 3300046507 Bacteria 2362
125 Ga0495610_0152112 3300046512 Bacteria 986
126 Ga0495616_0007635 3300046513 Bacteria 6470
127 Ga0495618_0076168 3300046514 Bacteria 2137
128 Ga0495620_0017670 3300046515 Bacteria 3548
129 Ga0495628_0029965 3300046516 Bacteria 4408
130 Ga0495630_0005265 3300046517 Bacteria 9127
131 Ga0495630_0102905 3300046517 Bacteria 2161
132 Ga0495631_0032556 3300046518 Bacteria 2349
133 Ga0495643_0026200 3300046522 Bacteria 3291
134 Ga0495644_0050859 3300046523 Bacteria 1556
135 Ga0495666_0018532 3300046526 Bacteria 3463
136 Ga0495652_0020422 3300046529 Bacteria 5888
137 Ga0495652_0437278 3300046529 Bacteria 918
138 Ga0495640_0028129 3300046533 Bacteria 4050
139 Ga0495587_0001229 3300046536 Bacteria 16979
140 Ga0495597_0031334 3300046542 Bacteria 2420
141 Ga0495645_0019834 3300046543 Bacteria 4845
142 Ga0495645_0133952 3300046543 Bacteria 1734
143 Ga0495622_0003212 3300046557 Bacteria 7744
144 Ga0495622_0054626 3300046557 Bacteria 1853
145 Ga0495667_0088441 3300046559 Bacteria 2008
146 Ga0495667_0135553 3300046559 Bacteria 1587
147 Ga0495656_0067844 3300046615 Bacteria 1575
148 Ga0495668_0139517 3300046616 Bacteria 1326
149 Ga0495634_0007110 3300046642 Bacteria 8441
150 Ga0495625_0018730 3300046660 Bacteria 5393
151 Ga0495635_0003044 3300046663 Bacteria 11523
152 Ga0495588_0002530 3300046674 Bacteria 7823
153 Ga0495588_0007213 3300046674 Bacteria 5045
154 Ga0495588_0009250 3300046674 Bacteria 4551
155 Ga0495588_0367470 3300046674 Bacteria 756
156 Ga0495657_0000796 3300046675 Bacteria 28012
157 Ga0495657_0032452 3300046675 Bacteria 3643
158 Ga0495599_0361950 3300046678 Bacteria 868
159 Ga0495623_0103694 3300046679 Bacteria 1730
160 Ga0495646_0002293 3300046680 Bacteria 11696
161 Ga0495658_0014802 3300046683 Bacteria 3991
162 Ga0495613_0005466 3300046689 Bacteria 9542
163 Ga0495613_0033859 3300046689 Bacteria 3794
164 Ga0495613_0131978 3300046689 Bacteria 1788
165 Ga0495624_0013227 3300046690 Bacteria 5627
166 Ga0495624_0082937 3300046690 Bacteria 1983
167 Ga0495624_0086292 3300046690 Bacteria 1938
168 Ga0495671_0003815 3300046692 Bacteria 9165
169 Ga0495589_0006450 3300046794 Bacteria 6186
170 Ga0495589_0011498 3300046794 Bacteria 4596
171 Ga0495589_0018600 3300046794 Bacteria 3562
172 Ga0495589_0047378 3300046794 Bacteria 2130
173 Ga0495589_0168239 3300046794 Bacteria 1042
174 Ga0495600_0003691 3300046809 Bacteria 9041
175 Ga0495581_0004218 3300047315 Bacteria 8283
176 Ga0495581_0074699 3300047315 Bacteria 1961
177 Ga0495581_0192467 3300047315 Bacteria 1193
178 Ga0495581_0207834 3300047315 Bacteria 1145
179 Ga0495581_0264476 3300047315 Bacteria 1006
180 Ga0495604_0000695 3300047317 Bacteria 28567
181 Ga0495604_0067302 3300047317 Bacteria 2722
182 Ga0495636_0002669 3300047318 Bacteria 6886
183 Ga0495636_0012023 3300047318 Bacteria 3431
184 Ga0495636_0172203 3300047318 Bacteria 979
185 Ga0495674_0203106 3300047319 Bacteria 1643
186 Ga0495676_0004474 3300047321 Bacteria 12776
187 Ga0495676_0007640 3300047321 Bacteria 9915
188 Ga0495676_0009942 3300047321 Bacteria 8642
