F415541

General Info

Members Datasets Scaffolds Average Seq Length
343 201 686 140

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10335096|Ga0105240_103350962
Length 156
Sequence MVGGFMASVAQSTALTDLGGRIMHVHRLNPILNVSNIQQSFAWFEKLGWQKGWEWGSPPTFGGVCSGECEIFLCENGQGGRGRTALPMTFGPKSNEAAEKAVWMSIWVDDVDAVHRRCLEKGIEVTWPPTDMPWNTREMHLRHPDGHVFRVSQGKE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 2.04
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 27.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10335096 3300009093 Bacteria 1720
2 Ga0065715_10284709 3300005293 Bacteria 1077
3 Ga0065707_10421533 3300005295 Unclassified 827
4 Ga0070658_10142880 3300005327 Bacteria 2000
5 Ga0070676_10196361 3300005328 Unclassified 1320
6 Ga0070683_100055221 3300005329 Bacteria 3685
7 Ga0070683_100997152 3300005329 Bacteria 804
8 Ga0070690_100009465 3300005330 Bacteria 5643
9 Ga0070690_100068507 3300005330 Bacteria 2302
10 Ga0070670_100023336 3300005331 Bacteria 5325
11 Ga0070670_100839800 3300005331 Unclassified 831
12 Ga0068869_101418731 3300005334 Unclassified 615
13 Ga0070666_10001377 3300005335 Bacteria 14720
14 Ga0070680_100206681 3300005336 Bacteria 1656
15 Ga0070682_100170776 3300005337 Unclassified 1511
16 Ga0068868_100011878 3300005338 Bacteria 6349
17 Ga0068868_100112589 3300005338 Bacteria 2212
18 Ga0070660_100063021 3300005339 Bacteria 2882
19 Ga0070689_100001799 3300005340 Bacteria 13779
20 Ga0070689_100004330 3300005340 Bacteria 9587
21 Ga0070687_100009035 3300005343 Bacteria 4250
22 Ga0070687_100072171 3300005343 Bacteria 1857
23 Ga0070661_100028203 3300005344 Unclassified 4048
24 Ga0070668_100213659 3300005347 Bacteria 1588
25 Ga0070669_100652717 3300005353 Bacteria 885
26 Ga0070675_100583819 3300005354 Bacteria 1013
27 Ga0070674_100026837 3300005356 Bacteria 3767
28 Ga0070674_100152772 3300005356 Bacteria 1743
29 Ga0070673_100171095 3300005364 Unclassified 1854
30 Ga0070673_100243372 3300005364 Unclassified 1565
31 Ga0070688_100018750 3300005365 Bacteria 3999
32 Ga0070688_100714697 3300005365 Bacteria 777
33 Ga0070688_100789112 3300005365 Bacteria 742
34 Ga0070659_100018017 3300005366 Bacteria 5325
35 Ga0070659_101397040 3300005366 Bacteria 622
36 Ga0070667_100008289 3300005367 Bacteria 8613
37 Ga0070667_101029618 3300005367 Unclassified 768
38 Ga0070703_10003229 3300005406 Bacteria 4651
39 Ga0070709_10000001 3300005434 Bacteria 412391
40 Ga0070701_10064778 3300005438 Bacteria 1938
41 Ga0070705_101627547 3300005440 Bacteria 544
42 Ga0070694_100016845 3300005444 Bacteria 4608
43 Ga0070708_100977767 3300005445 Bacteria 794
44 Ga0070663_100457618 3300005455 Bacteria 1053
45 Ga0070678_100056375 3300005456 Bacteria 2873
46 Ga0070678_101111953 3300005456 Unclassified 730
47 Ga0070678_102167646 3300005456 Unclassified 527
48 Ga0070662_100045033 3300005457 Bacteria 3164
49 Ga0070662_100047147 3300005457 Bacteria 3099
50 Ga0070681_10088700 3300005458 Bacteria 3044
51 Ga0068867_100056973 3300005459 Bacteria 2893
52 Ga0068867_101767684 3300005459 Unclassified 581
53 Ga0070685_10010501 3300005466 Bacteria 4813
54 Ga0070685_10074120 3300005466 Bacteria 2024
55 Ga0070685_10425169 3300005466 Unclassified 925
56 Ga0070706_100598172 3300005467 Bacteria 1025
57 Ga0070706_100797862 3300005467 Bacteria 874
58 Ga0070707_100240234 3300005468 Bacteria 1763
