F415523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 189 | 343 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100590484|Ga0068871_1005904842 |
| Length | 167 |
| Sequence | MPHSDSENCLCYTKIKGVGMKIFLGGDHNGFERKKELAEYLRRSGYEVIDEGDKNLEPEDDFPQFASRVVNAMRAEGEDARGILICGSGQGMCMAANRFKGIRAALASDQEEARSARNDDDSNILCVSSRYLDFDTTVGIVHTWLITPFAGASRFKRRIAQLDDLGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 67 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 68 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 69 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 121 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 122 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 123 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 135 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 136 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 137 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 150 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 157 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 158 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 162 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 164 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 165 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 167 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 168 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 169 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 170 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 171 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 172 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 173 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 174 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 175 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 176 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 177 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 178 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 179 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 180 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 181 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 182 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 183 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 184 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 187 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 189 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.95 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 69.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000038 | 3300001915 | Bacteria | 31009 |
| 2 | JGI24741J21665_1004123 | 3300001915 | Unclassified | 3291 |
| 3 | JGI24740J21852_10025542 | 3300001979 | Unclassified | 1990 |
| 4 | JGI24737J22298_10000095 | 3300001990 | Bacteria | 26030 |
| 5 | JGI24735J21928_10000419 | 3300002067 | Bacteria | 14834 |
| 6 | rootH2_10006847 | 3300003320 | Bacteria | 155484 |
| 7 | rootH2_10265633 | 3300003320 | Unclassified | 1577 |
| 8 | rootL2_10032831 | 3300003322 | Bacteria | 1859 |
| 9 | rootL2_10345651 | 3300003322 | Bacteria | 1656 |
| 10 | rootH1_10333123 | 3300003323 | Bacteria | 1134 |
| 11 | JGI25405J52794_10000208 | 3300003911 | Bacteria | 7663 |
| 12 | Ga0065704_10310638 | 3300005289 | Bacteria | 869 |
| 13 | Ga0070658_10000020 | 3300005327 | Bacteria | 188851 |
| 14 | Ga0070658_10000698 | 3300005327 | Bacteria | 29119 |
| 15 | Ga0070658_10004259 | 3300005327 | Bacteria | 11691 |
| 16 | Ga0070658_10007725 | 3300005327 | Bacteria | 8663 |
| 17 | Ga0070658_10027230 | 3300005327 | Bacteria | 4589 |
| 18 | Ga0070658_10034880 | 3300005327 | Unclassified | 4049 |
| 19 | Ga0070658_10051728 | 3300005327 | Bacteria | 3329 |
| 20 | Ga0070677_10022032 | 3300005333 | Unclassified | 2342 |
| 21 | Ga0070680_100871562 | 3300005336 | Unclassified | 776 |
| 22 | Ga0070660_100000224 | 3300005339 | Bacteria | 37460 |
| 23 | Ga0070660_100000454 | 3300005339 | Bacteria | 27343 |
| 24 | Ga0070660_100189675 | 3300005339 | Unclassified | 1665 |
| 25 | Ga0070691_10001232 | 3300005341 | Bacteria | 10772 |
| 26 | Ga0070692_10271938 | 3300005345 | Bacteria | 1023 |
| 27 | Ga0070671_100114573 | 3300005355 | Bacteria | 2266 |
| 28 | Ga0070674_100013892 | 3300005356 | Unclassified | 4991 |
| 29 | Ga0070674_100595563 | 3300005356 | Bacteria | 933 |
| 30 | Ga0070673_100000478 | 3300005364 | Bacteria | 21291 |
| 31 | Ga0070688_100574294 | 3300005365 | Bacteria | 860 |
| 32 | Ga0070659_100001084 | 3300005366 | Bacteria | 19882 |
| 33 | Ga0070659_100121733 | 3300005366 | Unclassified | 2114 |
| 34 | Ga0070667_100002835 | 3300005367 | Bacteria | 14959 |
| 35 | Ga0070667_100131750 | 3300005367 | Bacteria | 2183 |
| 36 | Ga0070700_100035333 | 3300005441 | Bacteria | 3024 |
| 37 | Ga0070678_100017282 | 3300005456 | Bacteria | 4640 |
| 38 | Ga0070681_10311194 | 3300005458 | Bacteria | 1484 |
| 39 | Ga0070685_10001150 | 3300005466 | Bacteria | 14152 |
| 40 | Ga0070685_10002053 | 3300005466 | Bacteria | 10422 |
| 41 | Ga0070679_100018926 | 3300005530 | Bacteria | 6687 |
| 42 | Ga0070679_100389126 | 3300005530 | Bacteria | 1341 |
| 43 | Ga0070679_101186887 | 3300005530 | Unclassified | 708 |
| 44 | Ga0070684_100595851 | 3300005535 | Bacteria | 1027 |
| 45 | Ga0070672_100024525 | 3300005543 | Bacteria | 4460 |
| 46 | Ga0070686_100250173 | 3300005544 | Bacteria | 1294 |
| 47 | Ga0070665_100019100 | 3300005548 | Bacteria | 6876 |
| 48 | Ga0070665_100327066 | 3300005548 | Bacteria | 1537 |
| 49 | Ga0068855_100000211 | 3300005563 | Bacteria | 74558 |
| 50 | Ga0068855_100091960 | 3300005563 | Bacteria | 3499 |
| 51 | Ga0068857_100000002 | 3300005577 | Bacteria | 241401 |
| 52 | Ga0068856_100032328 | 3300005614 | Bacteria | 5122 |
| 53 | Ga0068859_101786424 | 3300005617 | Bacteria | 679 |
| 54 | Ga0068864_100894786 | 3300005618 | Bacteria | 876 |
| 55 | Ga0068866_10685237 | 3300005718 | Bacteria | 701 |
| 56 | Ga0068861_100930683 | 3300005719 | Bacteria | 825 |
| 57 | Ga0068863_100083636 | 3300005841 | Bacteria | 3024 |
| 58 | Ga0068863_100220357 | 3300005841 | Bacteria | 1828 |
| 59 | Ga0068863_102347961 | 3300005841 | Bacteria | 543 |
| 60 | Ga0068858_100149488 | 3300005842 | Bacteria | 2195 |
| 61 | Ga0068858_100731878 | 3300005842 | Bacteria | 963 |
| 62 | Ga0068860_100114349 | 3300005843 | Bacteria | 2581 |