189 Ga0495676_0084125 3300047321 Bacteria 2401
190 Ga0495676_0119062 3300047321 Bacteria 1924
191 Ga0495683_0050364 3300047323 Bacteria 2084
192 Ga0495683_0165055 3300047323 Bacteria 1021
193 Ga0495687_005559 3300047443 Bacteria 7993
194 Ga0495687_006824 3300047443 Bacteria 6886
195 Ga0495687_030609 3300047443 Bacteria 2476
196 Ga0495687_032494 3300047443 Bacteria 2380
197 Ga0495687_040850 3300047443 Bacteria 2040
198 Ga0495675_0005534 3300047444 Bacteria 7705
199 Ga0495685_001224 3300047447 Bacteria 7875
200 Ga0495685_014415 3300047447 Bacteria 2686
201 Ga0495685_020888 3300047447 Bacteria 2251
202 Ga0495685_041438 3300047447 Bacteria 1574
203 Ga0495685_058686 3300047447 Bacteria 1299
204 Ga0495681_0000484 3300047470 Bacteria 30579
205 Ga0495681_0050984 3300047470 Bacteria 1948
206 Ga0495684_0391510 3300047471 Bacteria 978
207 Ga0495686_0117588 3300047472 Bacteria 1588
208 Ga0495686_0182775 3300047472 Bacteria 1214
209 Ga0495593_0001318 3300047673 Bacteria 14549
210 Ga0495593_0090847 3300047673 Bacteria 1572
211 Ga0495602_0010449 3300048088 Bacteria 9637
212 Ga0495614_0000529 3300048089 Bacteria 15758
213 Ga0495614_0001808 3300048089 Bacteria 9365
214 Ga0495614_0003444 3300048089 Bacteria 7081
215 Ga0495626_0093197 3300048091 Bacteria 1322
216 Ga0496106_0103644 3300048909 Bacteria 2208
217 Ga0496109_0022562 3300048912 Bacteria 5577
218 Ga0495678_077539 3300049459 Bacteria 1201
219 Ga0501031_0003606 3300049568 Bacteria 9955
220 Ga0501032_0030457 3300049569 Bacteria 3703
221 Ga0501032_0306928 3300049569 Bacteria 1025
222 Ga0501033_0001721 3300049570 Bacteria 19146
223 Ga0501033_0096335 3300049570 Bacteria 2162
224 Ga0501034_0005363 3300049571 Bacteria 14038
225 Ga0501034_0037905 3300049571 Bacteria 4882
226 Ga0501036_0000553 3300049572 Bacteria 26858
227 Ga0501036_0016118 3300049572 Bacteria 6245
228 Ga0501037_0289597 3300049573 Bacteria 1139
229 Ga0501038_0014436 3300049574 Bacteria 7200
230 Ga0501038_0062325 3300049574 Bacteria 3186
231 Ga0501038_0070629 3300049574 Bacteria 2964
232 Ga0501039_0002645 3300049575 Bacteria 13380
233 Ga0501043_0009787 3300049579 Bacteria 7513
234 Ga0501043_0245001 3300049579 Bacteria 1382
235 Ga0501043_0257689 3300049579 Bacteria 1342
236 Ga0501046_0063877 3300049580 Bacteria 2874
237 Ga0501046_0261444 3300049580 Bacteria 1271
238 Ga0501047_0023815 3300049581 Bacteria 5878
239 Ga0501047_0116534 3300049581 Bacteria 2553
240 Ga0501048_0005435 3300049582 Bacteria 9685
241 Ga0501048_0045304 3300049582 Bacteria 3142
242 Ga0501068_0101148 3300049584 Bacteria 1787
243 Ga0501070_0000903 3300049586 Bacteria 27034
244 Ga0501070_0060121 3300049586 Bacteria 3150
245 Ga0501070_0177953 3300049586 Bacteria 1751
246 Ga0501074_0000685 3300049590 Bacteria 21150
247 Ga0501282_003927 3300049778 Bacteria 1594
248 Ga0501035_0001374 3300049822 Bacteria 25051
249 Ga0501035_0007641 3300049822 Bacteria 10102
250 Ga0501035_0026349 3300049822 Bacteria 5320
251 Ga0501044_0004484 3300049823 Bacteria 15612
252 Ga0501044_0007347 3300049823 Bacteria 12111
253 Ga0501044_0038511 3300049823 Bacteria 4992