59 Ga0070679_100228717 3300005530 Unclassified 1820
60 Ga0070684_100015671 3300005535 Bacteria 6182
61 Ga0068853_100075116 3300005539 Bacteria 2949
62 Ga0070672_100014121 3300005543 Bacteria 5653
63 Ga0070672_100041926 3300005543 Bacteria 3522
64 Ga0070672_101032832 3300005543 Unclassified 729
65 Ga0070686_100091494 3300005544 Bacteria 2035
66 Ga0070686_100135681 3300005544 Unclassified 1707
67 Ga0070695_100011860 3300005545 Bacteria 5216
68 Ga0070696_101029422 3300005546 Unclassified 689
69 Ga0070665_100205826 3300005548 Unclassified 1968
70 Ga0070665_102158999 3300005548 Unclassified 561
71 Ga0070704_100675317 3300005549 Bacteria 914
72 Ga0068855_100041609 3300005563 Bacteria 5446
73 Ga0070664_100008427 3300005564 Bacteria 8336
74 Ga0070664_100031839 3300005564 Unclassified 4410
75 Ga0068857_100843146 3300005577 Unclassified 877
76 Ga0068857_100850672 3300005577 Unclassified 873
77 Ga0068854_100053201 3300005578 Bacteria 2906
78 Ga0068854_100629059 3300005578 Bacteria 919
79 Ga0068856_100249789 3300005614 Bacteria 1789
80 Ga0070702_100019019 3300005615 Unclassified 3573
81 Ga0070702_100081512 3300005615 Bacteria 1939
82 Ga0068852_100030383 3300005616 Bacteria 4446
83 Ga0068859_100052026 3300005617 Unclassified 4118
84 Ga0068859_100097743 3300005617 Bacteria 2989
85 Ga0068859_100110005 3300005617 Bacteria 2817
86 Ga0068859_100130971 3300005617 Bacteria 2579
87 Ga0068864_100005231 3300005618 Bacteria 10636
88 Ga0068864_100449839 3300005618 Bacteria 1232
89 Ga0068864_100747748 3300005618 Bacteria 958
90 Ga0068866_10034429 3300005718 Bacteria 2467
91 Ga0068861_100169291 3300005719 Unclassified 1809
92 Ga0068851_10015575 3300005834 Bacteria 3625
93 Ga0068870_10098582 3300005840 Bacteria 1647
94 Ga0068863_100069089 3300005841 Unclassified 3340
95 Ga0068863_102514565 3300005841 Unclassified 524
96 Ga0068858_100000522 3300005842 Bacteria 40339
97 Ga0068858_100005396 3300005842 Bacteria 12530
98 Ga0068858_100035286 3300005842 Bacteria 4639
99 Ga0068858_100067733 3300005842 Bacteria 3307
100 Ga0068858_100084227 3300005842 Bacteria 2958
101 Ga0068860_100050248 3300005843 Bacteria 3970
102 Ga0068860_100636205 3300005843 Bacteria 1074
103 Ga0068862_100159301 3300005844 Bacteria 2014
104 Ga0075365_10012968 3300006038 Bacteria 4970
105 Ga0075368_10005281 3300006042 Bacteria 4434
106 Ga0075364_10442855 3300006051 Bacteria 887
107 Ga0075364_11081741 3300006051 Bacteria 544
108 Ga0075362_10124236 3300006177 Bacteria 1223
109 Ga0075367_10001399 3300006178 Bacteria 10334
110 Ga0075366_10000302 3300006195 Bacteria 22298
111 Ga0097621_100054724 3300006237 Unclassified 3256
112 Ga0097621_100092419 3300006237 Bacteria 2534
113 Ga0068871_100117395 3300006358 Unclassified 2244
114 Ga0068871_100243260 3300006358 Bacteria 1565
115 Ga0068871_100245514 3300006358 Bacteria 1558
116 Ga0075428_100095739 3300006844 Bacteria 3236
117 Ga0075428_100282160 3300006844 Unclassified 1787
118 Ga0075428_100476833 3300006844 Bacteria 1335
119 Ga0075428_100690567 3300006844 Unclassified 1087
120 Ga0075428_101582731 3300006844 Unclassified 685
121 Ga0075430_100101608 3300006846 Bacteria 2401
122 Ga0075431_100011972 3300006847 Bacteria 8751
123 Ga0075431_100783008 3300006847 Unclassified 928
124 Ga0075429_100170287 3300006880 Bacteria 1907
125 Ga0075429_100308498 3300006880 Bacteria 1385
