F415523

General Info

Members Datasets Scaffolds Average Seq Length
343 189 343 148

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100590484|Ga0068871_1005904842
Length 167
Sequence MPHSDSENCLCYTKIKGVGMKIFLGGDHNGFERKKELAEYLRRSGYEVIDEGDKNLEPEDDFPQFASRVVNAMRAEGEDARGILICGSGQGMCMAANRFKGIRAALASDQEEARSARNDDDSNILCVSSRYLDFDTTVGIVHTWLITPFAGASRFKRRIAQLDDLGM

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
67 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
68 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
69 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
168 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
169 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
176 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
177 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
178 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
179 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
184 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
188 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
189 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.95
Nodule 0
Rhizoplane 1.75
Rhizosphere 69.68
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000038 3300001915 Bacteria 31009
2 JGI24741J21665_1004123 3300001915 Unclassified 3291
3 JGI24740J21852_10025542 3300001979 Unclassified 1990
4 JGI24737J22298_10000095 3300001990 Bacteria 26030
5 JGI24735J21928_10000419 3300002067 Bacteria 14834
6 rootH2_10006847 3300003320 Bacteria 155484
7 rootH2_10265633 3300003320 Unclassified 1577
8 rootL2_10032831 3300003322 Bacteria 1859
9 rootL2_10345651 3300003322 Bacteria 1656
10 rootH1_10333123 3300003323 Bacteria 1134
11 JGI25405J52794_10000208 3300003911 Bacteria 7663
12 Ga0065704_10310638 3300005289 Bacteria 869
13 Ga0070658_10000020 3300005327 Bacteria 188851
14 Ga0070658_10000698 3300005327 Bacteria 29119
15 Ga0070658_10004259 3300005327 Bacteria 11691
16 Ga0070658_10007725 3300005327 Bacteria 8663
17 Ga0070658_10027230 3300005327 Bacteria 4589
18 Ga0070658_10034880 3300005327 Unclassified 4049
19 Ga0070658_10051728 3300005327 Bacteria 3329
20 Ga0070677_10022032 3300005333 Unclassified 2342
21 Ga0070680_100871562 3300005336 Unclassified 776
22 Ga0070660_100000224 3300005339 Bacteria 37460
23 Ga0070660_100000454 3300005339 Bacteria 27343
24 Ga0070660_100189675 3300005339 Unclassified 1665
25 Ga0070691_10001232 3300005341 Bacteria 10772
26 Ga0070692_10271938 3300005345 Bacteria 1023
27 Ga0070671_100114573 3300005355 Bacteria 2266
28 Ga0070674_100013892 3300005356 Unclassified 4991
29 Ga0070674_100595563 3300005356 Bacteria 933
30 Ga0070673_100000478 3300005364 Bacteria 21291
31 Ga0070688_100574294 3300005365 Bacteria 860
32 Ga0070659_100001084 3300005366 Bacteria 19882
33 Ga0070659_100121733 3300005366 Unclassified 2114
34 Ga0070667_100002835 3300005367 Bacteria 14959
35 Ga0070667_100131750 3300005367 Bacteria 2183
36 Ga0070700_100035333 3300005441 Bacteria 3024
37 Ga0070678_100017282 3300005456 Bacteria 4640
38 Ga0070681_10311194 3300005458 Bacteria 1484
39 Ga0070685_10001150 3300005466 Bacteria 14152
40 Ga0070685_10002053 3300005466 Bacteria 10422
41 Ga0070679_100018926 3300005530 Bacteria 6687
42 Ga0070679_100389126 3300005530 Bacteria 1341
43 Ga0070679_101186887 3300005530 Unclassified 708
44 Ga0070684_100595851 3300005535 Bacteria 1027
45 Ga0070672_100024525 3300005543 Bacteria 4460
46 Ga0070686_100250173 3300005544 Bacteria 1294
47 Ga0070665_100019100 3300005548 Bacteria 6876
48 Ga0070665_100327066 3300005548 Bacteria 1537
49 Ga0068855_100000211 3300005563 Bacteria 74558
50 Ga0068855_100091960 3300005563 Bacteria 3499
51 Ga0068857_100000002 3300005577 Bacteria 241401
52 Ga0068856_100032328 3300005614 Bacteria 5122
53 Ga0068859_101786424 3300005617 Bacteria 679
54 Ga0068864_100894786 3300005618 Bacteria 876
55 Ga0068866_10685237 3300005718 Bacteria 701
56 Ga0068861_100930683 3300005719 Bacteria 825
57 Ga0068863_100083636 3300005841 Bacteria 3024
58 Ga0068863_100220357 3300005841 Bacteria 1828
59 Ga0068863_102347961 3300005841 Bacteria 543
60 Ga0068858_100149488 3300005842 Bacteria 2195
61 Ga0068858_100731878 3300005842 Bacteria 963
62 Ga0068860_100114349 3300005843 Bacteria 2581
63 Ga0068862_100036003 3300005844 Bacteria 4193
64 Ga0081455_10000001 3300005937 Bacteria 603871
65 Ga0081455_10000003 3300005937 Bacteria 367763
66 Ga0075365_10000020 3300006038 Bacteria 64494
67 Ga0075365_10002844 3300006038 Bacteria 8686
68 Ga0075365_10079015 3300006038 Bacteria 2225
69 Ga0075368_10002443 3300006042 Bacteria 6065
70 Ga0075368_10049769 3300006042 Bacteria 1663
71 Ga0075363_100000016 3300006048 Bacteria 38279
72 Ga0075364_10045228 3300006051 Unclassified 2865
73 Ga0075364_10080408 3300006051 Bacteria 2154
74 Ga0075364_10168680 3300006051 Bacteria 1479
75 Ga0075362_10000073 3300006177 Bacteria 27914
76 Ga0075362_10501769 3300006177 Bacteria 620
77 Ga0075367_10000637 3300006178 Bacteria 13436
78 Ga0075369_10000005 3300006186 Bacteria 147699
79 Ga0075369_10000051 3300006186 Bacteria 29832
80 Ga0075369_10173372 3300006186 Bacteria 991