| 63 | Ga0068862_100036003 | 3300005844 | Bacteria | 4193 |
| 64 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 65 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 66 | Ga0075365_10000020 | 3300006038 | Bacteria | 64494 |
| 67 | Ga0075365_10002844 | 3300006038 | Bacteria | 8686 |
| 68 | Ga0075365_10079015 | 3300006038 | Bacteria | 2225 |
| 69 | Ga0075368_10002443 | 3300006042 | Bacteria | 6065 |
| 70 | Ga0075368_10049769 | 3300006042 | Bacteria | 1663 |
| 71 | Ga0075363_100000016 | 3300006048 | Bacteria | 38279 |
| 72 | Ga0075364_10045228 | 3300006051 | Unclassified | 2865 |
| 73 | Ga0075364_10080408 | 3300006051 | Bacteria | 2154 |
| 74 | Ga0075364_10168680 | 3300006051 | Bacteria | 1479 |
| 75 | Ga0075362_10000073 | 3300006177 | Bacteria | 27914 |
| 76 | Ga0075362_10501769 | 3300006177 | Bacteria | 620 |
| 77 | Ga0075367_10000637 | 3300006178 | Bacteria | 13436 |
| 78 | Ga0075369_10000005 | 3300006186 | Bacteria | 147699 |
| 79 | Ga0075369_10000051 | 3300006186 | Bacteria | 29832 |
| 80 | Ga0075369_10173372 | 3300006186 | Bacteria | 991 |
| 81 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 82 | Ga0075366_10000044 | 3300006195 | Bacteria | 45021 |
| 83 | Ga0075366_10000342 | 3300006195 | Bacteria | 21427 |
| 84 | Ga0075366_10009291 | 3300006195 | Bacteria | 5491 |
| 85 | Ga0075366_10010754 | 3300006195 | Bacteria | 5144 |
| 86 | Ga0097621_100001002 | 3300006237 | Bacteria | 19854 |
| 87 | Ga0097621_100547018 | 3300006237 | Unclassified | 1053 |
| 88 | Ga0097621_100735389 | 3300006237 | Bacteria | 910 |
| 89 | Ga0075370_10017117 | 3300006353 | Bacteria | 3912 |
| 90 | Ga0075370_10167409 | 3300006353 | Bacteria | 1291 |
| 91 | Ga0075370_10265450 | 3300006353 | Bacteria | 1018 |
| 92 | Ga0068871_100000156 | 3300006358 | Bacteria | 45103 |
| 93 | Ga0068871_100590484 | 3300006358 | Bacteria | 1009 |
| 94 | Ga0075428_100034021 | 3300006844 | Bacteria | 5622 |
| 95 | Ga0075430_100025155 | 3300006846 | Bacteria | 5063 |
| 96 | Ga0097620_101786342 | 3300006931 | Bacteria | 679 |
| 97 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 98 | Ga0105240_10042730 | 3300009093 | Bacteria | 5774 |
| 99 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 100 | Ga0105245_10000122 | 3300009098 | Bacteria | 75415 |
| 101 | Ga0105245_10003504 | 3300009098 | Bacteria | 14046 |
| 102 | Ga0105245_10034602 | 3300009098 | Unclassified | 4482 |
| 103 | Ga0105245_10095193 | 3300009098 | Bacteria | 2747 |
| 104 | Ga0105245_10850433 | 3300009098 | Bacteria | 952 |
| 105 | Ga0105245_11746075 | 3300009098 | Unclassified | 675 |
| 106 | Ga0105247_10043015 | 3300009101 | Unclassified | 2767 |
| 107 | Ga0105247_10072194 | 3300009101 | Bacteria | 2160 |
| 108 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 109 | Ga0105243_10008792 | 3300009148 | Bacteria | 7735 |
| 110 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 111 | Ga0105241_10632418 | 3300009174 | Bacteria | 970 |
| 112 | Ga0105241_10807353 | 3300009174 | Unclassified | 865 |
| 113 | Ga0105242_10000064 | 3300009176 | Bacteria | 74150 |
| 114 | Ga0105242_10001814 | 3300009176 | Bacteria | 16772 |
| 115 | Ga0105242_10111899 | 3300009176 | Bacteria | 2329 |
| 116 | Ga0105242_10455813 | 3300009176 | Bacteria | 1207 |
| 117 | Ga0105248_10322747 | 3300009177 | Bacteria | 1739 |
| 118 | Ga0105237_10009676 | 3300009545 | Bacteria | 10316 |
| 119 | Ga0105237_10178780 | 3300009545 | Bacteria | 2122 |
| 120 | Ga0105238_10141789 | 3300009551 | Bacteria | 2380 |
| 121 | Ga0105238_10288211 | 3300009551 | Bacteria | 1624 |
| 122 | Ga0105238_10673636 | 3300009551 | Unclassified | 1045 |
| 123 | Ga0105032_100054 | 3300009979 | Bacteria | 14092 |
| 124 | Ga0105029_100020 | 3300009984 | Bacteria | 8175 |
| 125 | Ga0105033_100510 | 3300009986 | Bacteria | 3014 |
| 126 | Ga0105033_101944 | 3300009986 | Unclassified | 1706 |
| 127 | Ga0105033_103919 | 3300009986 | Bacteria | 1264 |
| 128 | Ga0105030_102457 | 3300009987 | Unclassified | 1610 |
| 129 | Ga0105239_10068970 | 3300010375 | Bacteria | 3886 |
| 130 | Ga0105239_10115049 | 3300010375 | Bacteria | 2984 |
| 131 | Ga0105239_10352446 | 3300010375 | Bacteria | 1662 |
| 132 | Ga0105239_11541919 | 3300010375 | Unclassified | 768 |
| 133 | Ga0105246_11344652 | 3300011119 | Bacteria | 664 |
| 134 | Ga0157371_10000937 | 3300013102 | Bacteria | 32624 |
| 135 | Ga0157369_10000261 | 3300013105 | Bacteria | 71207 |
| 136 | Ga0157369_10370420 | 3300013105 | Unclassified | 1487 |
| 137 | Ga0157369_10545917 | 3300013105 | Unclassified | 1198 |
| 138 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 139 | Ga0157374_10000934 | 3300013296 | Bacteria | 25443 |
| 140 | Ga0157374_10001692 | 3300013296 | Bacteria | 18472 |
| 141 | Ga0157374_10021134 | 3300013296 | Bacteria | 5785 |
| 142 | Ga0157378_10052886 | 3300013297 | Bacteria | 3614 |
| 143 | Ga0157378_10126237 | 3300013297 | Bacteria | 2364 |
| 144 | Ga0157378_10146442 | 3300013297 | Unclassified | 2197 |
| 145 | Ga0163162_11356345 | 3300013306 | Bacteria | 809 |
| 146 | Ga0157372_10207367 | 3300013307 | Bacteria | 2271 |
| 147 | Ga0157372_10252947 | 3300013307 | Bacteria | 2045 |
| 148 | Ga0157372_10870336 | 3300013307 | Bacteria | 1046 |
| 149 | Ga0163163_10003002 | 3300014325 | Bacteria | 14278 |
| 150 | Ga0163163_10025827 | 3300014325 | Bacteria | 5603 |
| 151 | Ga0163163_10389073 | 3300014325 | Bacteria | 1452 |
| 152 | Ga0163163_12156221 | 3300014325 | Unclassified | 617 |
| 153 | Ga0157377_10046392 | 3300014745 | Unclassified | 2430 |
| 154 | Ga0157379_10082232 | 3300014968 | Unclassified | 2886 |
| 155 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 156 | Ga0157376_10836128 | 3300014969 | Bacteria | 935 |
| 157 | Ga0207647_10423106 | 3300025904 | Unclassified | 749 |
| 158 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 159 | Ga0207705_10000056 | 3300025909 | Bacteria | 157554 |
| 160 | Ga0207705_10000327 | 3300025909 | Bacteria | 43259 |
| 161 | Ga0207705_10018486 | 3300025909 | Bacteria | 4983 |
| 162 | Ga0207705_10091946 | 3300025909 | Bacteria | 2223 |
| 163 | Ga0207705_11252968 | 3300025909 | Unclassified | 568 |
| 164 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 165 | Ga0207707_10240495 | 3300025912 | Bacteria | 1574 |
| 166 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 167 | Ga0207695_10251507 | 3300025913 | Bacteria | 1666 |