126 Ga0068865_100012487 3300006881 Bacteria 5347
127 Ga0097620_100052026 3300006931 Unclassified 4118
128 Ga0097620_100097745 3300006931 Bacteria 2989
129 Ga0097620_100110002 3300006931 Bacteria 2817
130 Ga0097620_100130976 3300006931 Bacteria 2579
131 Ga0075435_100631692 3300007076 Unclassified 929
132 Ga0105240_10024835 3300009093 Bacteria 7890
133 Ga0111539_10000099 3300009094 Bacteria 91525
134 Ga0111539_10181890 3300009094 Bacteria 2455
135 Ga0105245_10000131 3300009098 Bacteria 71486
136 Ga0105245_10022904 3300009098 Bacteria 5480
137 Ga0105245_10043078 3300009098 Bacteria 4027
138 Ga0105245_10253864 3300009098 Bacteria 1709
139 Ga0105247_10012173 3300009101 Bacteria 5172
140 Ga0105247_10072151 3300009101 Unclassified 2161
141 Ga0105247_10274972 3300009101 Bacteria 1160
142 Ga0114129_10087194 3300009147 Bacteria 4328
143 Ga0114129_11267465 3300009147 Unclassified 915
144 Ga0105243_10022878 3300009148 Bacteria 4751
145 Ga0105242_11374591 3300009176 Bacteria 732
146 Ga0105242_12074864 3300009176 Bacteria 612
147 Ga0105248_10009876 3300009177 Bacteria 10509
148 Ga0105248_10069888 3300009177 Bacteria 3943
149 Ga0105248_10240641 3300009177 Unclassified 2037
150 Ga0105237_10090288 3300009545 Bacteria 3053
151 Ga0105238_10082310 3300009551 Unclassified 3209
152 Ga0105238_10084326 3300009551 Bacteria 3167
153 Ga0105238_11316304 3300009551 Bacteria 749
154 Ga0105249_10199309 3300009553 Unclassified 1958
155 Ga0105249_11092259 3300009553 Unclassified 868
156 Ga0105239_10015175 3300010375 Bacteria 8538
157 Ga0105239_10064170 3300010375 Unclassified 4032
158 Ga0105239_11284543 3300010375 Unclassified 844
159 Ga0105246_10012399 3300011119 Bacteria 5317
160 Ga0105246_10347608 3300011119 Bacteria 1214
161 Ga0157373_10057075 3300013100 Bacteria 2770
162 Ga0157369_10032685 3300013105 Bacteria 5719
163 Ga0157374_10014762 3300013296 Bacteria 6839
164 Ga0157374_10022097 3300013296 Bacteria 5671
165 Ga0157378_10109795 3300013297 Bacteria 2527
166 Ga0157378_10821291 3300013297 Unclassified 956
167 Ga0157378_11138271 3300013297 Unclassified 818
168 Ga0163162_10002683 3300013306 Bacteria 16868
169 Ga0163162_10013568 3300013306 Bacteria 7958
170 Ga0163162_10960457 3300013306 Unclassified 965
171 Ga0157372_10580318 3300013307 Bacteria 1307
172 Ga0157375_10008567 3300013308 Bacteria 8957
173 Ga0157375_10046828 3300013308 Bacteria 4219
174 Ga0157375_10067366 3300013308 Bacteria 3577
175 Ga0157375_10175792 3300013308 Bacteria 2290
176 Ga0157375_12214498 3300013308 Unclassified 655
177 Ga0157375_12300192 3300013308 Bacteria 643
178 Ga0163163_10028347 3300014325 Bacteria 5375
179 Ga0163163_10095570 3300014325 Unclassified 2991
180 Ga0163163_10483200 3300014325 Bacteria 1300
181 Ga0157380_11184751 3300014326 Bacteria 807
182 Ga0157380_11519287 3300014326 Bacteria 723
183 Ga0157377_10021275 3300014745 Bacteria 3410
184 Ga0157379_10009374 3300014968 Bacteria 8531
185 Ga0157379_10011693 3300014968 Bacteria 7662
186 Ga0157376_10091612 3300014969 Bacteria 2634
187 Ga0157376_10717801 3300014969 Bacteria 1006
188 Ga0163161_10173767 3300017792 Bacteria 1648
189 Ga0207656_10164456 3300025321 Bacteria 1057
190 Ga0207653_10003656 3300025885 Bacteria 4841
191 Ga0207642_10135075 3300025899 Bacteria 1293
192 Ga0207710_10022161 3300025900 Unclassified 2726
193 Ga0207710_10036646 3300025900 Bacteria 2163