254 Ga0501044_0177224 3300049823 Bacteria 2100
255 nmdc:mga06z11_1486_c1 3300050494 Bacteria 8701
256 nmdc:mga07m45_33093_c1 3300050496 Bacteria 2869
257 Ga0495655_0020944 3300053083 Bacteria 1473
258 Ga0500644_0010695 3300053088 Bacteria 2489
259 Ga0500640_014393 3300053095 Bacteria 3293
260 Ga0500553_049993 3300053101 Bacteria 2009
261 Ga0500560_000298 3300053107 Bacteria 6300
262 Ga0500572_008378 3300053111 Bacteria 2415
263 Ga0500573_0035100 3300053140 Bacteria 2893
264 Ga0500574_067500 3300053141 Bacteria 1045
265 Ga0500600_0050086 3300053149 Bacteria 2372
266 Ga0500633_0055786 3300053160 Bacteria 1377
267 Ga0500634_0133821 3300053161 Bacteria 1186
268 2547408383 2547132111 Bacteria 8013147
269 2554256219 2554235005 Bacteria 6457341
270 2585296620 2582581312 Bacteria 7308206
271 2585309063 2582581313 Bacteria 10042643
272 2585319253 2582581314 Bacteria 11452267
273 2616697307 2616644814 Bacteria 11555299
274 2616903249 2616644941 Bacteria 8510691
275 2643764027 2643221548 Bacteria 8053412
276 2643902252 2643221578 Bacteria 9213798
277 2643943921 2643221587 Bacteria 7586415
278 2644265801 2643221647 Bacteria 10741251
279 2644386905 2643221670 Bacteria 6497041
280 2644403823 2643221673 Bacteria 9196637
281 2644434658 2643221677 Bacteria 7584031
282 2644440058 2643221678 Bacteria 9540101
283 2644461541 2643221682 Bacteria 6743283
284 2644632617 2643221714 Bacteria 9015452
285 2768642991 2767802112 Bacteria 6465194
286 2784590421 2784132148 Bacteria 8627943
287 2785341194 2784746763 Bacteria 9783172
288 2785371509 2784746768 Bacteria 10036182
289 2786672667 2786546132 Bacteria 10419719
290 2804847911 2802429296 Bacteria 7227771
291 2808844036 2808606359 Bacteria 9866990
292 2808913632 2808606375 Bacteria 9466072
293 2809234094 2808606448 Bacteria 8656184
294 2811844404 2808606982 Bacteria 7791042
295 2812355935 2811994879 Bacteria 9313447
296 2812478744 2811994917 Bacteria 7761064
297 2819694621 2818991463 Bacteria 7948711
298 2852641030 2852635781 Bacteria 8251373
299 2862186420 2862178590 Bacteria 8583590
300 2862284739 2862281513 Bacteria 9621493
301 2862293501 2862290372 Bacteria 7471434
302 2862390576 2862382967 Bacteria 10317375
303 2862512670 2862507626 Bacteria 9425308
304 2862577500 2862574272 Bacteria 10567477
305 2863408624 2863404153 Bacteria 9672205
306 2867430211 2867428634 Bacteria 9590268
307 2873154046 2873151551 Bacteria 8625867
308 2875396701 2875391855 Bacteria 7600475
309 2877679097 2877676314 Bacteria 9512378
310 2912717609 2912715099 Bacteria 9460473
311 2912762760 2912757875 Bacteria 7940295
312 2918506514 2918501144 Bacteria 8668083
313 2919471741 2919468124 Bacteria 9133025
314 2935395083 2935390628 Bacteria 7043367
315 2946047851 2946045630 Bacteria 8527308
316 2946069852 2946064051 Bacteria 8957905
317 2946077769 2946072368 Bacteria 8999607
318 2947226947 2947224130 Bacteria 9938529
319 2954384001 2954380949 Bacteria 10050426
320 2954678960 2954673503 Bacteria 9685905
321 2954685192 2954682443 Bacteria 9862841
322 2954694800 2954691527 Bacteria 10720516
323 2954710002 2954701450 Bacteria 10834262