| 168 | Ga0207671_10004219 | 3300025914 | Bacteria | 13846 |
| 169 | Ga0207671_10348786 | 3300025914 | Bacteria | 1173 |
| 170 | Ga0207660_11231845 | 3300025917 | Bacteria | 608 |
| 171 | Ga0207657_10000741 | 3300025919 | Bacteria | 34635 |
| 172 | Ga0207657_10001246 | 3300025919 | Bacteria | 27202 |
| 173 | Ga0207657_10004983 | 3300025919 | Bacteria | 13968 |
| 174 | Ga0207652_10039985 | 3300025921 | Bacteria | 3982 |
| 175 | Ga0207652_10070130 | 3300025921 | Bacteria | 3043 |
| 176 | Ga0207652_10507739 | 3300025921 | Bacteria | 1085 |
| 177 | Ga0207694_10122299 | 3300025924 | Bacteria | 2079 |
| 178 | Ga0207694_10726693 | 3300025924 | Unclassified | 838 |
| 179 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 180 | Ga0207687_10000111 | 3300025927 | Bacteria | 58083 |
| 181 | Ga0207687_10022274 | 3300025927 | Bacteria | 4214 |
| 182 | Ga0207687_10333391 | 3300025927 | Unclassified | 1231 |
| 183 | Ga0207687_10528349 | 3300025927 | Bacteria | 988 |
| 184 | Ga0207644_10238843 | 3300025931 | Unclassified | 1446 |
| 185 | Ga0207644_10274001 | 3300025931 | Bacteria | 1353 |
| 186 | Ga0207690_10002993 | 3300025932 | Bacteria | 10175 |
| 187 | Ga0207690_10329126 | 3300025932 | Bacteria | 1203 |
| 188 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 189 | Ga0207686_10062976 | 3300025934 | Bacteria | 2357 |
| 190 | Ga0207686_10082135 | 3300025934 | Bacteria | 2106 |
| 191 | Ga0207686_10145732 | 3300025934 | Bacteria | 1642 |
| 192 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 193 | Ga0207709_10109382 | 3300025935 | Bacteria | 1845 |
| 194 | Ga0207669_10023824 | 3300025937 | Bacteria | 3277 |
| 195 | Ga0207669_10516501 | 3300025937 | Bacteria | 958 |
| 196 | Ga0207691_10127119 | 3300025940 | Bacteria | 2254 |
| 197 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 198 | Ga0207667_10000466 | 3300025949 | Bacteria | 54272 |
| 199 | Ga0207667_10031525 | 3300025949 | Bacteria | 5722 |
| 200 | Ga0207651_10004394 | 3300025960 | Bacteria | 7096 |
| 201 | Ga0207651_10722738 | 3300025960 | Bacteria | 879 |
| 202 | Ga0207712_10002011 | 3300025961 | Bacteria | 13346 |
| 203 | Ga0207668_10076528 | 3300025972 | Bacteria | 2410 |
| 204 | Ga0207658_10106854 | 3300025986 | Unclassified | 2204 |
| 205 | Ga0207703_10345568 | 3300026035 | Bacteria | 1368 |
| 206 | Ga0207708_10065807 | 3300026075 | Bacteria | 2771 |
| 207 | Ga0207702_10037462 | 3300026078 | Bacteria | 4060 |
| 208 | Ga0207641_10033583 | 3300026088 | Bacteria | 4262 |
| 209 | Ga0207641_10064846 | 3300026088 | Bacteria | 3123 |
| 210 | Ga0207676_10811590 | 3300026095 | Bacteria | 913 |
| 211 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 212 | Ga0207683_10063904 | 3300026121 | Unclassified | 3243 |
| 213 | Ga0207683_10095325 | 3300026121 | Bacteria | 2653 |
| 214 | Ga0209813_10000004 | 3300027866 | Bacteria | 139340 |
| 215 | Ga0268266_10001150 | 3300028379 | Bacteria | 32834 |
| 216 | Ga0268265_10182737 | 3300028380 | Bacteria | 1803 |
| 217 | Ga0268264_10067517 | 3300028381 | Bacteria | 3019 |
| 218 | Ga0265337_1030254 | 3300028556 | Bacteria | 1614 |
| 219 | Ga0265319_1131456 | 3300028563 | Unclassified | 778 |
| 220 | Ga0265334_10000032 | 3300028573 | Bacteria | 107258 |
| 221 | Ga0307517_10172389 | 3300028786 | Unclassified | 1419 |
| 222 | Ga0265338_10000052 | 3300028800 | Bacteria | 209239 |
| 223 | Ga0265338_10000192 | 3300028800 | Bacteria | 115195 |
| 224 | Ga0265338_10000601 | 3300028800 | Bacteria | 63282 |
| 225 | Ga0265338_10003756 | 3300028800 | Bacteria | 21096 |
| 226 | Ga0265338_10022464 | 3300028800 | Bacteria | 6531 |
| 227 | Ga0265338_10035636 | 3300028800 | Bacteria | 4776 |
| 228 | Ga0314311_1042448 | 3300030733 | Bacteria | 1263 |
| 229 | Ga0316183_1008217 | 3300030742 | Bacteria | 7119 |
| 230 | Ga0316183_1062714 | 3300030742 | Bacteria | 7229 |
| 231 | Ga0316183_1207294 | 3300030742 | Bacteria | 1226 |
| 232 | Ga0316181_1138937 | 3300030744 | Bacteria | 58229 |
| 233 | Ga0316182_1028256 | 3300030745 | Bacteria | 15303 |
| 234 | Ga0316182_1069541 | 3300030745 | Bacteria | 851 |
| 235 | Ga0316182_1101633 | 3300030745 | Bacteria | 3020 |
| 236 | Ga0265340_10000077 | 3300031247 | Bacteria | 47065 |
| 237 | Ga0265327_10000961 | 3300031251 | Bacteria | 41308 |
| 238 | Ga0265327_10004080 | 3300031251 | Bacteria | 13211 |
| 239 | Ga0265327_10099549 | 3300031251 | Unclassified | 1405 |
| 240 | Ga0307516_10004034 | 3300031730 | Bacteria | 18404 |
| 241 | Ga0373952_0126986 | 3300035092 | Unclassified | 697 |
| 242 | Ga0373925_1162078 | 3300037068 | Bacteria | 634 |
| 243 | Ga0395900_0039080 | 3300037418 | Bacteria | 4891 |
| 244 | Ga0395900_0047975 | 3300037418 | Bacteria | 4399 |
| 245 | Ga0395898_0959029 | 3300037466 | Unclassified | 792 |
| 246 | Ga0395905_0002005 | 3300037471 | Bacteria | 23268 |
| 247 | Ga0395905_0756612 | 3300037471 | Unclassified | 874 |
| 248 | Ga0395905_1330674 | 3300037471 | Bacteria | 622 |
| 249 | Ga0395901_0001919 | 3300038443 | Bacteria | 21405 |
| 250 | Ga0451802_0097460 | 3300041460 | Unclassified | 647 |
| 251 | Ga0451839_1370826 | 3300041496 | Bacteria | 517 |
| 252 | Ga0439432_006774 | 3300042006 | Bacteria | 4077 |
| 253 | Ga0450918_000271 | 3300042531 | Bacteria | 11744 |
| 254 | Ga0466963_0673482 | 3300044694 | Bacteria | 730 |
| 255 | Ga0466967_2555524 | 3300045976 | Unclassified | 505 |
| 256 | Ga0495583_0014267 | 3300046506 | Unclassified | 4392 |
| 257 | Ga0495609_0148431 | 3300046538 | Unclassified | 998 |
| 258 | Ga0495588_0000116 | 3300046674 | Bacteria | 135919 |
| 259 | Ga0495658_0146200 | 3300046683 | Bacteria | 1449 |
| 260 | Ga0495658_0695667 | 3300046683 | Bacteria | 651 |
| 261 | Ga0495672_0135844 | 3300047320 | Unclassified | 1289 |
| 262 | Ga0495681_0260397 | 3300047470 | Unclassified | 682 |
| 263 | Ga0496100_0040985 | 3300048903 | Unclassified | 2949 |
| 264 | Ga0496100_0883373 | 3300048903 | Bacteria | 702 |
| 265 | Ga0496109_0211074 | 3300048912 | Bacteria | 1826 |
| 266 | Ga0496112_0044274 | 3300048915 | Bacteria | 4361 |
| 267 | Ga0496113_0575238 | 3300048916 | Bacteria | 903 |
| 268 | Ga0496126_0026023 | 3300048929 | Bacteria | 5618 |
| 269 | Ga0495678_149044 | 3300049459 | Unclassified | 757 |
| 270 | Ga0501034_0978432 | 3300049571 | Bacteria | 731 |