194 Ga0207680_10003647 3300025903 Bacteria 7237
195 Ga0207680_10132584 3300025903 Bacteria 1644
196 Ga0207645_10188656 3300025907 Bacteria 1354
197 Ga0207643_10105419 3300025908 Bacteria 1656
198 Ga0207705_10059301 3300025909 Bacteria 2762
199 Ga0207707_10183670 3300025912 Unclassified 1825
200 Ga0207695_10041645 3300025913 Bacteria 4915
201 Ga0207695_10643480 3300025913 Unclassified 941
202 Ga0207671_10070621 3300025914 Bacteria 2604
203 Ga0207660_10126947 3300025917 Bacteria 1938
204 Ga0207662_10001449 3300025918 Bacteria 11509
205 Ga0207657_10044395 3300025919 Bacteria 3907
206 Ga0207657_10465665 3300025919 Unclassified 991
207 Ga0207649_10032595 3300025920 Unclassified 3108
208 Ga0207649_10103558 3300025920 Unclassified 1888
209 Ga0207681_10753261 3300025923 Bacteria 812
210 Ga0207694_10024652 3300025924 Unclassified 4569
211 Ga0207694_10131101 3300025924 Bacteria 2009
212 Ga0207650_10029509 3300025925 Unclassified 3943
213 Ga0207650_10050189 3300025925 Bacteria 3084
214 Ga0207650_10975909 3300025925 Unclassified 720
215 Ga0207659_10121744 3300025926 Bacteria 2000
216 Ga0207659_10230523 3300025926 Unclassified 1493
217 Ga0207687_10012490 3300025927 Bacteria 5547
218 Ga0207687_10028517 3300025927 Bacteria 3750
219 Ga0207687_10076898 3300025927 Bacteria 2399
220 Ga0207687_10524966 3300025927 Unclassified 991
221 Ga0207644_10038301 3300025931 Unclassified 3376
222 Ga0207690_10125412 3300025932 Unclassified 1871
223 Ga0207690_10426524 3300025932 Bacteria 1062
224 Ga0207706_10029667 3300025933 Bacteria 4882
225 Ga0207706_10034587 3300025933 Bacteria 4495
226 Ga0207706_10322031 3300025933 Bacteria 1345
227 Ga0207706_10942577 3300025933 Unclassified 728
228 Ga0207709_10091968 3300025935 Bacteria 1985
229 Ga0207670_10000768 3300025936 Bacteria 16882
230 Ga0207670_10143819 3300025936 Bacteria 1761
231 Ga0207670_10260813 3300025936 Unclassified 1343
232 Ga0207669_10824896 3300025937 Unclassified 770
233 Ga0207669_11404307 3300025937 Unclassified 594
234 Ga0207691_10005881 3300025940 Bacteria 11847
235 Ga0207691_10130787 3300025940 Bacteria 2218
236 Ga0207711_10006258 3300025941 Bacteria 10043
237 Ga0207711_10059549 3300025941 Bacteria 3288
238 Ga0207689_10097607 3300025942 Bacteria 2414
239 Ga0207689_10137897 3300025942 Unclassified 2009
240 Ga0207689_10858879 3300025942 Bacteria 766
241 Ga0207689_11318239 3300025942 Unclassified 606
242 Ga0207661_10044804 3300025944 Bacteria 3499
243 Ga0207661_10441145 3300025944 Bacteria 1185
244 Ga0207679_10007452 3300025945 Bacteria 6942
245 Ga0207679_10015026 3300025945 Bacteria 5103
246 Ga0207667_10188102 3300025949 Unclassified 2119
247 Ga0207651_10047627 3300025960 Bacteria 2892
248 Ga0207651_10370215 3300025960 Unclassified 1212
249 Ga0207712_10275871 3300025961 Bacteria 1370
250 Ga0207712_10366651 3300025961 Unclassified 1202
251 Ga0207668_10223621 3300025972 Bacteria 1513
252 Ga0207640_10074931 3300025981 Unclassified 2292
253 Ga0207640_10700470 3300025981 Unclassified 868
254 Ga0207658_10026177 3300025986 Unclassified 4087
255 Ga0207658_10636669 3300025986 Bacteria 960
256 Ga0207677_10016864 3300026023 Bacteria 4338
257 Ga0207677_10020629 3300026023 Unclassified 4005
258 Ga0207677_10115230 3300026023 Bacteria 2010
259 Ga0207703_10000212 3300026035 Bacteria 67995
260 Ga0207703_10027436 3300026035 Bacteria 4485