81 Ga0075366_10000001 3300006195 Bacteria 569172
82 Ga0075366_10000044 3300006195 Bacteria 45021
83 Ga0075366_10000342 3300006195 Bacteria 21427
84 Ga0075366_10009291 3300006195 Bacteria 5491
85 Ga0075366_10010754 3300006195 Bacteria 5144
86 Ga0097621_100001002 3300006237 Bacteria 19854
87 Ga0097621_100547018 3300006237 Unclassified 1053
88 Ga0097621_100735389 3300006237 Bacteria 910
89 Ga0075370_10017117 3300006353 Bacteria 3912
90 Ga0075370_10167409 3300006353 Bacteria 1291
91 Ga0075370_10265450 3300006353 Bacteria 1018
92 Ga0068871_100000156 3300006358 Bacteria 45103
93 Ga0068871_100590484 3300006358 Bacteria 1009
94 Ga0075428_100034021 3300006844 Bacteria 5622
95 Ga0075430_100025155 3300006846 Bacteria 5063
96 Ga0097620_101786342 3300006931 Bacteria 679
97 Ga0105240_10000003 3300009093 Bacteria 1183681
98 Ga0105240_10042730 3300009093 Bacteria 5774
99 Ga0105245_10000002 3300009098 Bacteria 634374
100 Ga0105245_10000122 3300009098 Bacteria 75415
101 Ga0105245_10003504 3300009098 Bacteria 14046
102 Ga0105245_10034602 3300009098 Unclassified 4482
103 Ga0105245_10095193 3300009098 Bacteria 2747
104 Ga0105245_10850433 3300009098 Bacteria 952
105 Ga0105245_11746075 3300009098 Unclassified 675
106 Ga0105247_10043015 3300009101 Unclassified 2767
107 Ga0105247_10072194 3300009101 Bacteria 2160
108 Ga0105243_10000001 3300009148 Bacteria 1156578
109 Ga0105243_10008792 3300009148 Bacteria 7735
110 Ga0105241_10000003 3300009174 Bacteria 839043
111 Ga0105241_10632418 3300009174 Bacteria 970
112 Ga0105241_10807353 3300009174 Unclassified 865
113 Ga0105242_10000064 3300009176 Bacteria 74150
114 Ga0105242_10001814 3300009176 Bacteria 16772
115 Ga0105242_10111899 3300009176 Bacteria 2329
116 Ga0105242_10455813 3300009176 Bacteria 1207
117 Ga0105248_10322747 3300009177 Bacteria 1739
118 Ga0105237_10009676 3300009545 Bacteria 10316
119 Ga0105237_10178780 3300009545 Bacteria 2122
120 Ga0105238_10141789 3300009551 Bacteria 2380
121 Ga0105238_10288211 3300009551 Bacteria 1624
122 Ga0105238_10673636 3300009551 Unclassified 1045
123 Ga0105032_100054 3300009979 Bacteria 14092
124 Ga0105029_100020 3300009984 Bacteria 8175
125 Ga0105033_100510 3300009986 Bacteria 3014
126 Ga0105033_101944 3300009986 Unclassified 1706
127 Ga0105033_103919 3300009986 Bacteria 1264
128 Ga0105030_102457 3300009987 Unclassified 1610
129 Ga0105239_10068970 3300010375 Bacteria 3886
130 Ga0105239_10115049 3300010375 Bacteria 2984
131 Ga0105239_10352446 3300010375 Bacteria 1662
132 Ga0105239_11541919 3300010375 Unclassified 768
133 Ga0105246_11344652 3300011119 Bacteria 664
134 Ga0157371_10000937 3300013102 Bacteria 32624
135 Ga0157369_10000261 3300013105 Bacteria 71207
136 Ga0157369_10370420 3300013105 Unclassified 1487
137 Ga0157369_10545917 3300013105 Unclassified 1198
138 Ga0157374_10000031 3300013296 Bacteria 204840
139 Ga0157374_10000934 3300013296 Bacteria 25443
140 Ga0157374_10001692 3300013296 Bacteria 18472
141 Ga0157374_10021134 3300013296 Bacteria 5785
142 Ga0157378_10052886 3300013297 Bacteria 3614
143 Ga0157378_10126237 3300013297 Bacteria 2364
144 Ga0157378_10146442 3300013297 Unclassified 2197
145 Ga0163162_11356345 3300013306 Bacteria 809
146 Ga0157372_10207367 3300013307 Bacteria 2271
147 Ga0157372_10252947 3300013307 Bacteria 2045
148 Ga0157372_10870336 3300013307 Bacteria 1046
149 Ga0163163_10003002 3300014325 Bacteria 14278
150 Ga0163163_10025827 3300014325 Bacteria 5603
151 Ga0163163_10389073 3300014325 Bacteria 1452
152 Ga0163163_12156221 3300014325 Unclassified 617
153 Ga0157377_10046392 3300014745 Unclassified 2430
154 Ga0157379_10082232 3300014968 Unclassified 2886
155 Ga0157376_10000001 3300014969 Bacteria 842910
156 Ga0157376_10836128 3300014969 Bacteria 935
157 Ga0207647_10423106 3300025904 Unclassified 749
158 Ga0207705_10000011 3300025909 Bacteria 517768
159 Ga0207705_10000056 3300025909 Bacteria 157554
160 Ga0207705_10000327 3300025909 Bacteria 43259
161 Ga0207705_10018486 3300025909 Bacteria 4983
162 Ga0207705_10091946 3300025909 Bacteria 2223
163 Ga0207705_11252968 3300025909 Unclassified 568
164 Ga0207654_10000002 3300025911 Bacteria 1460142
165 Ga0207707_10240495 3300025912 Bacteria 1574
166 Ga0207695_10000005 3300025913 Bacteria 1196715
167 Ga0207695_10251507 3300025913 Bacteria 1666
168 Ga0207671_10004219 3300025914 Bacteria 13846
169 Ga0207671_10348786 3300025914 Bacteria 1173
170 Ga0207660_11231845 3300025917 Bacteria 608
171 Ga0207657_10000741 3300025919 Bacteria 34635
172 Ga0207657_10001246 3300025919 Bacteria 27202
173 Ga0207657_10004983 3300025919 Bacteria 13968
174 Ga0207652_10039985 3300025921 Bacteria 3982
175 Ga0207652_10070130 3300025921 Bacteria 3043
176 Ga0207652_10507739 3300025921 Bacteria 1085
177 Ga0207694_10122299 3300025924 Bacteria 2079
178 Ga0207694_10726693 3300025924 Unclassified 838
179 Ga0207687_10000001 3300025927 Bacteria 1130810
180 Ga0207687_10000111 3300025927 Bacteria 58083
181 Ga0207687_10022274 3300025927 Bacteria 4214
182 Ga0207687_10333391 3300025927 Unclassified 1231
183 Ga0207687_10528349 3300025927 Bacteria 988
184 Ga0207644_10238843 3300025931 Unclassified 1446