| 271 | Ga0501037_0305155 | 3300049573 | Unclassified | 1105 |
| 272 | Ga0501070_0190171 | 3300049586 | Bacteria | 1687 |
| 273 | Ga0501070_0434341 | 3300049586 | Bacteria | 1060 |
| 274 | Ga0501070_0728916 | 3300049586 | Unclassified | 782 |
| 275 | Ga0501073_0317376 | 3300049589 | Unclassified | 1075 |
| 276 | Ga0501080_0000133 | 3300049742 | Bacteria | 52488 |
| 277 | Ga0501276_000057 | 3300049773 | Bacteria | 6139 |
| 278 | nmdc:mga03683_20_c3 | 3300050489 | Bacteria | 29488 |
| 279 | nmdc:mga03683_27206_c1 | 3300050489 | Bacteria | 2262 |
| 280 | nmdc:mga03n38_155660_c1 | 3300050490 | Bacteria | 1153 |
| 281 | nmdc:mga03n38_22_c1 | 3300050490 | Bacteria | 38225 |
| 282 | nmdc:mga00v17_120896_c1 | 3300050491 | Bacteria | 1667 |
| 283 | nmdc:mga00v17_196631_c1 | 3300050491 | Unclassified | 1303 |
| 284 | nmdc:mga00v17_37921_c1 | 3300050491 | Unclassified | 2879 |
| 285 | nmdc:mga0yw44_2_c1 | 3300050492 | Bacteria | 586884 |
| 286 | nmdc:mga0yw44_379685_c1 | 3300050492 | Bacteria | 954 |
| 287 | nmdc:mga0yw44_397_c1 | 3300050492 | Bacteria | 10503 |
| 288 | nmdc:mga0yw44_682229_c1 | 3300050492 | Bacteria | 698 |
| 289 | nmdc:mga0yw44_90758_c1 | 3300050492 | Unclassified | 1930 |
| 290 | nmdc:mga0k408_114_c1 | 3300050493 | Bacteria | 39328 |
| 291 | nmdc:mga0k408_17_c2 | 3300050493 | Bacteria | 97852 |
| 292 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 293 | nmdc:mga0k408_4029_c2 | 3300050493 | Bacteria | 5496 |
| 294 | nmdc:mga0k408_442135_c1 | 3300050493 | Unclassified | 772 |
| 295 | nmdc:mga0k408_7513_c1 | 3300050493 | Bacteria | 5820 |
| 296 | nmdc:mga06z11_534843_c1 | 3300050494 | Bacteria | 711 |
| 297 | nmdc:mga06z11_6_c1 | 3300050494 | Bacteria | 124054 |
| 298 | nmdc:mga04h51_4_c1 | 3300050495 | Bacteria | 139342 |
| 299 | nmdc:mga07m45_110368_c1 | 3300050496 | Bacteria | 1584 |
| 300 | nmdc:mga07m45_35926_c1 | 3300050496 | Bacteria | 2757 |
| 301 | nmdc:mga07m45_43368_c1 | 3300050496 | Unclassified | 2522 |
| 302 | nmdc:mga07m45_7503_c2 | 3300050496 | Bacteria | 3944 |
| 303 | nmdc:mga0qj67_20494_c1 | 3300050509 | Bacteria | 5063 |
| 304 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 305 | nmdc:mga0sz30_23_c1 | 3300050516 | Bacteria | 65683 |
| 306 | nmdc:mga0sz30_24448_c1 | 3300050516 | Bacteria | 2465 |
| 307 | nmdc:mga0sz30_48908_c1 | 3300050516 | Bacteria | 1790 |
| 308 | Ga0500610_0162858 | 3300053079 | Bacteria | 1108 |
| 309 | Ga0500643_000022 | 3300053087 | Bacteria | 277519 |
| 310 | Ga0500643_000043 | 3300053087 | Bacteria | 157905 |
| 311 | Ga0500643_029967 | 3300053087 | Unclassified | 1670 |
| 312 | Ga0500644_0000935 | 3300053088 | Bacteria | 9247 |
| 313 | Ga0500644_0003942 | 3300053088 | Bacteria | 3696 |
| 314 | Ga0500644_0072154 | 3300053088 | Bacteria | 1247 |
| 315 | Ga0500646_0000290 | 3300053090 | Bacteria | 15407 |
| 316 | Ga0500583_0000137 | 3300053092 | Bacteria | 31497 |
| 317 | Ga0500583_0017248 | 3300053092 | Bacteria | 2904 |
| 318 | Ga0500651_0000045 | 3300053093 | Bacteria | 85481 |
| 319 | Ga0500651_0001186 | 3300053093 | Bacteria | 12921 |
| 320 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 321 | Ga0500556_0001227 | 3300053104 | Bacteria | 11950 |
| 322 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 323 | Ga0500562_002309 | 3300053108 | Bacteria | 4779 |
| 324 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 325 | Ga0500594_0002594 | 3300053118 | Unclassified | 3926 |
| 326 | Ga0500594_0213438 | 3300053118 | Unclassified | 636 |
| 327 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 328 | Ga0500614_011759 | 3300053123 | Bacteria | 1901 |
| 329 | Ga0500628_000012 | 3300053129 | Bacteria | 106556 |
| 330 | Ga0500628_017303 | 3300053129 | Unclassified | 1406 |
| 331 | Ga0500642_0139257 | 3300053130 | Bacteria | 1138 |
| 332 | Ga0500655_000436 | 3300053133 | Bacteria | 8576 |
| 333 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 334 | Ga0500577_0000427 | 3300053142 | Bacteria | 10827 |
| 335 | Ga0500577_0004394 | 3300053142 | Bacteria | 3722 |
| 336 | Ga0500579_005181 | 3300053143 | Bacteria | 7989 |
| 337 | Ga0500589_000016 | 3300053147 | Bacteria | 107090 |
| 338 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 339 | Ga0500616_0118538 | 3300053153 | Unclassified | 1268 |
| 340 | Ga0500622_0078098 | 3300053156 | Unclassified | 1662 |
| 341 | Ga0500649_000013 | 3300053722 | Bacteria | 73694 |
| 342 | Ga0500570_000005 | 3300053724 | Bacteria | 132994 |
| 343 | Ga0500611_000355 | 3300053727 | Unclassified | 4701 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0756612 | Ga0395905_0756612_489_857 | 120 |
| 2 | 3300025935 | Ga0207709_10109382 | Ga0207709_101093822 | 133 |
| 3 | 3300030742 | Ga0316183_1008217 | Ga0316183_10082171 | 133 |
| 4 | 3300003322 | rootL2_10032831 | rootL2_100328313 | 134 |
| 5 | 3300003323 | rootH1_10333123 | rootH1_103331232 | 134 |
| 6 | 3300003911 | JGI25405J52794_10000208 | JGI25405J52794_100002085 | 134 |
| 7 | 3300005937 | Ga0081455_10000001 | Ga0081455_10000001257 | 134 |
| 8 | 3300050492 | nmdc:mga0yw44_682229_c1 | nmdc:mga0yw44_682229_c1_19_423 | 134 |
| 9 | 3300003320 | rootH2_10006847 | rootH2_1000684797 | 135 |
| 10 | 3300006042 | Ga0075368_10002443 | Ga0075368_100024438 | 135 |
| 11 | 3300006048 | Ga0075363_100000016 | Ga0075363_10000001626 | 135 |
| 12 | 3300006178 | Ga0075367_10000637 | Ga0075367_1000063711 | 135 |
| 13 | 3300006353 | Ga0075370_10265450 | Ga0075370_102654501 | 135 |
| 14 | 3300027866 | Ga0209813_10000004 | Ga0209813_1000000489 | 135 |
| 15 | 3300030742 | Ga0316183_1207294 | Ga0316183_12072942 | 135 |
| 16 | 3300030745 | Ga0316182_1101633 | Ga0316182_11016333 | 135 |
| 17 | 3300035092 | Ga0373952_0126986 | Ga0373952_0126986_72_518 | 135 |
| 18 | 3300046538 | Ga0495609_0148431 | Ga0495609_0148431_12_419 | 135 |
| 19 | 3300050490 | nmdc:mga03n38_22_c1 | nmdc:mga03n38_22_c1_23836_24282 | 135 |
| 20 | 3300050494 | nmdc:mga06z11_6_c1 | nmdc:mga06z11_6_c1_28098_28544 | 135 |
| 21 | 3300050495 | nmdc:mga04h51_4_c1 | nmdc:mga04h51_4_c1_57340_57786 | 135 |
| 22 | 3300050496 | nmdc:mga07m45_43368_c1 | nmdc:mga07m45_43368_c1_391_837 | 135 |
| 23 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002970 | 144 |
| 24 | 3300025914 | Ga0207671_10348786 | Ga0207671_103487861 | 144 |
| 25 | 3300025949 | Ga0207667_10000008 | Ga0207667_1000000862 | 144 |