261 Ga0207703_10163446 3300026035 Bacteria 1952
262 Ga0207703_10175262 3300026035 Unclassified 1889
263 Ga0207703_11363051 3300026035 Unclassified 682
264 Ga0207639_10143482 3300026041 Bacteria 1992
265 Ga0207678_10021502 3300026067 Bacteria 5657
266 Ga0207708_10089153 3300026075 Unclassified 2377
267 Ga0207641_10080405 3300026088 Unclassified 2827
268 Ga0207641_10153748 3300026088 Bacteria 2086
269 Ga0207648_10035711 3300026089 Bacteria 4380
270 Ga0207648_11288279 3300026089 Bacteria 687
271 Ga0207676_10042219 3300026095 Unclassified 3506
272 Ga0207676_10066633 3300026095 Bacteria 2873
273 Ga0207676_10425974 3300026095 Bacteria 1246
274 Ga0207676_10675443 3300026095 Bacteria 999
275 Ga0207674_10037155 3300026116 Bacteria 5068
276 Ga0207674_10199985 3300026116 Bacteria 1948
277 Ga0207675_100041443 3300026118 Bacteria 4300
278 Ga0207675_100600416 3300026118 Unclassified 1104
279 Ga0207683_10038905 3300026121 Bacteria 4148
280 Ga0207683_10262931 3300026121 Bacteria 1576
281 Ga0207683_11303211 3300026121 Bacteria 672
282 Ga0207698_10024597 3300026142 Bacteria 4230
283 Ga0209813_10094247 3300027866 Bacteria 1010
284 Ga0207428_10000201 3300027907 Bacteria 83434
285 Ga0207428_10054794 3300027907 Bacteria 3174
286 Ga0268266_10090695 3300028379 Unclassified 2679
287 Ga0268266_10473714 3300028379 Bacteria 1193
288 Ga0268265_10586445 3300028380 Bacteria 1063
289 Ga0268265_11059663 3300028380 Bacteria 803
290 Ga0268265_12046519 3300028380 Unclassified 580
291 Ga0268264_10032149 3300028381 Bacteria 4305
292 Ga0268264_10580514 3300028381 Unclassified 1103
293 Ga0307405_10150161 3300031731 Bacteria 1637
294 Ga0307413_10166191 3300031824 Bacteria 1556
295 Ga0307410_10009235 3300031852 Bacteria 5519
296 Ga0307412_10033166 3300031911 Unclassified 3280
297 Ga0307409_100020102 3300031995 Unclassified 4542
298 Ga0307415_100091278 3300032126 Bacteria 2206
299 Ga0373961_0304963 3300035241 Bacteria 590
300 Ga0373933_0018792 3300035724 Bacteria 3892
301 Ga0373937_1056890 3300036401 Bacteria 761
302 Ga0395898_0121402 3300037466 Bacteria 2503
303 Ga0450918_021761 3300042531 Bacteria 1120
304 Ga0451576_0543696 3300045051 Bacteria 1220
305 Ga0466967_1643799 3300045976 Unclassified 640
306 Ga0495625_0569308 3300046660 Unclassified 684
307 Ga0496102_0560686 3300048905 Bacteria 1065
308 Ga0496106_0194104 3300048909 Unclassified 1615
309 Ga0496108_0093014 3300048911 Unclassified 2564
310 Ga0496110_0386778 3300048913 Bacteria 1275
311 Ga0496112_0007829 3300048915 Bacteria 9510
312 Ga0496112_1283847 3300048915 Bacteria 648
313 Ga0496113_0096038 3300048916 Unclassified 2291
314 Ga0501036_0285269 3300049572 Bacteria 1382
315 Ga0501038_0889753 3300049574 Unclassified 658
316 Ga0501046_0866967 3300049580 Bacteria 631
317 Ga0501071_0753419 3300049587 Bacteria 750
318 Ga0501071_0977755 3300049587 Bacteria 654
319 Ga0501075_0085403 3300049591 Bacteria 2391
320 Ga0501075_1350684 3300049591 Unclassified 540
321 Ga0501076_0068672 3300049592 Bacteria 2831
322 Ga0501076_1373081 3300049592 Bacteria 581
323 Ga0501080_0070461 3300049742 Bacteria 3252
324 Ga0501083_0725469 3300049744 Bacteria 646
325 nmdc:mga03683_72601_c1 3300050489 Bacteria 1474
326 nmdc:mga03683_9760_c1 3300050489 Bacteria 2370
327 nmdc:mga00v17_34894_c1 3300050491 Bacteria 2991
328 nmdc:mga0yw44_15675_c1 3300050492 Unclassified 4068