185 Ga0207644_10274001 3300025931 Bacteria 1353
186 Ga0207690_10002993 3300025932 Bacteria 10175
187 Ga0207690_10329126 3300025932 Bacteria 1203
188 Ga0207686_10000001 3300025934 Bacteria 1169580
189 Ga0207686_10062976 3300025934 Bacteria 2357
190 Ga0207686_10082135 3300025934 Bacteria 2106
191 Ga0207686_10145732 3300025934 Bacteria 1642
192 Ga0207709_10000002 3300025935 Bacteria 1171536
193 Ga0207709_10109382 3300025935 Bacteria 1845
194 Ga0207669_10023824 3300025937 Bacteria 3277
195 Ga0207669_10516501 3300025937 Bacteria 958
196 Ga0207691_10127119 3300025940 Bacteria 2254
197 Ga0207667_10000008 3300025949 Bacteria 625138
198 Ga0207667_10000466 3300025949 Bacteria 54272
199 Ga0207667_10031525 3300025949 Bacteria 5722
200 Ga0207651_10004394 3300025960 Bacteria 7096
201 Ga0207651_10722738 3300025960 Bacteria 879
202 Ga0207712_10002011 3300025961 Bacteria 13346
203 Ga0207668_10076528 3300025972 Bacteria 2410
204 Ga0207658_10106854 3300025986 Unclassified 2204
205 Ga0207703_10345568 3300026035 Bacteria 1368
206 Ga0207708_10065807 3300026075 Bacteria 2771
207 Ga0207702_10037462 3300026078 Bacteria 4060
208 Ga0207641_10033583 3300026088 Bacteria 4262
209 Ga0207641_10064846 3300026088 Bacteria 3123
210 Ga0207676_10811590 3300026095 Bacteria 913
211 Ga0207674_10000001 3300026116 Bacteria 616581
212 Ga0207683_10063904 3300026121 Unclassified 3243
213 Ga0207683_10095325 3300026121 Bacteria 2653
214 Ga0209813_10000004 3300027866 Bacteria 139340
215 Ga0268266_10001150 3300028379 Bacteria 32834
216 Ga0268265_10182737 3300028380 Bacteria 1803
217 Ga0268264_10067517 3300028381 Bacteria 3019
218 Ga0265337_1030254 3300028556 Bacteria 1614
219 Ga0265319_1131456 3300028563 Unclassified 778
220 Ga0265334_10000032 3300028573 Bacteria 107258
221 Ga0307517_10172389 3300028786 Unclassified 1419
222 Ga0265338_10000052 3300028800 Bacteria 209239
223 Ga0265338_10000192 3300028800 Bacteria 115195
224 Ga0265338_10000601 3300028800 Bacteria 63282
225 Ga0265338_10003756 3300028800 Bacteria 21096
226 Ga0265338_10022464 3300028800 Bacteria 6531
227 Ga0265338_10035636 3300028800 Bacteria 4776
228 Ga0314311_1042448 3300030733 Bacteria 1263
229 Ga0316183_1008217 3300030742 Bacteria 7119
230 Ga0316183_1062714 3300030742 Bacteria 7229
231 Ga0316183_1207294 3300030742 Bacteria 1226
232 Ga0316181_1138937 3300030744 Bacteria 58229
233 Ga0316182_1028256 3300030745 Bacteria 15303
234 Ga0316182_1069541 3300030745 Bacteria 851
235 Ga0316182_1101633 3300030745 Bacteria 3020
236 Ga0265340_10000077 3300031247 Bacteria 47065
237 Ga0265327_10000961 3300031251 Bacteria 41308
238 Ga0265327_10004080 3300031251 Bacteria 13211
239 Ga0265327_10099549 3300031251 Unclassified 1405
240 Ga0307516_10004034 3300031730 Bacteria 18404
241 Ga0373952_0126986 3300035092 Unclassified 697
242 Ga0373925_1162078 3300037068 Bacteria 634
243 Ga0395900_0039080 3300037418 Bacteria 4891
244 Ga0395900_0047975 3300037418 Bacteria 4399
245 Ga0395898_0959029 3300037466 Unclassified 792
246 Ga0395905_0002005 3300037471 Bacteria 23268
247 Ga0395905_0756612 3300037471 Unclassified 874
248 Ga0395905_1330674 3300037471 Bacteria 622
249 Ga0395901_0001919 3300038443 Bacteria 21405
250 Ga0451802_0097460 3300041460 Unclassified 647
251 Ga0451839_1370826 3300041496 Bacteria 517
252 Ga0439432_006774 3300042006 Bacteria 4077
253 Ga0450918_000271 3300042531 Bacteria 11744
254 Ga0466963_0673482 3300044694 Bacteria 730
255 Ga0466967_2555524 3300045976 Unclassified 505
256 Ga0495583_0014267 3300046506 Unclassified 4392
257 Ga0495609_0148431 3300046538 Unclassified 998
258 Ga0495588_0000116 3300046674 Bacteria 135919
259 Ga0495658_0146200 3300046683 Bacteria 1449
260 Ga0495658_0695667 3300046683 Bacteria 651
261 Ga0495672_0135844 3300047320 Unclassified 1289
262 Ga0495681_0260397 3300047470 Unclassified 682
263 Ga0496100_0040985 3300048903 Unclassified 2949
264 Ga0496100_0883373 3300048903 Bacteria 702
265 Ga0496109_0211074 3300048912 Bacteria 1826
266 Ga0496112_0044274 3300048915 Bacteria 4361
267 Ga0496113_0575238 3300048916 Bacteria 903
268 Ga0496126_0026023 3300048929 Bacteria 5618
269 Ga0495678_149044 3300049459 Unclassified 757
270 Ga0501034_0978432 3300049571 Bacteria 731
271 Ga0501037_0305155 3300049573 Unclassified 1105
272 Ga0501070_0190171 3300049586 Bacteria 1687
273 Ga0501070_0434341 3300049586 Bacteria 1060
274 Ga0501070_0728916 3300049586 Unclassified 782
275 Ga0501073_0317376 3300049589 Unclassified 1075
276 Ga0501080_0000133 3300049742 Bacteria 52488
277 Ga0501276_000057 3300049773 Bacteria 6139
278 nmdc:mga03683_20_c3 3300050489 Bacteria 29488
279 nmdc:mga03683_27206_c1 3300050489 Bacteria 2262
280 nmdc:mga03n38_155660_c1 3300050490 Bacteria 1153
281 nmdc:mga03n38_22_c1 3300050490 Bacteria 38225
282 nmdc:mga00v17_120896_c1 3300050491 Bacteria 1667
283 nmdc:mga00v17_196631_c1 3300050491 Unclassified 1303
284 nmdc:mga00v17_37921_c1 3300050491 Unclassified 2879
285 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
286 nmdc:mga0yw44_379685_c1 3300050492 Bacteria 954
287 nmdc:mga0yw44_397_c1 3300050492 Bacteria 10503