| 26 | 3300009148 | Ga0105243_10008792 | Ga0105243_100087927 | 146 |
| 27 | 3300013102 | Ga0157371_10000937 | Ga0157371_100009379 | 146 |
| 28 | 3300005367 | Ga0070667_100131750 | Ga0070667_1001317504 | 147 |
| 29 | 3300005544 | Ga0070686_100250173 | Ga0070686_1002501732 | 147 |
| 30 | 3300005617 | Ga0068859_101786424 | Ga0068859_1017864242 | 147 |
| 31 | 3300005618 | Ga0068864_100894786 | Ga0068864_1008947861 | 147 |
| 32 | 3300005842 | Ga0068858_100149488 | Ga0068858_1001494882 | 147 |
| 33 | 3300005842 | Ga0068858_100731878 | Ga0068858_1007318782 | 147 |
| 34 | 3300005843 | Ga0068860_100114349 | Ga0068860_1001143494 | 147 |
| 35 | 3300005844 | Ga0068862_100036003 | Ga0068862_1000360033 | 147 |
| 36 | 3300005937 | Ga0081455_10000003 | Ga0081455_10000003361 | 147 |
| 37 | 3300006038 | Ga0075365_10000020 | Ga0075365_1000002014 | 147 |
| 38 | 3300006186 | Ga0075369_10000005 | Ga0075369_1000000537 | 147 |
| 39 | 3300006186 | Ga0075369_10000051 | Ga0075369_1000005118 | 147 |
| 40 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001465 | 147 |
| 41 | 3300006237 | Ga0097621_100001002 | Ga0097621_1000010021 | 147 |
| 42 | 3300006358 | Ga0068871_100000156 | Ga0068871_1000001562 | 147 |
| 43 | 3300006358 | Ga0068871_100590484 | Ga0068871_1005904842 | 147 |
| 44 | 3300006844 | Ga0075428_100034021 | Ga0075428_1000340213 | 147 |
| 45 | 3300006846 | Ga0075430_100025155 | Ga0075430_1000251554 | 147 |
| 46 | 3300006931 | Ga0097620_101786342 | Ga0097620_1017863422 | 147 |
| 47 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003770 | 147 |
| 48 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002178 | 147 |
| 49 | 3300009098 | Ga0105245_10000122 | Ga0105245_1000012269 | 147 |
| 50 | 3300009098 | Ga0105245_10003504 | Ga0105245_1000350418 | 147 |
| 51 | 3300009098 | Ga0105245_10034602 | Ga0105245_100346021 | 147 |
| 52 | 3300009098 | Ga0105245_10095193 | Ga0105245_100951932 | 147 |
| 53 | 3300009101 | Ga0105247_10072194 | Ga0105247_100721942 | 147 |
| 54 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001522 | 147 |
| 55 | 3300009176 | Ga0105242_10000064 | Ga0105242_1000006462 | 147 |
| 56 | 3300009176 | Ga0105242_10111899 | Ga0105242_101118992 | 147 |
| 57 | 3300009545 | Ga0105237_10009676 | Ga0105237_100096763 | 147 |
| 58 | 3300010375 | Ga0105239_10115049 | Ga0105239_101150492 | 147 |
| 59 | 3300013105 | Ga0157369_10545917 | Ga0157369_105459171 | 147 |
| 60 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031195 | 147 |
| 61 | 3300013296 | Ga0157374_10000934 | Ga0157374_1000093410 | 147 |
| 62 | 3300013306 | Ga0163162_11356345 | Ga0163162_113563452 | 147 |
| 63 | 3300014325 | Ga0163163_10003002 | Ga0163163_100030029 | 147 |
| 64 | 3300014325 | Ga0163163_10025827 | Ga0163163_100258274 | 147 |
| 65 | 3300014745 | Ga0157377_10046392 | Ga0157377_100463921 | 147 |
| 66 | 3300014969 | Ga0157376_10000001 | Ga0157376_10000001176 | 147 |
| 67 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005779 | 147 |
| 68 | 3300025914 | Ga0207671_10004219 | Ga0207671_1000421911 | 147 |
| 69 | 3300025927 | Ga0207687_10000001 | Ga0207687_100000011033 | 147 |
| 70 | 3300025927 | Ga0207687_10000111 | Ga0207687_1000011122 | 147 |
| 71 | 3300025927 | Ga0207687_10022274 | Ga0207687_100222742 | 147 |
| 72 | 3300025927 | Ga0207687_10333391 | Ga0207687_103333913 | 147 |
| 73 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001620 | 147 |
| 74 | 3300025934 | Ga0207686_10062976 | Ga0207686_100629762 | 147 |
| 75 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002738 | 147 |
| 76 | 3300025960 | Ga0207651_10722738 | Ga0207651_107227381 | 147 |
| 77 | 3300025972 | Ga0207668_10076528 | Ga0207668_100765284 | 147 |
| 78 | 3300026035 | Ga0207703_10345568 | Ga0207703_103455682 | 147 |
| 79 | 3300026095 | Ga0207676_10811590 | Ga0207676_108115901 | 147 |
| 80 | 3300028380 | Ga0268265_10182737 | Ga0268265_101827373 | 147 |
| 81 | 3300028381 | Ga0268264_10067517 | Ga0268264_100675174 | 147 |
| 82 | 3300028786 | Ga0307517_10172389 | Ga0307517_101723893 | 147 |
| 83 | 3300031730 | Ga0307516_10004034 | Ga0307516_1000403411 | 147 |
| 84 | 3300042006 | Ga0439432_006774 | Ga0439432_006774_1173_1622 | 147 |
| 85 | 3300046683 | Ga0495658_0695667 | Ga0495658_0695667_150_593 | 147 |
| 86 | 3300048929 | Ga0496126_0026023 | Ga0496126_0026023_1308_1751 | 147 |
| 87 | 3300049459 | Ga0495678_149044 | Ga0495678_149044_137_580 | 147 |
| 88 | 3300050490 | nmdc:mga03n38_155660_c1 | nmdc:mga03n38_155660_c1_694_1137 | 147 |
| 89 | 3300050492 | nmdc:mga0yw44_2_c1 | nmdc:mga0yw44_2_c1_206900_207343 | 147 |
| 90 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_647838_648281 | 147 |
| 91 | 3300050496 | nmdc:mga07m45_110368_c1 | nmdc:mga07m45_110368_c1_909_1352 | 147 |
| 92 | 3300050496 | nmdc:mga07m45_35926_c1 | nmdc:mga07m45_35926_c1_1427_1870 | 147 |
| 93 | 3300050509 | nmdc:mga0qj67_20494_c1 | nmdc:mga0qj67_20494_c1_2299_2742 | 147 |
| 94 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_183014_183457 | 147 |
| 95 | 3300050516 | nmdc:mga0sz30_23_c1 | nmdc:mga0sz30_23_c1_45049_45492 | 147 |
| 96 | 3300053079 | Ga0500610_0162858 | Ga0500610_0162858_540_983 | 147 |
| 97 | 3300053087 | Ga0500643_000022 | Ga0500643_000022_17156_17599 | 147 |
| 98 | 3300053087 | Ga0500643_029967 | Ga0500643_029967_671_1114 | 147 |
| 99 | 3300053088 | Ga0500644_0072154 | Ga0500644_0072154_391_834 | 147 |
| 100 | 3300053092 | Ga0500583_0000137 | Ga0500583_0000137_7577_8020 | 147 |
| 101 | 3300053093 | Ga0500651_0000045 | Ga0500651_0000045_44440_44883 | 147 |
| 102 | 3300053093 | Ga0500651_0001186 | Ga0500651_0001186_4930_5373 | 147 |
| 103 | 3300053118 | Ga0500594_0213438 | Ga0500594_0213438_170_613 | 147 |
| 104 | 3300053123 | Ga0500614_011759 | Ga0500614_011759_1105_1548 | 147 |
| 105 | 3300053130 | Ga0500642_0139257 | Ga0500642_0139257_429_872 | 147 |
| 106 | 3300053147 | Ga0500589_000016 | Ga0500589_000016_25614_26057 | 147 |
| 107 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_321213_321656 | 147 |
| 108 | 3300053153 | Ga0500616_0118538 | Ga0500616_0118538_434_877 | 147 |
| 109 | 3300001915 | JGI24741J21665_1000038 | JGI24741J21665_100003830 | 148 |
| 110 | 3300001915 | JGI24741J21665_1004123 | JGI24741J21665_10041232 | 148 |
| 111 | 3300001979 | JGI24740J21852_10025542 | JGI24740J21852_100255423 | 148 |