324 2954714309 2954711539 Bacteria 10867210
325 2954724258 2954721474 Bacteria 10456478
326 2954737582 2954731030 Bacteria 10243860
327 2954743155 2954740390 Bacteria 10229294
328 2954756415 2954749733 Bacteria 10366972
329 2954762113 2954759201 Bacteria 9358192
330 2966600855 2966598605 Bacteria 7676064
331 2990062951 2990059506 Bacteria 9321252
332 2990094490 2990088156 Bacteria 6657676
333 2995467121 2995463766 Bacteria 8577691
334 3006500129 3006493962 Bacteria 8825450
335 8008562795 8008558824 Bacteria 10610750
336 8008577159 8008574985 Bacteria 7815457
337 8023629649 8023623736 Bacteria 8593882
338 8025419418 8025413630 Bacteria 7014048
339 8025531298 8025530807 Bacteria 8495698
340 8033688366 8033684223 Bacteria 6906479
341 8054163298 8054160619 Bacteria 7783213
342 8056672600 8056667051 Bacteria 6953971
343 8056832209 8056829672 Bacteria 9045328
344 Ga0105245_10538531
345 JGI24737J22298_10013068
346 JGI24738J21930_10027825
347 rootH2_10125958
348 rootH1_10014918
349 rootH1_10050643
350 JGI25160J50197_1025278
351 Ga0006562J51391_1088469
352 Ga0068855_100501147
353 Ga0068856_100449925
354 Ga0081455_10092627
355 Ga0075370_10132865
356 Ga0099826_10068081
357 Ga0105251_10018747
358 Ga0105245_10796880
359 Ga0105243_10179760
360 Ga0105246_10002359
361 Ga0157369_10223294
362 Ga0182008_10001523
363 Ga0182007_10001711
364 Ga0183367_1002
365 Ga0209758_1002043
366 Ga0207426_1001450
367 Ga0207696_1030742
368 Ga0207687_10522986
369 Ga0207709_10033275
370 Ga0207667_10135836
371 Ga0207702_10191749
372 Ga0209371_1011596
373 Ga0209813_10027698
374 Ga0307517_10003614
375 Ga0307515_10004012
376 Ga0307515_10067530
377 Ga0307515_10124781
378 Ga0268256_1002847
379 Ga0307511_10002529
380 Ga0307511_10044086
381 Ga0307512_10002762
382 Ga0307513_10066430
383 Ga0307513_10110901
384 Ga0307509_10027300
385 Ga0307509_10044840
386 Ga0307509_10047585
387 Ga0307508_10054955
388 Ga0307514_10054236
389 Ga0307514_10110100
390 Ga0307516_10001694
391 Ga0307516_10019922
392 Ga0307415_100894508
393 Ga0307507_10040869
394 Ga0307507_10049349
395 Ga0307510_10045906
396 Ga0307510_10076655
397 Ga0307510_10093744
398 Ga0307510_10130232
399 Ga0395900_0115516
400 Ga0395898_0104500
401 Ga0395898_0298464
402 Ga0395901_0014818
403 Ga0439436_0000429
404 Ga0439439_0008528
405 Ga0451833_1176889
406 Ga0451837_0024477
407 Ga0451841_1228942
408 Ga0451853_1805508
409 Ga0439433_0000632
410 Ga0439448_0044426
411 Ga0439449_0003102
412 Ga0439449_0034160
413 Ga0439449_0092693
414 Ga0439455_0005163
415 Ga0439457_000481
416 Ga0439457_002452
417 Ga0439462_0006078
418 Ga0450894_002902
419 Ga0450903_000635
420 Ga0450903_008143
421 Ga0439458_0000385
422 Ga0466969_0015675
423 Ga0466965_0071463
424 Ga0466966_0003594
425 Ga0466961_0107697
426 Ga0466963_0004224
427 Ga0466963_0070981
428 Ga0466968_0066158
429 Ga0466970_0023578
430 Ga0466957_0022241
431 Ga0466960_0040587
432 Ga0466959_0024425
433 Ga0466967_0025305
434 Ga0466967_0076172
435 Ga0495617_010342
436 Ga0495627_021671
437 Ga0495592_0078561
438 Ga0495603_0000638
439 Ga0495603_0001879
440 Ga0495603_0003236