288 nmdc:mga0yw44_682229_c1 3300050492 Bacteria 698
289 nmdc:mga0yw44_90758_c1 3300050492 Unclassified 1930
290 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
291 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
292 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
293 nmdc:mga0k408_4029_c2 3300050493 Bacteria 5496
294 nmdc:mga0k408_442135_c1 3300050493 Unclassified 772
295 nmdc:mga0k408_7513_c1 3300050493 Bacteria 5820
296 nmdc:mga06z11_534843_c1 3300050494 Bacteria 711
297 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
298 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
299 nmdc:mga07m45_110368_c1 3300050496 Bacteria 1584
300 nmdc:mga07m45_35926_c1 3300050496 Bacteria 2757
301 nmdc:mga07m45_43368_c1 3300050496 Unclassified 2522
302 nmdc:mga07m45_7503_c2 3300050496 Bacteria 3944
303 nmdc:mga0qj67_20494_c1 3300050509 Bacteria 5063
304 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
305 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
306 nmdc:mga0sz30_24448_c1 3300050516 Bacteria 2465
307 nmdc:mga0sz30_48908_c1 3300050516 Bacteria 1790
308 Ga0500610_0162858 3300053079 Bacteria 1108
309 Ga0500643_000022 3300053087 Bacteria 277519
310 Ga0500643_000043 3300053087 Bacteria 157905
311 Ga0500643_029967 3300053087 Unclassified 1670
312 Ga0500644_0000935 3300053088 Bacteria 9247
313 Ga0500644_0003942 3300053088 Bacteria 3696
314 Ga0500644_0072154 3300053088 Bacteria 1247
315 Ga0500646_0000290 3300053090 Bacteria 15407
316 Ga0500583_0000137 3300053092 Bacteria 31497
317 Ga0500583_0017248 3300053092 Bacteria 2904
318 Ga0500651_0000045 3300053093 Bacteria 85481
319 Ga0500651_0001186 3300053093 Bacteria 12921
320 Ga0500650_0000001 3300053098 Bacteria 818797
321 Ga0500556_0001227 3300053104 Bacteria 11950
322 Ga0500562_000002 3300053108 Bacteria 977234
323 Ga0500562_002309 3300053108 Bacteria 4779
324 Ga0500594_0000001 3300053118 Bacteria 1178472
325 Ga0500594_0002594 3300053118 Unclassified 3926
326 Ga0500594_0213438 3300053118 Unclassified 636
327 Ga0500614_000001 3300053123 Bacteria 1274484
328 Ga0500614_011759 3300053123 Bacteria 1901
329 Ga0500628_000012 3300053129 Bacteria 106556
330 Ga0500628_017303 3300053129 Unclassified 1406
331 Ga0500642_0139257 3300053130 Bacteria 1138
332 Ga0500655_000436 3300053133 Bacteria 8576
333 Ga0500561_0000001 3300053137 Bacteria 957685
334 Ga0500577_0000427 3300053142 Bacteria 10827
335 Ga0500577_0004394 3300053142 Bacteria 3722
336 Ga0500579_005181 3300053143 Bacteria 7989
337 Ga0500589_000016 3300053147 Bacteria 107090
338 Ga0500616_0000005 3300053153 Bacteria 961725
339 Ga0500616_0118538 3300053153 Unclassified 1268
340 Ga0500622_0078098 3300053156 Unclassified 1662
341 Ga0500649_000013 3300053722 Bacteria 73694
342 Ga0500570_000005 3300053724 Bacteria 132994
343 Ga0500611_000355 3300053727 Unclassified 4701

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0756612 Ga0395905_0756612_489_857 120
2 3300025935 Ga0207709_10109382 Ga0207709_101093822 133
3 3300030742 Ga0316183_1008217 Ga0316183_10082171 133
4 3300003322 rootL2_10032831 rootL2_100328313 134
5 3300003323 rootH1_10333123 rootH1_103331232 134
6 3300003911 JGI25405J52794_10000208 JGI25405J52794_100002085 134
7 3300005937 Ga0081455_10000001 Ga0081455_10000001257 134
8 3300050492 nmdc:mga0yw44_682229_c1 nmdc:mga0yw44_682229_c1_19_423 134
9 3300003320 rootH2_10006847 rootH2_1000684797 135
10 3300006042 Ga0075368_10002443 Ga0075368_100024438 135
11 3300006048 Ga0075363_100000016 Ga0075363_10000001626 135
12 3300006178 Ga0075367_10000637 Ga0075367_1000063711 135
13 3300006353 Ga0075370_10265450 Ga0075370_102654501 135
14 3300027866 Ga0209813_10000004 Ga0209813_1000000489 135
15 3300030742 Ga0316183_1207294 Ga0316183_12072942 135
16 3300030745 Ga0316182_1101633 Ga0316182_11016333 135
17 3300035092 Ga0373952_0126986 Ga0373952_0126986_72_518 135
18 3300046538 Ga0495609_0148431 Ga0495609_0148431_12_419 135
19 3300050490 nmdc:mga03n38_22_c1 nmdc:mga03n38_22_c1_23836_24282 135
20 3300050494 nmdc:mga06z11_6_c1 nmdc:mga06z11_6_c1_28098_28544 135
21 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_57340_57786 135
22 3300050496 nmdc:mga07m45_43368_c1 nmdc:mga07m45_43368_c1_391_837 135
23 3300025911 Ga0207654_10000002 Ga0207654_10000002970 144
24 3300025914 Ga0207671_10348786 Ga0207671_103487861 144
25 3300025949 Ga0207667_10000008 Ga0207667_1000000862 144
26 3300009148 Ga0105243_10008792 Ga0105243_100087927 146
27 3300013102 Ga0157371_10000937 Ga0157371_100009379 146
28 3300005367 Ga0070667_100131750 Ga0070667_1001317504 147
29 3300005544 Ga0070686_100250173 Ga0070686_1002501732 147
30 3300005617 Ga0068859_101786424 Ga0068859_1017864242 147
31 3300005618 Ga0068864_100894786 Ga0068864_1008947861 147
32 3300005842 Ga0068858_100149488 Ga0068858_1001494882 147
33 3300005842 Ga0068858_100731878 Ga0068858_1007318782 147
34 3300005843 Ga0068860_100114349 Ga0068860_1001143494 147
35 3300005844 Ga0068862_100036003 Ga0068862_1000360033 147
36 3300005937 Ga0081455_10000003 Ga0081455_10000003361 147
37 3300006038 Ga0075365_10000020 Ga0075365_1000002014 147