329 nmdc:mga0k408_716_c1 3300050493 Bacteria 18166
330 nmdc:mga06z11_1703_c1 3300050494 Bacteria 8252
331 nmdc:mga04h51_38930_c1 3300050495 Bacteria 1542
332 nmdc:mga05p37_1071614_c1 3300050507 Unclassified 847
333 nmdc:mga09592_155262_c1 3300050508 Bacteria 1975
334 nmdc:mga09592_192783_c1 3300050508 Bacteria 1764
335 nmdc:mga0qj67_54985_c1 3300050509 Bacteria 3152
336 nmdc:mga06r32_126689_c1 3300050510 Bacteria 2523
337 nmdc:mga06r32_591236_c1 3300050510 Bacteria 1081
338 nmdc:mga08y16_122_c1 3300050511 Bacteria 67305
339 nmdc:mga08y16_87567_c1 3300050511 Bacteria 3245
340 Ga0495601_0004523 3300053077 Bacteria 8041
341 Ga0495601_0670564 3300053077 Bacteria 663
342 Ga0501084_0788515 3300054114 Bacteria 800
343 Ga0530510_1450905 3300061734 Bacteria 527
344 Ga0105240_10335096
345 Ga0065715_10284709
346 Ga0065707_10421533
347 Ga0070658_10142880
348 Ga0070676_10196361
349 Ga0070683_100055221
350 Ga0070683_100997152
351 Ga0070690_100009465
352 Ga0070690_100068507
353 Ga0070670_100023336
354 Ga0070670_100839800
355 Ga0068869_101418731
356 Ga0070666_10001377
357 Ga0070680_100206681
358 Ga0070682_100170776
359 Ga0068868_100011878
360 Ga0068868_100112589
361 Ga0070660_100063021
362 Ga0070689_100001799
363 Ga0070689_100004330
364 Ga0070687_100009035
365 Ga0070687_100072171
366 Ga0070661_100028203
367 Ga0070668_100213659
368 Ga0070669_100652717
369 Ga0070675_100583819
370 Ga0070674_100026837
371 Ga0070674_100152772
372 Ga0070673_100171095
373 Ga0070673_100243372
374 Ga0070688_100018750
375 Ga0070688_100714697
376 Ga0070688_100789112
377 Ga0070659_100018017
378 Ga0070659_101397040
379 Ga0070667_100008289
380 Ga0070667_101029618
381 Ga0070703_10003229
382 Ga0070709_10000001
383 Ga0070701_10064778
384 Ga0070705_101627547
385 Ga0070694_100016845
386 Ga0070708_100977767
387 Ga0070663_100457618
388 Ga0070678_100056375
389 Ga0070678_101111953
390 Ga0070678_102167646
391 Ga0070662_100045033
392 Ga0070662_100047147
393 Ga0070681_10088700
394 Ga0068867_100056973
395 Ga0068867_101767684
396 Ga0070685_10010501
397 Ga0070685_10074120
398 Ga0070685_10425169
399 Ga0070706_100598172
400 Ga0070706_100797862
401 Ga0070707_100240234
402 Ga0070679_100228717
403 Ga0070684_100015671
404 Ga0068853_100075116
405 Ga0070672_100014121
406 Ga0070672_100041926
407 Ga0070672_101032832
408 Ga0070686_100091494
409 Ga0070686_100135681
410 Ga0070695_100011860
411 Ga0070696_101029422
412 Ga0070665_100205826
413 Ga0070665_102158999
414 Ga0070704_100675317
415 Ga0068855_100041609
416 Ga0070664_100008427
417 Ga0070664_100031839
418 Ga0068857_100843146
419 Ga0068857_100850672
420 Ga0068854_100053201
421 Ga0068854_100629059
422 Ga0068856_100249789
423 Ga0070702_100019019
424 Ga0070702_100081512
425 Ga0068852_100030383
426 Ga0068859_100052026
427 Ga0068859_100097743
428 Ga0068859_100110005
429 Ga0068859_100130971
430 Ga0068864_100005231
431 Ga0068864_100449839
432 Ga0068864_100747748
433 Ga0068866_10034429
434 Ga0068861_100169291
435 Ga0068851_10015575
436 Ga0068870_10098582
437 Ga0068863_100069089
438 Ga0068863_102514565
439 Ga0068858_100000522
440 Ga0068858_100005396
441 Ga0068858_100035286
442 Ga0068858_100067733
443 Ga0068858_100084227
444 Ga0068860_100050248
445 Ga0068860_100636205
446 Ga0068862_100159301
447 Ga0075365_10012968
448 Ga0075368_10005281
449 Ga0075364_10442855
450 Ga0075364_11081741