| 112 | 3300001990 | JGI24737J22298_10000095 | JGI24737J22298_100000957 | 148 |
| 113 | 3300002067 | JGI24735J21928_10000419 | JGI24735J21928_1000041914 | 148 |
| 114 | 3300003320 | rootH2_10265633 | rootH2_102656332 | 148 |
| 115 | 3300003322 | rootL2_10345651 | rootL2_103456513 | 148 |
| 116 | 3300005289 | Ga0065704_10310638 | Ga0065704_103106381 | 148 |
| 117 | 3300005327 | Ga0070658_10000020 | Ga0070658_10000020196 | 148 |
| 118 | 3300005327 | Ga0070658_10000698 | Ga0070658_100006989 | 148 |
| 119 | 3300005327 | Ga0070658_10004259 | Ga0070658_1000425911 | 148 |
| 120 | 3300005327 | Ga0070658_10007725 | Ga0070658_1000772510 | 148 |
| 121 | 3300005327 | Ga0070658_10027230 | Ga0070658_100272306 | 148 |
| 122 | 3300005327 | Ga0070658_10034880 | Ga0070658_100348803 | 148 |
| 123 | 3300005327 | Ga0070658_10051728 | Ga0070658_100517282 | 148 |
| 124 | 3300005333 | Ga0070677_10022032 | Ga0070677_100220323 | 148 |
| 125 | 3300005336 | Ga0070680_100871562 | Ga0070680_1008715621 | 148 |
| 126 | 3300005339 | Ga0070660_100000224 | Ga0070660_10000022434 | 148 |
| 127 | 3300005339 | Ga0070660_100000454 | Ga0070660_10000045417 | 148 |
| 128 | 3300005339 | Ga0070660_100189675 | Ga0070660_1001896752 | 148 |
| 129 | 3300005341 | Ga0070691_10001232 | Ga0070691_1000123210 | 148 |
| 130 | 3300005345 | Ga0070692_10271938 | Ga0070692_102719382 | 148 |
| 131 | 3300005355 | Ga0070671_100114573 | Ga0070671_1001145731 | 148 |
| 132 | 3300005356 | Ga0070674_100013892 | Ga0070674_1000138921 | 148 |
| 133 | 3300005356 | Ga0070674_100595563 | Ga0070674_1005955632 | 148 |
| 134 | 3300005364 | Ga0070673_100000478 | Ga0070673_10000047822 | 148 |
| 135 | 3300005365 | Ga0070688_100574294 | Ga0070688_1005742941 | 148 |
| 136 | 3300005366 | Ga0070659_100001084 | Ga0070659_1000010849 | 148 |
| 137 | 3300005366 | Ga0070659_100121733 | Ga0070659_1001217332 | 148 |
| 138 | 3300005367 | Ga0070667_100002835 | Ga0070667_10000283514 | 148 |
| 139 | 3300005441 | Ga0070700_100035333 | Ga0070700_1000353333 | 148 |
| 140 | 3300005456 | Ga0070678_100017282 | Ga0070678_1000172823 | 148 |
| 141 | 3300005458 | Ga0070681_10311194 | Ga0070681_103111943 | 148 |
| 142 | 3300005466 | Ga0070685_10001150 | Ga0070685_1000115015 | 148 |
| 143 | 3300005466 | Ga0070685_10002053 | Ga0070685_100020538 | 148 |
| 144 | 3300005530 | Ga0070679_100018926 | Ga0070679_1000189268 | 148 |
| 145 | 3300005530 | Ga0070679_100389126 | Ga0070679_1003891261 | 148 |
| 146 | 3300005530 | Ga0070679_101186887 | Ga0070679_1011868872 | 148 |
| 147 | 3300005535 | Ga0070684_100595851 | Ga0070684_1005958512 | 148 |
| 148 | 3300005543 | Ga0070672_100024525 | Ga0070672_1000245252 | 148 |
| 149 | 3300005548 | Ga0070665_100019100 | Ga0070665_1000191004 | 148 |
| 150 | 3300005548 | Ga0070665_100327066 | Ga0070665_1003270662 | 148 |
| 151 | 3300005563 | Ga0068855_100000211 | Ga0068855_10000021134 | 148 |
| 152 | 3300005563 | Ga0068855_100091960 | Ga0068855_1000919604 | 148 |
| 153 | 3300005577 | Ga0068857_100000002 | Ga0068857_10000000262 | 148 |
| 154 | 3300005614 | Ga0068856_100032328 | Ga0068856_1000323282 | 148 |
| 155 | 3300005718 | Ga0068866_10685237 | Ga0068866_106852372 | 148 |
| 156 | 3300005719 | Ga0068861_100930683 | Ga0068861_1009306831 | 148 |
| 157 | 3300005841 | Ga0068863_100083636 | Ga0068863_1000836365 | 148 |
| 158 | 3300005841 | Ga0068863_100220357 | Ga0068863_1002203572 | 148 |
| 159 | 3300005841 | Ga0068863_102347961 | Ga0068863_1023479612 | 148 |
| 160 | 3300006038 | Ga0075365_10002844 | Ga0075365_100028449 | 148 |
| 161 | 3300006038 | Ga0075365_10079015 | Ga0075365_100790152 | 148 |
| 162 | 3300006042 | Ga0075368_10049769 | Ga0075368_100497692 | 148 |
| 163 | 3300006051 | Ga0075364_10045228 | Ga0075364_100452282 | 148 |
| 164 | 3300006051 | Ga0075364_10080408 | Ga0075364_100804083 | 148 |
| 165 | 3300006051 | Ga0075364_10168680 | Ga0075364_101686802 | 148 |
| 166 | 3300006177 | Ga0075362_10000073 | Ga0075362_1000007315 | 148 |
| 167 | 3300006177 | Ga0075362_10501769 | Ga0075362_105017692 | 148 |
| 168 | 3300006186 | Ga0075369_10173372 | Ga0075369_101733721 | 148 |
| 169 | 3300006195 | Ga0075366_10000044 | Ga0075366_1000004438 | 148 |
| 170 | 3300006195 | Ga0075366_10000342 | Ga0075366_1000034213 | 148 |
| 171 | 3300006195 | Ga0075366_10009291 | Ga0075366_100092913 | 148 |
| 172 | 3300006195 | Ga0075366_10010754 | Ga0075366_100107542 | 148 |
| 173 | 3300006237 | Ga0097621_100547018 | Ga0097621_1005470182 | 148 |
| 174 | 3300006237 | Ga0097621_100735389 | Ga0097621_1007353892 | 148 |
| 175 | 3300006353 | Ga0075370_10017117 | Ga0075370_100171176 | 148 |
| 176 | 3300006353 | Ga0075370_10167409 | Ga0075370_101674092 | 148 |
| 177 | 3300009093 | Ga0105240_10042730 | Ga0105240_100427302 | 148 |
| 178 | 3300009098 | Ga0105245_10850433 | Ga0105245_108504332 | 148 |
| 179 | 3300009098 | Ga0105245_11746075 | Ga0105245_117460752 | 148 |
| 180 | 3300009101 | Ga0105247_10043015 | Ga0105247_100430153 | 148 |
| 181 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003239 | 148 |
| 182 | 3300009174 | Ga0105241_10632418 | Ga0105241_106324182 | 148 |
| 183 | 3300009174 | Ga0105241_10807353 | Ga0105241_108073532 | 148 |
| 184 | 3300009176 | Ga0105242_10001814 | Ga0105242_100018144 | 148 |
| 185 | 3300009176 | Ga0105242_10455813 | Ga0105242_104558132 | 148 |
| 186 | 3300009177 | Ga0105248_10322747 | Ga0105248_103227472 | 148 |
| 187 | 3300009545 | Ga0105237_10178780 | Ga0105237_101787801 | 148 |
| 188 | 3300009551 | Ga0105238_10141789 | Ga0105238_101417893 | 148 |
| 189 | 3300009551 | Ga0105238_10288211 | Ga0105238_102882113 | 148 |
| 190 | 3300009551 | Ga0105238_10673636 | Ga0105238_106736362 | 148 |
| 191 | 3300009979 | Ga0105032_100054 | Ga0105032_10005411 | 148 |
| 192 | 3300009984 | Ga0105029_100020 | Ga0105029_1000208 | 148 |
| 193 | 3300009986 | Ga0105033_100510 | Ga0105033_1005102 | 148 |
| 194 | 3300009986 | Ga0105033_101944 | Ga0105033_1019442 | 148 |
| 195 | 3300009986 | Ga0105033_103919 | Ga0105033_1039191 | 148 |
| 196 | 3300009987 | Ga0105030_102457 | Ga0105030_1024573 | 148 |
| 197 | 3300010375 | Ga0105239_10068970 | Ga0105239_100689705 | 148 |
| 198 | 3300010375 | Ga0105239_10352446 | Ga0105239_103524462 | 148 |
| 199 | 3300010375 | Ga0105239_11541919 | Ga0105239_115419192 | 148 |
| 200 | 3300011119 | Ga0105246_11344652 | Ga0105246_113446522 | 148 |