38 3300006186 Ga0075369_10000005 Ga0075369_1000000537 147
39 3300006186 Ga0075369_10000051 Ga0075369_1000005118 147
40 3300006195 Ga0075366_10000001 Ga0075366_10000001465 147
41 3300006237 Ga0097621_100001002 Ga0097621_1000010021 147
42 3300006358 Ga0068871_100000156 Ga0068871_1000001562 147
43 3300006358 Ga0068871_100590484 Ga0068871_1005904842 147
44 3300006844 Ga0075428_100034021 Ga0075428_1000340213 147
45 3300006846 Ga0075430_100025155 Ga0075430_1000251554 147
46 3300006931 Ga0097620_101786342 Ga0097620_1017863422 147
47 3300009093 Ga0105240_10000003 Ga0105240_10000003770 147
48 3300009098 Ga0105245_10000002 Ga0105245_10000002178 147
49 3300009098 Ga0105245_10000122 Ga0105245_1000012269 147
50 3300009098 Ga0105245_10003504 Ga0105245_1000350418 147
51 3300009098 Ga0105245_10034602 Ga0105245_100346021 147
52 3300009098 Ga0105245_10095193 Ga0105245_100951932 147
53 3300009101 Ga0105247_10072194 Ga0105247_100721942 147
54 3300009148 Ga0105243_10000001 Ga0105243_10000001522 147
55 3300009176 Ga0105242_10000064 Ga0105242_1000006462 147
56 3300009176 Ga0105242_10111899 Ga0105242_101118992 147
57 3300009545 Ga0105237_10009676 Ga0105237_100096763 147
58 3300010375 Ga0105239_10115049 Ga0105239_101150492 147
59 3300013105 Ga0157369_10545917 Ga0157369_105459171 147
60 3300013296 Ga0157374_10000031 Ga0157374_10000031195 147
61 3300013296 Ga0157374_10000934 Ga0157374_1000093410 147
62 3300013306 Ga0163162_11356345 Ga0163162_113563452 147
63 3300014325 Ga0163163_10003002 Ga0163163_100030029 147
64 3300014325 Ga0163163_10025827 Ga0163163_100258274 147
65 3300014745 Ga0157377_10046392 Ga0157377_100463921 147
66 3300014969 Ga0157376_10000001 Ga0157376_10000001176 147
67 3300025913 Ga0207695_10000005 Ga0207695_10000005779 147
68 3300025914 Ga0207671_10004219 Ga0207671_1000421911 147
69 3300025927 Ga0207687_10000001 Ga0207687_100000011033 147
70 3300025927 Ga0207687_10000111 Ga0207687_1000011122 147
71 3300025927 Ga0207687_10022274 Ga0207687_100222742 147
72 3300025927 Ga0207687_10333391 Ga0207687_103333913 147
73 3300025934 Ga0207686_10000001 Ga0207686_10000001620 147
74 3300025934 Ga0207686_10062976 Ga0207686_100629762 147
75 3300025935 Ga0207709_10000002 Ga0207709_10000002738 147
76 3300025960 Ga0207651_10722738 Ga0207651_107227381 147
77 3300025972 Ga0207668_10076528 Ga0207668_100765284 147
78 3300026035 Ga0207703_10345568 Ga0207703_103455682 147
79 3300026095 Ga0207676_10811590 Ga0207676_108115901 147
80 3300028380 Ga0268265_10182737 Ga0268265_101827373 147
81 3300028381 Ga0268264_10067517 Ga0268264_100675174 147
82 3300028786 Ga0307517_10172389 Ga0307517_101723893 147
83 3300031730 Ga0307516_10004034 Ga0307516_1000403411 147
84 3300042006 Ga0439432_006774 Ga0439432_006774_1173_1622 147
85 3300046683 Ga0495658_0695667 Ga0495658_0695667_150_593 147
86 3300048929 Ga0496126_0026023 Ga0496126_0026023_1308_1751 147
87 3300049459 Ga0495678_149044 Ga0495678_149044_137_580 147
88 3300050490 nmdc:mga03n38_155660_c1 nmdc:mga03n38_155660_c1_694_1137 147
89 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_206900_207343 147
90 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_647838_648281 147
91 3300050496 nmdc:mga07m45_110368_c1 nmdc:mga07m45_110368_c1_909_1352 147
92 3300050496 nmdc:mga07m45_35926_c1 nmdc:mga07m45_35926_c1_1427_1870 147
93 3300050509 nmdc:mga0qj67_20494_c1 nmdc:mga0qj67_20494_c1_2299_2742 147
94 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_183014_183457 147
95 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_45049_45492 147
96 3300053079 Ga0500610_0162858 Ga0500610_0162858_540_983 147
97 3300053087 Ga0500643_000022 Ga0500643_000022_17156_17599 147
98 3300053087 Ga0500643_029967 Ga0500643_029967_671_1114 147
99 3300053088 Ga0500644_0072154 Ga0500644_0072154_391_834 147
100 3300053092 Ga0500583_0000137 Ga0500583_0000137_7577_8020 147
101 3300053093 Ga0500651_0000045 Ga0500651_0000045_44440_44883 147
102 3300053093 Ga0500651_0001186 Ga0500651_0001186_4930_5373 147
103 3300053118 Ga0500594_0213438 Ga0500594_0213438_170_613 147
104 3300053123 Ga0500614_011759 Ga0500614_011759_1105_1548 147
105 3300053130 Ga0500642_0139257 Ga0500642_0139257_429_872 147
106 3300053147 Ga0500589_000016 Ga0500589_000016_25614_26057 147
107 3300053153 Ga0500616_0000005 Ga0500616_0000005_321213_321656 147
108 3300053153 Ga0500616_0118538 Ga0500616_0118538_434_877 147
109 3300001915 JGI24741J21665_1000038 JGI24741J21665_100003830 148
110 3300001915 JGI24741J21665_1004123 JGI24741J21665_10041232 148
111 3300001979 JGI24740J21852_10025542 JGI24740J21852_100255423 148
112 3300001990 JGI24737J22298_10000095 JGI24737J22298_100000957 148
113 3300002067 JGI24735J21928_10000419 JGI24735J21928_1000041914 148
114 3300003320 rootH2_10265633 rootH2_102656332 148
115 3300003322 rootL2_10345651 rootL2_103456513 148
116 3300005289 Ga0065704_10310638 Ga0065704_103106381 148
117 3300005327 Ga0070658_10000020 Ga0070658_10000020196 148
118 3300005327 Ga0070658_10000698 Ga0070658_100006989 148
119 3300005327 Ga0070658_10004259 Ga0070658_1000425911 148
120 3300005327 Ga0070658_10007725 Ga0070658_1000772510 148