441 Ga0495603_0010259
442 Ga0495603_0077806
443 Ga0495590_0020064
444 Ga0495629_0001217
445 Ga0495629_0003212
446 Ga0495629_0016554
447 Ga0495629_0038474
448 Ga0495629_0381478
449 Ga0495638_0176742
450 Ga0495641_0095158
451 Ga0495651_0000989
452 Ga0495653_0050418
453 Ga0495653_0318406
454 Ga0495582_0010514
455 Ga0495582_0062558
456 Ga0495605_0097323
457 Ga0495662_0000804
458 Ga0495662_0002565
459 Ga0495662_0017322
460 Ga0495664_0001534
461 Ga0495594_0001615
462 Ga0495594_0004360
463 Ga0495594_0096080
464 Ga0495607_0169131
465 Ga0495583_0019462
466 Ga0495606_0016910
467 Ga0495606_0063108
468 Ga0495610_0152112
469 Ga0495616_0007635
470 Ga0495618_0076168
471 Ga0495620_0017670
472 Ga0495628_0029965
473 Ga0495630_0005265
474 Ga0495630_0102905
475 Ga0495631_0032556
476 Ga0495643_0026200
477 Ga0495644_0050859
478 Ga0495666_0018532
479 Ga0495652_0020422
480 Ga0495652_0437278
481 Ga0495640_0028129
482 Ga0495587_0001229
483 Ga0495597_0031334
484 Ga0495645_0019834
485 Ga0495645_0133952
486 Ga0495622_0003212
487 Ga0495622_0054626
488 Ga0495667_0088441
489 Ga0495667_0135553
490 Ga0495656_0067844
491 Ga0495668_0139517
492 Ga0495634_0007110
493 Ga0495625_0018730
494 Ga0495635_0003044
495 Ga0495588_0002530
496 Ga0495588_0007213
497 Ga0495588_0009250
498 Ga0495588_0367470
499 Ga0495657_0000796
500 Ga0495657_0032452
501 Ga0495599_0361950
502 Ga0495623_0103694
503 Ga0495646_0002293
504 Ga0495658_0014802
505 Ga0495613_0005466
506 Ga0495613_0033859
507 Ga0495613_0131978
508 Ga0495624_0013227
509 Ga0495624_0082937
510 Ga0495624_0086292
511 Ga0495671_0003815
512 Ga0495589_0006450
513 Ga0495589_0011498
514 Ga0495589_0018600
515 Ga0495589_0047378
516 Ga0495589_0168239
517 Ga0495600_0003691
518 Ga0495581_0004218
519 Ga0495581_0074699
520 Ga0495581_0192467
521 Ga0495581_0207834
522 Ga0495581_0264476
523 Ga0495604_0000695
524 Ga0495604_0067302
525 Ga0495636_0002669
526 Ga0495636_0012023
527 Ga0495636_0172203
528 Ga0495674_0203106
529 Ga0495676_0004474
530 Ga0495676_0007640
531 Ga0495676_0009942
532 Ga0495676_0084125
533 Ga0495676_0119062
534 Ga0495683_0050364
535 Ga0495683_0165055
536 Ga0495687_005559
537 Ga0495687_006824
538 Ga0495687_030609
539 Ga0495687_032494
540 Ga0495687_040850
541 Ga0495675_0005534
542 Ga0495685_001224
543 Ga0495685_014415
544 Ga0495685_020888
545 Ga0495685_041438
546 Ga0495685_058686
547 Ga0495681_0000484
548 Ga0495681_0050984
549 Ga0495684_0391510
550 Ga0495686_0117588
551 Ga0495686_0182775
552 Ga0495593_0001318
553 Ga0495593_0090847
554 Ga0495602_0010449
555 Ga0495614_0000529
556 Ga0495614_0001808
557 Ga0495614_0003444
558 Ga0495626_0093197
559 Ga0496106_0103644
560 Ga0496109_0022562
561 Ga0495678_077539
562 Ga0501031_0003606
563 Ga0501032_0030457
564 Ga0501032_0306928
565 Ga0501033_0001721
566 Ga0501033_0096335
567 Ga0501034_0005363
568 Ga0501034_0037905
569 Ga0501036_0000553
570 Ga0501036_0016118
571 Ga0501037_0289597
572 Ga0501038_0014436
573 Ga0501038_0062325
574 Ga0501038_0070629
575 Ga0501039_0002645
576 Ga0501043_0009787
577 Ga0501043_0245001
578 Ga0501043_0257689
579 Ga0501046_0063877