451 Ga0075362_10124236
452 Ga0075367_10001399
453 Ga0075366_10000302
454 Ga0097621_100054724
455 Ga0097621_100092419
456 Ga0068871_100117395
457 Ga0068871_100243260
458 Ga0068871_100245514
459 Ga0075428_100095739
460 Ga0075428_100282160
461 Ga0075428_100476833
462 Ga0075428_100690567
463 Ga0075428_101582731
464 Ga0075430_100101608
465 Ga0075431_100011972
466 Ga0075431_100783008
467 Ga0075429_100170287
468 Ga0075429_100308498
469 Ga0068865_100012487
470 Ga0097620_100052026
471 Ga0097620_100097745
472 Ga0097620_100110002
473 Ga0097620_100130976
474 Ga0075435_100631692
475 Ga0105240_10024835
476 Ga0111539_10000099
477 Ga0111539_10181890
478 Ga0105245_10000131
479 Ga0105245_10022904
480 Ga0105245_10043078
481 Ga0105245_10253864
482 Ga0105247_10012173
483 Ga0105247_10072151
484 Ga0105247_10274972
485 Ga0114129_10087194
486 Ga0114129_11267465
487 Ga0105243_10022878
488 Ga0105242_11374591
489 Ga0105242_12074864
490 Ga0105248_10009876
491 Ga0105248_10069888
492 Ga0105248_10240641
493 Ga0105237_10090288
494 Ga0105238_10082310
495 Ga0105238_10084326
496 Ga0105238_11316304
497 Ga0105249_10199309
498 Ga0105249_11092259
499 Ga0105239_10015175
500 Ga0105239_10064170
501 Ga0105239_11284543
502 Ga0105246_10012399
503 Ga0105246_10347608
504 Ga0157373_10057075
505 Ga0157369_10032685
506 Ga0157374_10014762
507 Ga0157374_10022097
508 Ga0157378_10109795
509 Ga0157378_10821291
510 Ga0157378_11138271
511 Ga0163162_10002683
512 Ga0163162_10013568
513 Ga0163162_10960457
514 Ga0157372_10580318
515 Ga0157375_10008567
516 Ga0157375_10046828
517 Ga0157375_10067366
518 Ga0157375_10175792
519 Ga0157375_12214498
520 Ga0157375_12300192
521 Ga0163163_10028347
522 Ga0163163_10095570
523 Ga0163163_10483200
524 Ga0157380_11184751
525 Ga0157380_11519287
526 Ga0157377_10021275
527 Ga0157379_10009374
528 Ga0157379_10011693
529 Ga0157376_10091612
530 Ga0157376_10717801
531 Ga0163161_10173767
532 Ga0207656_10164456
533 Ga0207653_10003656
534 Ga0207642_10135075
535 Ga0207710_10022161
536 Ga0207710_10036646
537 Ga0207680_10003647
538 Ga0207680_10132584
539 Ga0207645_10188656
540 Ga0207643_10105419
541 Ga0207705_10059301
542 Ga0207707_10183670
543 Ga0207695_10041645
544 Ga0207695_10643480
545 Ga0207671_10070621
546 Ga0207660_10126947
547 Ga0207662_10001449
548 Ga0207657_10044395
549 Ga0207657_10465665
550 Ga0207649_10032595
551 Ga0207649_10103558
552 Ga0207681_10753261
553 Ga0207694_10024652
554 Ga0207694_10131101
555 Ga0207650_10029509
556 Ga0207650_10050189
557 Ga0207650_10975909
558 Ga0207659_10121744
559 Ga0207659_10230523
560 Ga0207687_10012490
561 Ga0207687_10028517
562 Ga0207687_10076898
563 Ga0207687_10524966
564 Ga0207644_10038301
565 Ga0207690_10125412
566 Ga0207690_10426524
567 Ga0207706_10029667
568 Ga0207706_10034587
569 Ga0207706_10322031
570 Ga0207706_10942577
571 Ga0207709_10091968
572 Ga0207670_10000768
573 Ga0207670_10143819
574 Ga0207670_10260813
575 Ga0207669_10824896
576 Ga0207669_11404307
577 Ga0207691_10005881
578 Ga0207691_10130787
579 Ga0207711_10006258
580 Ga0207711_10059549
581 Ga0207689_10097607
582 Ga0207689_10137897
583 Ga0207689_10858879
584 Ga0207689_11318239
585 Ga0207661_10044804
586 Ga0207661_10441145
587 Ga0207679_10007452
588 Ga0207679_10015026
589 Ga0207667_10188102
590 Ga0207651_10047627
591 Ga0207651_10370215
592 Ga0207712_10275871
593 Ga0207712_10366651