121 3300005327 Ga0070658_10027230 Ga0070658_100272306 148
122 3300005327 Ga0070658_10034880 Ga0070658_100348803 148
123 3300005327 Ga0070658_10051728 Ga0070658_100517282 148
124 3300005333 Ga0070677_10022032 Ga0070677_100220323 148
125 3300005336 Ga0070680_100871562 Ga0070680_1008715621 148
126 3300005339 Ga0070660_100000224 Ga0070660_10000022434 148
127 3300005339 Ga0070660_100000454 Ga0070660_10000045417 148
128 3300005339 Ga0070660_100189675 Ga0070660_1001896752 148
129 3300005341 Ga0070691_10001232 Ga0070691_1000123210 148
130 3300005345 Ga0070692_10271938 Ga0070692_102719382 148
131 3300005355 Ga0070671_100114573 Ga0070671_1001145731 148
132 3300005356 Ga0070674_100013892 Ga0070674_1000138921 148
133 3300005356 Ga0070674_100595563 Ga0070674_1005955632 148
134 3300005364 Ga0070673_100000478 Ga0070673_10000047822 148
135 3300005365 Ga0070688_100574294 Ga0070688_1005742941 148
136 3300005366 Ga0070659_100001084 Ga0070659_1000010849 148
137 3300005366 Ga0070659_100121733 Ga0070659_1001217332 148
138 3300005367 Ga0070667_100002835 Ga0070667_10000283514 148
139 3300005441 Ga0070700_100035333 Ga0070700_1000353333 148
140 3300005456 Ga0070678_100017282 Ga0070678_1000172823 148
141 3300005458 Ga0070681_10311194 Ga0070681_103111943 148
142 3300005466 Ga0070685_10001150 Ga0070685_1000115015 148
143 3300005466 Ga0070685_10002053 Ga0070685_100020538 148
144 3300005530 Ga0070679_100018926 Ga0070679_1000189268 148
145 3300005530 Ga0070679_100389126 Ga0070679_1003891261 148
146 3300005530 Ga0070679_101186887 Ga0070679_1011868872 148
147 3300005535 Ga0070684_100595851 Ga0070684_1005958512 148
148 3300005543 Ga0070672_100024525 Ga0070672_1000245252 148
149 3300005548 Ga0070665_100019100 Ga0070665_1000191004 148
150 3300005548 Ga0070665_100327066 Ga0070665_1003270662 148
151 3300005563 Ga0068855_100000211 Ga0068855_10000021134 148
152 3300005563 Ga0068855_100091960 Ga0068855_1000919604 148
153 3300005577 Ga0068857_100000002 Ga0068857_10000000262 148
154 3300005614 Ga0068856_100032328 Ga0068856_1000323282 148
155 3300005718 Ga0068866_10685237 Ga0068866_106852372 148
156 3300005719 Ga0068861_100930683 Ga0068861_1009306831 148
157 3300005841 Ga0068863_100083636 Ga0068863_1000836365 148
158 3300005841 Ga0068863_100220357 Ga0068863_1002203572 148
159 3300005841 Ga0068863_102347961 Ga0068863_1023479612 148
160 3300006038 Ga0075365_10002844 Ga0075365_100028449 148
161 3300006038 Ga0075365_10079015 Ga0075365_100790152 148
162 3300006042 Ga0075368_10049769 Ga0075368_100497692 148
163 3300006051 Ga0075364_10045228 Ga0075364_100452282 148
164 3300006051 Ga0075364_10080408 Ga0075364_100804083 148
165 3300006051 Ga0075364_10168680 Ga0075364_101686802 148
166 3300006177 Ga0075362_10000073 Ga0075362_1000007315 148
167 3300006177 Ga0075362_10501769 Ga0075362_105017692 148
168 3300006186 Ga0075369_10173372 Ga0075369_101733721 148
169 3300006195 Ga0075366_10000044 Ga0075366_1000004438 148
170 3300006195 Ga0075366_10000342 Ga0075366_1000034213 148
171 3300006195 Ga0075366_10009291 Ga0075366_100092913 148
172 3300006195 Ga0075366_10010754 Ga0075366_100107542 148
173 3300006237 Ga0097621_100547018 Ga0097621_1005470182 148
174 3300006237 Ga0097621_100735389 Ga0097621_1007353892 148
175 3300006353 Ga0075370_10017117 Ga0075370_100171176 148
176 3300006353 Ga0075370_10167409 Ga0075370_101674092 148
177 3300009093 Ga0105240_10042730 Ga0105240_100427302 148
178 3300009098 Ga0105245_10850433 Ga0105245_108504332 148
179 3300009098 Ga0105245_11746075 Ga0105245_117460752 148
180 3300009101 Ga0105247_10043015 Ga0105247_100430153 148
181 3300009174 Ga0105241_10000003 Ga0105241_10000003239 148
182 3300009174 Ga0105241_10632418 Ga0105241_106324182 148
183 3300009174 Ga0105241_10807353 Ga0105241_108073532 148
184 3300009176 Ga0105242_10001814 Ga0105242_100018144 148
185 3300009176 Ga0105242_10455813 Ga0105242_104558132 148
186 3300009177 Ga0105248_10322747 Ga0105248_103227472 148
187 3300009545 Ga0105237_10178780 Ga0105237_101787801 148
188 3300009551 Ga0105238_10141789 Ga0105238_101417893 148
189 3300009551 Ga0105238_10288211 Ga0105238_102882113 148
190 3300009551 Ga0105238_10673636 Ga0105238_106736362 148
191 3300009979 Ga0105032_100054 Ga0105032_10005411 148
192 3300009984 Ga0105029_100020 Ga0105029_1000208 148
193 3300009986 Ga0105033_100510 Ga0105033_1005102 148
194 3300009986 Ga0105033_101944 Ga0105033_1019442 148
195 3300009986 Ga0105033_103919 Ga0105033_1039191 148
196 3300009987 Ga0105030_102457 Ga0105030_1024573 148
197 3300010375 Ga0105239_10068970 Ga0105239_100689705 148
198 3300010375 Ga0105239_10352446 Ga0105239_103524462 148
199 3300010375 Ga0105239_11541919 Ga0105239_115419192 148
200 3300011119 Ga0105246_11344652 Ga0105246_113446522 148
201 3300013105 Ga0157369_10000261 Ga0157369_1000026162 148
202 3300013105 Ga0157369_10370420 Ga0157369_103704202 148
203 3300013296 Ga0157374_10001692 Ga0157374_100016928 148
204 3300013296 Ga0157374_10021134 Ga0157374_100211343 148
205 3300013297 Ga0157378_10052886 Ga0157378_100528864 148
206 3300013297 Ga0157378_10126237 Ga0157378_101262371 148