580 Ga0501046_0261444
581 Ga0501047_0023815
582 Ga0501047_0116534
583 Ga0501048_0005435
584 Ga0501048_0045304
585 Ga0501068_0101148
586 Ga0501070_0000903
587 Ga0501070_0060121
588 Ga0501070_0177953
589 Ga0501074_0000685
590 Ga0501282_003927
591 Ga0501035_0001374
592 Ga0501035_0007641
593 Ga0501035_0026349
594 Ga0501044_0004484
595 Ga0501044_0007347
596 Ga0501044_0038511
597 Ga0501044_0177224
598 nmdc:mga06z11_1486_c1
599 nmdc:mga07m45_33093_c1
600 Ga0495655_0020944
601 Ga0500644_0010695
602 Ga0500640_014393
603 Ga0500553_049993
604 Ga0500560_000298
605 Ga0500572_008378
606 Ga0500573_0035100
607 Ga0500574_067500
608 Ga0500600_0050086
609 Ga0500633_0055786
610 Ga0500634_0133821
611 2547408383
612 2554256219
613 2585296620
614 2585309063
615 2585319253
616 2616697307
617 2616903249
618 2643764027
619 2643902252
620 2643943921
621 2644265801
622 2644386905
623 2644403823
624 2644434658
625 2644440058
626 2644461541
627 2644632617
628 2768642991
629 2784590421
630 2785341194
631 2785371509
632 2786672667
633 2804847911
634 2808844036
635 2808913632
636 2809234094
637 2811844404
638 2812355935
639 2812478744
640 2819694621
641 2852641030
642 2862186420
643 2862284739
644 2862293501
645 2862390576
646 2862512670
647 2862577500
648 2863408624
649 2867430211
650 2873154046
651 2875396701
652 2877679097
653 2912717609
654 2912762760
655 2918506514
656 2919471741
657 2935395083
658 2946047851
659 2946069852
660 2946077769
661 2947226947
662 2954384001
663 2954678960
664 2954685192
665 2954694800
666 2954710002
667 2954714309
668 2954724258
669 2954737582
670 2954743155
671 2954756415
672 2954762113
673 2966600855
674 2990062951
675 2990094490
676 2995467121
677 3006500129
678 8008562795
679 8008577159
680 8023629649
681 8025419418
682 8025531298
683 8033688366
684 8054163298
685 8056672600
686 8056832209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12730

ABC2_membrane_4

ABC-2 family transporter protein

16

201

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r8d-assembly1.cif.gz_B the structure of human abcg1 e242q with cholesterol 0.7025 26 255
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.6995 1 253
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.6975 3 254
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.6903 1 253
7fdv-assembly1.cif.gz_D cryo-em structure of the human cholesterol transporter abcg1 in complex with cholesterol 0.6859 3 254
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6825 61 249 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6624 61 251 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5735 60 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5269 61 249 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5172 61 251 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A4S3GL66-F1-model_v4 deleted 0.9748 1 255
AF-A0A6G4VDJ1-F1-model_v4 ABC transporter permease subunit 0.9741 1 256 GO:0016020
AF-A0A1C4SV79-F1-model_v4 deleted 0.9724 37 256
AF-A0A4S3GL66-F1-model_v4 deleted 0.9674 1 255
AF-A0A100JHL4-F1-model_v4 deleted 0.9638 67 256

Map