594 Ga0207668_10223621
595 Ga0207640_10074931
596 Ga0207640_10700470
597 Ga0207658_10026177
598 Ga0207658_10636669
599 Ga0207677_10016864
600 Ga0207677_10020629
601 Ga0207677_10115230
602 Ga0207703_10000212
603 Ga0207703_10027436
604 Ga0207703_10163446
605 Ga0207703_10175262
606 Ga0207703_11363051
607 Ga0207639_10143482
608 Ga0207678_10021502
609 Ga0207708_10089153
610 Ga0207641_10080405
611 Ga0207641_10153748
612 Ga0207648_10035711
613 Ga0207648_11288279
614 Ga0207676_10042219
615 Ga0207676_10066633
616 Ga0207676_10425974
617 Ga0207676_10675443
618 Ga0207674_10037155
619 Ga0207674_10199985
620 Ga0207675_100041443
621 Ga0207675_100600416
622 Ga0207683_10038905
623 Ga0207683_10262931
624 Ga0207683_11303211
625 Ga0207698_10024597
626 Ga0209813_10094247
627 Ga0207428_10000201
628 Ga0207428_10054794
629 Ga0268266_10090695
630 Ga0268266_10473714
631 Ga0268265_10586445
632 Ga0268265_11059663
633 Ga0268265_12046519
634 Ga0268264_10032149
635 Ga0268264_10580514
636 Ga0307405_10150161
637 Ga0307413_10166191
638 Ga0307410_10009235
639 Ga0307412_10033166
640 Ga0307409_100020102
641 Ga0307415_100091278
642 Ga0373961_0304963
643 Ga0373933_0018792
644 Ga0373937_1056890
645 Ga0395898_0121402
646 Ga0450918_021761
647 Ga0451576_0543696
648 Ga0466967_1643799
649 Ga0495625_0569308
650 Ga0496102_0560686
651 Ga0496106_0194104
652 Ga0496108_0093014
653 Ga0496110_0386778
654 Ga0496112_0007829
655 Ga0496112_1283847
656 Ga0496113_0096038
657 Ga0501036_0285269
658 Ga0501038_0889753
659 Ga0501046_0866967
660 Ga0501071_0753419
661 Ga0501071_0977755
662 Ga0501075_0085403
663 Ga0501075_1350684
664 Ga0501076_0068672
665 Ga0501076_1373081
666 Ga0501080_0070461
667 Ga0501083_0725469
668 nmdc:mga03683_72601_c1
669 nmdc:mga03683_9760_c1
670 nmdc:mga00v17_34894_c1
671 nmdc:mga0yw44_15675_c1
672 nmdc:mga0k408_716_c1
673 nmdc:mga06z11_1703_c1
674 nmdc:mga04h51_38930_c1
675 nmdc:mga05p37_1071614_c1
676 nmdc:mga09592_155262_c1
677 nmdc:mga09592_192783_c1
678 nmdc:mga0qj67_54985_c1
679 nmdc:mga06r32_126689_c1
680 nmdc:mga06r32_591236_c1
681 nmdc:mga08y16_122_c1
682 nmdc:mga08y16_87567_c1
683 Ga0495601_0004523
684 Ga0495601_0670564
685 Ga0501084_0788515
686 Ga0530510_1450905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

151

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.8329 1 131
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.806 3 133
2i7r-assembly1.cif.gz_B conserved domain protein 0.8051 5 132
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7999 3 133
4n04-assembly1.cif.gz_A the crystal structure of glyoxalase / bleomycin resistance protein from catenulispora acidiphila dsm 44928 0.7963 3 131
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9423 79 129 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.922 80 133 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8974 80 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8893 79 129 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8766 80 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2V9UTV9-F1-model_v4 Bleomycin resistance protein 0.9951 1 134
AF-A0A3M0XFE0-F1-model_v4 Bleomycin resistance family protein 0.9917 1 135
AF-A0A2V8ML47-F1-model_v4 Glyoxalase 0.9884 80 134
AF-A0A2V9UTV9-F1-model_v4 Bleomycin resistance protein 0.9877 1 134
AF-A0A6L7JXI2-F1-model_v4 deleted 0.9866 16 134

Map