207 3300013297 Ga0157378_10146442 Ga0157378_101464423 148
208 3300013307 Ga0157372_10207367 Ga0157372_102073672 148
209 3300013307 Ga0157372_10252947 Ga0157372_102529472 148
210 3300013307 Ga0157372_10870336 Ga0157372_108703362 148
211 3300014325 Ga0163163_10389073 Ga0163163_103890731 148
212 3300014325 Ga0163163_12156221 Ga0163163_121562211 148
213 3300014968 Ga0157379_10082232 Ga0157379_100822325 148
214 3300014969 Ga0157376_10836128 Ga0157376_108361282 148
215 3300025904 Ga0207647_10423106 Ga0207647_104231062 148
216 3300025909 Ga0207705_10000011 Ga0207705_10000011247 148
217 3300025909 Ga0207705_10000056 Ga0207705_1000005697 148
218 3300025909 Ga0207705_10000327 Ga0207705_1000032747 148
219 3300025909 Ga0207705_10018486 Ga0207705_100184867 148
220 3300025909 Ga0207705_10091946 Ga0207705_100919462 148
221 3300025909 Ga0207705_11252968 Ga0207705_112529681 148
222 3300025912 Ga0207707_10240495 Ga0207707_102404953 148
223 3300025913 Ga0207695_10251507 Ga0207695_102515072 148
224 3300025917 Ga0207660_11231845 Ga0207660_112318451 148
225 3300025919 Ga0207657_10000741 Ga0207657_1000074134 148
226 3300025919 Ga0207657_10001246 Ga0207657_1000124618 148
227 3300025919 Ga0207657_10004983 Ga0207657_1000498310 148
228 3300025921 Ga0207652_10039985 Ga0207652_100399852 148
229 3300025921 Ga0207652_10070130 Ga0207652_100701302 148
230 3300025921 Ga0207652_10507739 Ga0207652_105077392 148
231 3300025924 Ga0207694_10122299 Ga0207694_101222992 148
232 3300025924 Ga0207694_10726693 Ga0207694_107266932 148
233 3300025927 Ga0207687_10528349 Ga0207687_105283492 148
234 3300025931 Ga0207644_10238843 Ga0207644_102388431 148
235 3300025931 Ga0207644_10274001 Ga0207644_102740012 148
236 3300025932 Ga0207690_10002993 Ga0207690_1000299310 148
237 3300025932 Ga0207690_10329126 Ga0207690_103291262 148
238 3300025934 Ga0207686_10082135 Ga0207686_100821353 148
239 3300025934 Ga0207686_10145732 Ga0207686_101457323 148
240 3300025937 Ga0207669_10023824 Ga0207669_100238245 148
241 3300025937 Ga0207669_10516501 Ga0207669_105165011 148
242 3300025940 Ga0207691_10127119 Ga0207691_101271193 148
243 3300025949 Ga0207667_10000466 Ga0207667_1000046653 148
244 3300025949 Ga0207667_10031525 Ga0207667_100315259 148
245 3300025960 Ga0207651_10004394 Ga0207651_100043944 148
246 3300025961 Ga0207712_10002011 Ga0207712_100020111 148
247 3300025986 Ga0207658_10106854 Ga0207658_101068543 148
248 3300026075 Ga0207708_10065807 Ga0207708_100658073 148
249 3300026078 Ga0207702_10037462 Ga0207702_100374624 148
250 3300026088 Ga0207641_10033583 Ga0207641_100335833 148
251 3300026088 Ga0207641_10064846 Ga0207641_100648464 148
252 3300026116 Ga0207674_10000001 Ga0207674_10000001485 148
253 3300026121 Ga0207683_10063904 Ga0207683_100639043 148
254 3300026121 Ga0207683_10095325 Ga0207683_100953252 148
255 3300028379 Ga0268266_10001150 Ga0268266_1000115013 148
256 3300028556 Ga0265337_1030254 Ga0265337_10302542 148
257 3300028563 Ga0265319_1131456 Ga0265319_11314562 148
258 3300028573 Ga0265334_10000032 Ga0265334_1000003296 148
259 3300028800 Ga0265338_10000052 Ga0265338_10000052144 148
260 3300028800 Ga0265338_10000192 Ga0265338_1000019264 148
261 3300028800 Ga0265338_10000601 Ga0265338_1000060119 148
262 3300028800 Ga0265338_10003756 Ga0265338_100037564 148
263 3300028800 Ga0265338_10022464 Ga0265338_100224646 148
264 3300028800 Ga0265338_10035636 Ga0265338_100356366 148
265 3300030733 Ga0314311_1042448 Ga0314311_10424482 148
266 3300030742 Ga0316183_1062714 Ga0316183_10627144 148
267 3300030744 Ga0316181_1138937 Ga0316181_113893768 148
268 3300030745 Ga0316182_1028256 Ga0316182_102825611 148
269 3300030745 Ga0316182_1069541 Ga0316182_10695411 148
270 3300031247 Ga0265340_10000077 Ga0265340_1000007736 148
271 3300031251 Ga0265327_10000961 Ga0265327_1000096121 148
272 3300031251 Ga0265327_10004080 Ga0265327_1000408011 148
273 3300031251 Ga0265327_10099549 Ga0265327_100995492 148
274 3300037068 Ga0373925_1162078 Ga0373925_1162078_95_541 148
275 3300037418 Ga0395900_0039080 Ga0395900_0039080_1432_1884 148
276 3300037418 Ga0395900_0047975 Ga0395900_0047975_3602_4051 148
277 3300037466 Ga0395898_0959029 Ga0395898_0959029_194_640 148
278 3300037471 Ga0395905_0002005 Ga0395905_0002005_8085_8540 148
279 3300037471 Ga0395905_1330674 Ga0395905_1330674_145_591 148
280 3300038443 Ga0395901_0001919 Ga0395901_0001919_8224_8676 148
281 3300041460 Ga0451802_0097460 Ga0451802_0097460_50_499 148
282 3300041496 Ga0451839_1370826 Ga0451839_1370826_12_464 148
283 3300042531 Ga0450918_000271 Ga0450918_000271_1305_1757 148
284 3300044694 Ga0466963_0673482 Ga0466963_0673482_162_611 148
285 3300045976 Ga0466967_2555524 Ga0466967_2555524_45_491 148
286 3300046506 Ga0495583_0014267 Ga0495583_0014267_3162_3623 148
287 3300046674 Ga0495588_0000116 Ga0495588_0000116_116960_117406 148
288 3300046683 Ga0495658_0146200 Ga0495658_0146200_378_827 148
289 3300047320 Ga0495672_0135844 Ga0495672_0135844_783_1229 148
290 3300047470 Ga0495681_0260397 Ga0495681_0260397_87_533 148
291 3300048903 Ga0496100_0040985 Ga0496100_0040985_2473_2925 148
292 3300048903 Ga0496100_0883373 Ga0496100_0883373_138_590 148