| 201 | 3300013105 | Ga0157369_10000261 | Ga0157369_1000026162 | 148 |
| 202 | 3300013105 | Ga0157369_10370420 | Ga0157369_103704202 | 148 |
| 203 | 3300013296 | Ga0157374_10001692 | Ga0157374_100016928 | 148 |
| 204 | 3300013296 | Ga0157374_10021134 | Ga0157374_100211343 | 148 |
| 205 | 3300013297 | Ga0157378_10052886 | Ga0157378_100528864 | 148 |
| 206 | 3300013297 | Ga0157378_10126237 | Ga0157378_101262371 | 148 |
| 207 | 3300013297 | Ga0157378_10146442 | Ga0157378_101464423 | 148 |
| 208 | 3300013307 | Ga0157372_10207367 | Ga0157372_102073672 | 148 |
| 209 | 3300013307 | Ga0157372_10252947 | Ga0157372_102529472 | 148 |
| 210 | 3300013307 | Ga0157372_10870336 | Ga0157372_108703362 | 148 |
| 211 | 3300014325 | Ga0163163_10389073 | Ga0163163_103890731 | 148 |
| 212 | 3300014325 | Ga0163163_12156221 | Ga0163163_121562211 | 148 |
| 213 | 3300014968 | Ga0157379_10082232 | Ga0157379_100822325 | 148 |
| 214 | 3300014969 | Ga0157376_10836128 | Ga0157376_108361282 | 148 |
| 215 | 3300025904 | Ga0207647_10423106 | Ga0207647_104231062 | 148 |
| 216 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011247 | 148 |
| 217 | 3300025909 | Ga0207705_10000056 | Ga0207705_1000005697 | 148 |
| 218 | 3300025909 | Ga0207705_10000327 | Ga0207705_1000032747 | 148 |
| 219 | 3300025909 | Ga0207705_10018486 | Ga0207705_100184867 | 148 |
| 220 | 3300025909 | Ga0207705_10091946 | Ga0207705_100919462 | 148 |
| 221 | 3300025909 | Ga0207705_11252968 | Ga0207705_112529681 | 148 |
| 222 | 3300025912 | Ga0207707_10240495 | Ga0207707_102404953 | 148 |
| 223 | 3300025913 | Ga0207695_10251507 | Ga0207695_102515072 | 148 |
| 224 | 3300025917 | Ga0207660_11231845 | Ga0207660_112318451 | 148 |
| 225 | 3300025919 | Ga0207657_10000741 | Ga0207657_1000074134 | 148 |
| 226 | 3300025919 | Ga0207657_10001246 | Ga0207657_1000124618 | 148 |
| 227 | 3300025919 | Ga0207657_10004983 | Ga0207657_1000498310 | 148 |
| 228 | 3300025921 | Ga0207652_10039985 | Ga0207652_100399852 | 148 |
| 229 | 3300025921 | Ga0207652_10070130 | Ga0207652_100701302 | 148 |
| 230 | 3300025921 | Ga0207652_10507739 | Ga0207652_105077392 | 148 |
| 231 | 3300025924 | Ga0207694_10122299 | Ga0207694_101222992 | 148 |
| 232 | 3300025924 | Ga0207694_10726693 | Ga0207694_107266932 | 148 |
| 233 | 3300025927 | Ga0207687_10528349 | Ga0207687_105283492 | 148 |
| 234 | 3300025931 | Ga0207644_10238843 | Ga0207644_102388431 | 148 |
| 235 | 3300025931 | Ga0207644_10274001 | Ga0207644_102740012 | 148 |
| 236 | 3300025932 | Ga0207690_10002993 | Ga0207690_1000299310 | 148 |
| 237 | 3300025932 | Ga0207690_10329126 | Ga0207690_103291262 | 148 |
| 238 | 3300025934 | Ga0207686_10082135 | Ga0207686_100821353 | 148 |
| 239 | 3300025934 | Ga0207686_10145732 | Ga0207686_101457323 | 148 |
| 240 | 3300025937 | Ga0207669_10023824 | Ga0207669_100238245 | 148 |
| 241 | 3300025937 | Ga0207669_10516501 | Ga0207669_105165011 | 148 |
| 242 | 3300025940 | Ga0207691_10127119 | Ga0207691_101271193 | 148 |
| 243 | 3300025949 | Ga0207667_10000466 | Ga0207667_1000046653 | 148 |
| 244 | 3300025949 | Ga0207667_10031525 | Ga0207667_100315259 | 148 |
| 245 | 3300025960 | Ga0207651_10004394 | Ga0207651_100043944 | 148 |
| 246 | 3300025961 | Ga0207712_10002011 | Ga0207712_100020111 | 148 |
| 247 | 3300025986 | Ga0207658_10106854 | Ga0207658_101068543 | 148 |
| 248 | 3300026075 | Ga0207708_10065807 | Ga0207708_100658073 | 148 |
| 249 | 3300026078 | Ga0207702_10037462 | Ga0207702_100374624 | 148 |
| 250 | 3300026088 | Ga0207641_10033583 | Ga0207641_100335833 | 148 |
| 251 | 3300026088 | Ga0207641_10064846 | Ga0207641_100648464 | 148 |
| 252 | 3300026116 | Ga0207674_10000001 | Ga0207674_10000001485 | 148 |
| 253 | 3300026121 | Ga0207683_10063904 | Ga0207683_100639043 | 148 |
| 254 | 3300026121 | Ga0207683_10095325 | Ga0207683_100953252 | 148 |
| 255 | 3300028379 | Ga0268266_10001150 | Ga0268266_1000115013 | 148 |
| 256 | 3300028556 | Ga0265337_1030254 | Ga0265337_10302542 | 148 |
| 257 | 3300028563 | Ga0265319_1131456 | Ga0265319_11314562 | 148 |
| 258 | 3300028573 | Ga0265334_10000032 | Ga0265334_1000003296 | 148 |
| 259 | 3300028800 | Ga0265338_10000052 | Ga0265338_10000052144 | 148 |
| 260 | 3300028800 | Ga0265338_10000192 | Ga0265338_1000019264 | 148 |
| 261 | 3300028800 | Ga0265338_10000601 | Ga0265338_1000060119 | 148 |
| 262 | 3300028800 | Ga0265338_10003756 | Ga0265338_100037564 | 148 |
| 263 | 3300028800 | Ga0265338_10022464 | Ga0265338_100224646 | 148 |
| 264 | 3300028800 | Ga0265338_10035636 | Ga0265338_100356366 | 148 |
| 265 | 3300030733 | Ga0314311_1042448 | Ga0314311_10424482 | 148 |
| 266 | 3300030742 | Ga0316183_1062714 | Ga0316183_10627144 | 148 |
| 267 | 3300030744 | Ga0316181_1138937 | Ga0316181_113893768 | 148 |
| 268 | 3300030745 | Ga0316182_1028256 | Ga0316182_102825611 | 148 |
| 269 | 3300030745 | Ga0316182_1069541 | Ga0316182_10695411 | 148 |
| 270 | 3300031247 | Ga0265340_10000077 | Ga0265340_1000007736 | 148 |
| 271 | 3300031251 | Ga0265327_10000961 | Ga0265327_1000096121 | 148 |
| 272 | 3300031251 | Ga0265327_10004080 | Ga0265327_1000408011 | 148 |
| 273 | 3300031251 | Ga0265327_10099549 | Ga0265327_100995492 | 148 |
| 274 | 3300037068 | Ga0373925_1162078 | Ga0373925_1162078_95_541 | 148 |
| 275 | 3300037418 | Ga0395900_0039080 | Ga0395900_0039080_1432_1884 | 148 |
| 276 | 3300037418 | Ga0395900_0047975 | Ga0395900_0047975_3602_4051 | 148 |
| 277 | 3300037466 | Ga0395898_0959029 | Ga0395898_0959029_194_640 | 148 |
| 278 | 3300037471 | Ga0395905_0002005 | Ga0395905_0002005_8085_8540 | 148 |
| 279 | 3300037471 | Ga0395905_1330674 | Ga0395905_1330674_145_591 | 148 |
| 280 | 3300038443 | Ga0395901_0001919 | Ga0395901_0001919_8224_8676 | 148 |
| 281 | 3300041460 | Ga0451802_0097460 | Ga0451802_0097460_50_499 | 148 |
| 282 | 3300041496 | Ga0451839_1370826 | Ga0451839_1370826_12_464 | 148 |
| 283 | 3300042531 | Ga0450918_000271 | Ga0450918_000271_1305_1757 | 148 |
| 284 | 3300044694 | Ga0466963_0673482 | Ga0466963_0673482_162_611 | 148 |
| 285 | 3300045976 | Ga0466967_2555524 | Ga0466967_2555524_45_491 | 148 |
| 286 | 3300046506 | Ga0495583_0014267 | Ga0495583_0014267_3162_3623 | 148 |
| 287 | 3300046674 | Ga0495588_0000116 | Ga0495588_0000116_116960_117406 | 148 |
| 288 | 3300046683 | Ga0495658_0146200 | Ga0495658_0146200_378_827 | 148 |