293 3300048912 Ga0496109_0211074 Ga0496109_0211074_1289_1741 148
294 3300048915 Ga0496112_0044274 Ga0496112_0044274_2509_2961 148
295 3300048916 Ga0496113_0575238 Ga0496113_0575238_209_661 148
296 3300049571 Ga0501034_0978432 Ga0501034_0978432_201_647 148
297 3300049573 Ga0501037_0305155 Ga0501037_0305155_564_1010 148
298 3300049586 Ga0501070_0190171 Ga0501070_0190171_1052_1498 148
299 3300049586 Ga0501070_0434341 Ga0501070_0434341_22_468 148
300 3300049586 Ga0501070_0728916 Ga0501070_0728916_177_623 148
301 3300049589 Ga0501073_0317376 Ga0501073_0317376_41_487 148
302 3300049742 Ga0501080_0000133 Ga0501080_0000133_24459_24905 148
303 3300049773 Ga0501276_000057 Ga0501276_000057_3826_4272 148
304 3300050489 nmdc:mga03683_20_c3 nmdc:mga03683_20_c3_14410_14883 148
305 3300050489 nmdc:mga03683_27206_c1 nmdc:mga03683_27206_c1_1780_2226 148
306 3300050491 nmdc:mga00v17_120896_c1 nmdc:mga00v17_120896_c1_827_1273 148
307 3300050491 nmdc:mga00v17_196631_c1 nmdc:mga00v17_196631_c1_29_475 148
308 3300050491 nmdc:mga00v17_37921_c1 nmdc:mga00v17_37921_c1_1896_2357 148
309 3300050492 nmdc:mga0yw44_379685_c1 nmdc:mga0yw44_379685_c1_258_704 148
310 3300050492 nmdc:mga0yw44_397_c1 nmdc:mga0yw44_397_c1_8097_8543 148
311 3300050492 nmdc:mga0yw44_90758_c1 nmdc:mga0yw44_90758_c1_414_863 148
312 3300050493 nmdc:mga0k408_114_c1 nmdc:mga0k408_114_c1_15221_15667 148
313 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_12950_13399 148
314 3300050493 nmdc:mga0k408_4029_c2 nmdc:mga0k408_4029_c2_3172_3618 148
315 3300050493 nmdc:mga0k408_442135_c1 nmdc:mga0k408_442135_c1_311_757 148
316 3300050493 nmdc:mga0k408_7513_c1 nmdc:mga0k408_7513_c1_2871_3317 148
317 3300050494 nmdc:mga06z11_534843_c1 nmdc:mga06z11_534843_c1_42_488 148
318 3300050496 nmdc:mga07m45_7503_c2 nmdc:mga07m45_7503_c2_496_942 148
319 3300050516 nmdc:mga0sz30_24448_c1 nmdc:mga0sz30_24448_c1_1550_1999 148
320 3300050516 nmdc:mga0sz30_48908_c1 nmdc:mga0sz30_48908_c1_710_1156 148
321 3300053087 Ga0500643_000043 Ga0500643_000043_151865_152311 148
322 3300053088 Ga0500644_0000935 Ga0500644_0000935_2389_2835 148
323 3300053088 Ga0500644_0003942 Ga0500644_0003942_700_1146 148
324 3300053090 Ga0500646_0000290 Ga0500646_0000290_7622_8071 148
325 3300053092 Ga0500583_0017248 Ga0500583_0017248_795_1244 148
326 3300053098 Ga0500650_0000001 Ga0500650_0000001_406375_406824 148
327 3300053104 Ga0500556_0001227 Ga0500556_0001227_11388_11837 148
328 3300053108 Ga0500562_000002 Ga0500562_000002_827906_828355 148
329 3300053108 Ga0500562_002309 Ga0500562_002309_1242_1691 148
330 3300053118 Ga0500594_0000001 Ga0500594_0000001_1067453_1067902 148
331 3300053118 Ga0500594_0002594 Ga0500594_0002594_1088_1534 148
332 3300053123 Ga0500614_000001 Ga0500614_000001_315564_316010 148
333 3300053129 Ga0500628_000012 Ga0500628_000012_19686_20132 148
334 3300053129 Ga0500628_017303 Ga0500628_017303_592_1038 148
335 3300053133 Ga0500655_000436 Ga0500655_000436_288_737 148
336 3300053137 Ga0500561_0000001 Ga0500561_0000001_620770_621216 148
337 3300053142 Ga0500577_0000427 Ga0500577_0000427_4338_4784 148
338 3300053142 Ga0500577_0004394 Ga0500577_0004394_1216_1665 148
339 3300053143 Ga0500579_005181 Ga0500579_005181_1485_1934 148
340 3300053156 Ga0500622_0078098 Ga0500622_0078098_383_829 148
341 3300053722 Ga0500649_000013 Ga0500649_000013_63570_64016 148
342 3300053724 Ga0500570_000005 Ga0500570_000005_96215_96661 148
343 3300053727 Ga0500611_000355 Ga0500611_000355_2271_2717 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

22

162

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bes-assembly2.cif.gz_C structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. 0.9752 1 146
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9711 1 147
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9683 2 147
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9669 2 146
4em8-assembly1.cif.gz_B the structure of ribose 5-phosphate isomerase b from anaplasma phagocytophilum 0.9667 2 144
ID Description Score Start End Superfamily
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9746 1 146 3.40.1400.10
4em8B00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9667 2 144 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9665 2 146 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.963 2 147 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9623 1 148 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A431HH15-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.991 1 148 GO:0005975
GO:0016861
AF-A0A1F7GAM8-F1-model_v4 Ribose-5-phosphate isomerase 0.9855 1 145 GO:0004751
GO:0009052
GO:0019316
AF-A0A521Z8S9-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9853 1 147 GO:0004751
GO:0009052
GO:0019316
AF-A0A3A4ULU5-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9852 1 147 GO:0004751
GO:0009052
GO:0019316
AF-A0A2N6A0Z4-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9847 1 145 GO:0004751
GO:0009052
GO:0019316

Feature Viewer

pLDDT pTM Quality
96.96 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map