| 289 | 3300047320 | Ga0495672_0135844 | Ga0495672_0135844_783_1229 | 148 |
| 290 | 3300047470 | Ga0495681_0260397 | Ga0495681_0260397_87_533 | 148 |
| 291 | 3300048903 | Ga0496100_0040985 | Ga0496100_0040985_2473_2925 | 148 |
| 292 | 3300048903 | Ga0496100_0883373 | Ga0496100_0883373_138_590 | 148 |
| 293 | 3300048912 | Ga0496109_0211074 | Ga0496109_0211074_1289_1741 | 148 |
| 294 | 3300048915 | Ga0496112_0044274 | Ga0496112_0044274_2509_2961 | 148 |
| 295 | 3300048916 | Ga0496113_0575238 | Ga0496113_0575238_209_661 | 148 |
| 296 | 3300049571 | Ga0501034_0978432 | Ga0501034_0978432_201_647 | 148 |
| 297 | 3300049573 | Ga0501037_0305155 | Ga0501037_0305155_564_1010 | 148 |
| 298 | 3300049586 | Ga0501070_0190171 | Ga0501070_0190171_1052_1498 | 148 |
| 299 | 3300049586 | Ga0501070_0434341 | Ga0501070_0434341_22_468 | 148 |
| 300 | 3300049586 | Ga0501070_0728916 | Ga0501070_0728916_177_623 | 148 |
| 301 | 3300049589 | Ga0501073_0317376 | Ga0501073_0317376_41_487 | 148 |
| 302 | 3300049742 | Ga0501080_0000133 | Ga0501080_0000133_24459_24905 | 148 |
| 303 | 3300049773 | Ga0501276_000057 | Ga0501276_000057_3826_4272 | 148 |
| 304 | 3300050489 | nmdc:mga03683_20_c3 | nmdc:mga03683_20_c3_14410_14883 | 148 |
| 305 | 3300050489 | nmdc:mga03683_27206_c1 | nmdc:mga03683_27206_c1_1780_2226 | 148 |
| 306 | 3300050491 | nmdc:mga00v17_120896_c1 | nmdc:mga00v17_120896_c1_827_1273 | 148 |
| 307 | 3300050491 | nmdc:mga00v17_196631_c1 | nmdc:mga00v17_196631_c1_29_475 | 148 |
| 308 | 3300050491 | nmdc:mga00v17_37921_c1 | nmdc:mga00v17_37921_c1_1896_2357 | 148 |
| 309 | 3300050492 | nmdc:mga0yw44_379685_c1 | nmdc:mga0yw44_379685_c1_258_704 | 148 |
| 310 | 3300050492 | nmdc:mga0yw44_397_c1 | nmdc:mga0yw44_397_c1_8097_8543 | 148 |
| 311 | 3300050492 | nmdc:mga0yw44_90758_c1 | nmdc:mga0yw44_90758_c1_414_863 | 148 |
| 312 | 3300050493 | nmdc:mga0k408_114_c1 | nmdc:mga0k408_114_c1_15221_15667 | 148 |
| 313 | 3300050493 | nmdc:mga0k408_17_c2 | nmdc:mga0k408_17_c2_12950_13399 | 148 |
| 314 | 3300050493 | nmdc:mga0k408_4029_c2 | nmdc:mga0k408_4029_c2_3172_3618 | 148 |
| 315 | 3300050493 | nmdc:mga0k408_442135_c1 | nmdc:mga0k408_442135_c1_311_757 | 148 |
| 316 | 3300050493 | nmdc:mga0k408_7513_c1 | nmdc:mga0k408_7513_c1_2871_3317 | 148 |
| 317 | 3300050494 | nmdc:mga06z11_534843_c1 | nmdc:mga06z11_534843_c1_42_488 | 148 |
| 318 | 3300050496 | nmdc:mga07m45_7503_c2 | nmdc:mga07m45_7503_c2_496_942 | 148 |
| 319 | 3300050516 | nmdc:mga0sz30_24448_c1 | nmdc:mga0sz30_24448_c1_1550_1999 | 148 |
| 320 | 3300050516 | nmdc:mga0sz30_48908_c1 | nmdc:mga0sz30_48908_c1_710_1156 | 148 |
| 321 | 3300053087 | Ga0500643_000043 | Ga0500643_000043_151865_152311 | 148 |
| 322 | 3300053088 | Ga0500644_0000935 | Ga0500644_0000935_2389_2835 | 148 |
| 323 | 3300053088 | Ga0500644_0003942 | Ga0500644_0003942_700_1146 | 148 |
| 324 | 3300053090 | Ga0500646_0000290 | Ga0500646_0000290_7622_8071 | 148 |
| 325 | 3300053092 | Ga0500583_0017248 | Ga0500583_0017248_795_1244 | 148 |
| 326 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_406375_406824 | 148 |
| 327 | 3300053104 | Ga0500556_0001227 | Ga0500556_0001227_11388_11837 | 148 |
| 328 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_827906_828355 | 148 |
| 329 | 3300053108 | Ga0500562_002309 | Ga0500562_002309_1242_1691 | 148 |
| 330 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_1067453_1067902 | 148 |
| 331 | 3300053118 | Ga0500594_0002594 | Ga0500594_0002594_1088_1534 | 148 |
| 332 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_315564_316010 | 148 |
| 333 | 3300053129 | Ga0500628_000012 | Ga0500628_000012_19686_20132 | 148 |
| 334 | 3300053129 | Ga0500628_017303 | Ga0500628_017303_592_1038 | 148 |
| 335 | 3300053133 | Ga0500655_000436 | Ga0500655_000436_288_737 | 148 |
| 336 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_620770_621216 | 148 |
| 337 | 3300053142 | Ga0500577_0000427 | Ga0500577_0000427_4338_4784 | 148 |
| 338 | 3300053142 | Ga0500577_0004394 | Ga0500577_0004394_1216_1665 | 148 |
| 339 | 3300053143 | Ga0500579_005181 | Ga0500579_005181_1485_1934 | 148 |
| 340 | 3300053156 | Ga0500622_0078098 | Ga0500622_0078098_383_829 | 148 |
| 341 | 3300053722 | Ga0500649_000013 | Ga0500649_000013_63570_64016 | 148 |
| 342 | 3300053724 | Ga0500570_000005 | Ga0500570_000005_96215_96661 | 148 |
| 343 | 3300053727 | Ga0500611_000355 | Ga0500611_000355_2271_2717 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bes-assembly2.cif.gz_C | structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. | 0.9752 | 1 | 146 |
| 3ph4-assembly1.cif.gz_A | clostridium thermocellum ribose-5-phosphate isomerase b with d-allose | 0.9711 | 1 | 147 |
| 1o1x-assembly1.cif.gz_A | crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution | 0.9683 | 2 | 147 |
| 6mu0-assembly1.cif.gz_A | crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate | 0.9669 | 2 | 146 |
| 4em8-assembly1.cif.gz_B | the structure of ribose 5-phosphate isomerase b from anaplasma phagocytophilum | 0.9667 | 2 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKD7_1_162_3.40.1400.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9746 | 1 | 146 | 3.40.1400.10 |
| 4em8B00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9667 | 2 | 144 | 3.40.1400.10 |
| 6mu0A00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9665 | 2 | 146 | 3.40.1400.10 |
| 1o1xA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.963 | 2 | 147 | 3.40.1400.10 |
| 4lfkB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9623 | 1 | 148 | 3.40.1400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431HH15-F1-model_v4 | RpiB/LacA/LacB family sugar-phosphate isomerase | 0.991 | 1 | 148 |
GO:0005975
GO:0016861 |
| AF-A0A1F7GAM8-F1-model_v4 | Ribose-5-phosphate isomerase | 0.9855 | 1 | 145 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A521Z8S9-F1-model_v4 | RpiB/LacA/LacB family sugar-phosphate isomerase | 0.9853 | 1 | 147 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A3A4ULU5-F1-model_v4 | RpiB/LacA/LacB family sugar-phosphate isomerase | 0.9852 | 1 | 147 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A2N6A0Z4-F1-model_v4 | RpiB/LacA/LacB family sugar-phosphate isomerase | 0.9847 | 1 | 145 |
GO:0004751
GO:0009052 GO:0019316 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar