F415504

General Info

Members Datasets Scaffolds Average Seq Length
343 186 686 516

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10021415|Ga0070717_100214152
Length 531
Sequence MKVRMSAALAPETQPPLDPPQVNPWIVAVAVMFATFMEVLDTTVVNVSLPHIAGSLSASVDEAAWALTSYLVANAIILPMTGWLANFFGRKRTLMTAIVGFTAASVLCGSATSLPMLIFFRIVQGATGGALQPLSQAVMLEAFPPKDRGKAMAFWGLGIVVAPMLGPVLGGWLTDNLSWRWVFYINLPVGLASIIMARMFIFDPPYIRRSRAGIDYWGIGFLAVGVGALQVVLDKGQEEDWFASNWMFALAVIAGIAIIAFVVRELKTRDPVVHLRVFKERTYAAGVFLMTVLGFVLYGSLLLLPILLQTLLGYPALNAGMAMAPRGLGSFLMMPLVGTILGKFDPRKVLAVGLVGASWTLFALSRLNLNAGYWDIFWPQFIQGAALAMLFVPLTTATMDPIPKEEMGNATSMFNLMRNMGGSVGIAAATTYLFRRQQYHTHLLGARVNPFSPQTWAFLRGAQQNMIAHGSDPTTAMNQAYGSIWGVVQRQASMQAFVDTFQFMSVVFLLMLPLLLVMRKPKHQGRPAAMH

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 0
Rhizoplane 0.58
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10021415 3300006028 Bacteria 5094
2 Ga0065715_10017418 3300005293 Bacteria 1985
3 Ga0070658_10017628 3300005327 Bacteria 5712
4 Ga0070676_10018793 3300005328 Bacteria 3835
5 Ga0070683_100000026 3300005329 Bacteria 172308
6 Ga0070683_100067881 3300005329 Bacteria 3321
7 Ga0070690_100037422 3300005330 Bacteria 3058
8 Ga0070690_100084310 3300005330 Bacteria 2083
9 Ga0070660_100004231 3300005339 Bacteria 9912
10 Ga0070689_100025651 3300005340 Bacteria 4430
11 Ga0070689_100042597 3300005340 Bacteria 3486
12 Ga0070689_100049464 3300005340 Bacteria 3246
13 Ga0070687_100002717 3300005343 Bacteria 6701
14 Ga0070687_100009964 3300005343 Bacteria 4089
15 Ga0070692_10001997 3300005345 Bacteria 7735
16 Ga0070669_100018377 3300005353 Bacteria 4996
17 Ga0070675_100008302 3300005354 Bacteria 8057
18 Ga0070675_100077919 3300005354 Bacteria 2760
19 Ga0070671_100002840 3300005355 Bacteria 13454
20 Ga0070671_100015604 3300005355 Bacteria 6137
21 Ga0070674_100009653 3300005356 Bacteria 5788
22 Ga0070673_100019887 3300005364 Bacteria 4830
23 Ga0070673_100059048 3300005364 Bacteria 3035
24 Ga0070673_100136805 3300005364 Bacteria 2063
25 Ga0070688_100045556 3300005365 Bacteria 2711
26 Ga0070688_100056570 3300005365 Bacteria 2464
27 Ga0070667_100024324 3300005367 Bacteria 5031
28 Ga0070709_10011442 3300005434 Bacteria 4946
29 Ga0070701_10022129 3300005438 Bacteria 3044
30 Ga0070705_100000892 3300005440 Bacteria 16654
31 Ga0070700_100001458 3300005441 Bacteria 11756
32 Ga0070700_100010861 3300005441 Bacteria 5034
33 Ga0070700_100077626 3300005441 Bacteria 2136
34 Ga0070694_100000976 3300005444 Bacteria 16231
35 Ga0070708_100138598 3300005445 Unclassified 2255
36 Ga0070663_100053449 3300005455 Bacteria 2883
37 Ga0070678_100185690 3300005456 Bacteria 1706
38 Ga0070662_100020542 3300005457 Bacteria 4498
39 Ga0070681_10009924 3300005458 Bacteria 9383
40 Ga0068867_100000222 3300005459 Bacteria 37537
41 Ga0068867_100013794 3300005459 Bacteria 5722
42 Ga0070685_10029561 3300005466 Bacteria 3045
43 Ga0070706_100006243 3300005467 Bacteria 11268
44 Ga0070706_100013769 3300005467 Bacteria 7480
45 Ga0070707_100001342 3300005468 Bacteria 24199
46 Ga0070707_100003317 3300005468 Bacteria 15200
47 Ga0070698_100003090 3300005471 Bacteria 18346
48 Ga0070698_100006173 3300005471 Bacteria 13049
49 Ga0070698_100008092 3300005471 Bacteria 11370
50 Ga0070698_100020003 3300005471 Bacteria 7018
51 Ga0070699_100000868 3300005518 Bacteria 28150
52 Ga0070699_100001619 3300005518 Bacteria 20514
53 Ga0070699_100005576 3300005518 Bacteria 11039
54 Ga0070699_100008613 3300005518 Bacteria 8840
55 Ga0070699_100183535 3300005518 Bacteria 1857
56 Ga0070684_100000052 3300005535 Bacteria 77818
57 Ga0070684_100040920 3300005535 Bacteria 3993
58 Ga0070697_100107781 3300005536 Bacteria 2318
59 Ga0070672_100002667 3300005543 Bacteria 11408
60 Ga0070672_100113054 3300005543 Bacteria 2216
61 Ga0070686_100000977 3300005544 Bacteria 16467
62 Ga0070695_100000255 3300005545 Bacteria 26665
63 Ga0070695_100049106 3300005545 Bacteria 2700
64 Ga0070696_100001147 3300005546 Bacteria 17178
65 Ga0070696_100007261 3300005546 Bacteria 7397
66 Ga0070696_100015111 3300005546 Bacteria 5183
67 Ga0070665_100002974 3300005548 Bacteria 18312
68 Ga0070665_100006522 3300005548 Bacteria 11860
69 Ga0070704_100001231 3300005549 Bacteria 13483
70 Ga0070704_100073463 3300005549 Bacteria 2491
71 Ga0068855_100027775 3300005563 Bacteria 6770
72 Ga0068857_100015171 3300005577 Bacteria 6722
73 Ga0068854_100005596 3300005578 Bacteria 7940
74 Ga0068859_100003008 3300005617 Bacteria 17092
75 Ga0068859_100016398 3300005617 Bacteria 7441
76 Ga0068859_100123392 3300005617 Bacteria 2657
77 Ga0068864_100057372 3300005618 Bacteria 3364
78 Ga0068864_100190306 3300005618 Bacteria 1881
79 Ga0068866_10073277 3300005718 Bacteria 1817
80 Ga0068861_100003182 3300005719 Bacteria 10862
81 Ga0068870_10002866 3300005840 Bacteria 7257
82 Ga0068863_100011829 3300005841 Bacteria 8434
83 Ga0068863_100034346 3300005841 Bacteria 4832
84 Ga0068858_100013977 3300005842 Bacteria 7574
85 Ga0068858_100042987 3300005842 Bacteria 4190
86 Ga0068858_100090423 3300005842 Bacteria 2849
87 Ga0068860_100037727 3300005843 Bacteria 4624
88 Ga0068862_100007800 3300005844 Bacteria 8853
89 Ga0068862_100034358 3300005844 Bacteria 4289
90 Ga0075368_10018335 3300006042 Bacteria 2629
91 Ga0075364_10001115 3300006051 Bacteria 14338
92 Ga0075364_10005958 3300006051 Bacteria 7128
93 Ga0075362_10001884 3300006177 Bacteria 6878
94 Ga0075362_10023930 3300006177 Bacteria 2587
95 Ga0075367_10014687 3300006178 Bacteria 4240
96 Ga0075367_10023833 3300006178 Bacteria 3448
97 Ga0075367_10033623 3300006178 Bacteria 2957
98 Ga0075367_10061216 3300006178 Bacteria 2246
99 Ga0075366_10002498 3300006195 Bacteria 9438
100 Ga0075370_10003032 3300006353 Bacteria 7918
101 Ga0075428_100054775 3300006844 Bacteria 4370
102 Ga0075428_100240273 3300006844 Bacteria 1954
103 Ga0075430_100051608 3300006846 Bacteria 3465
104 Ga0075431_100041768 3300006847 Unclassified 4729
105 Ga0075431_100101911 3300006847 Bacteria 2962
106 Ga0075433_10069955 3300006852 Bacteria 3083
107 Ga0075433_10077417 3300006852 Bacteria 2929
108 Ga0075433_10127726 3300006852 Bacteria 2258
109 Ga0075433_10167317 3300006852 Bacteria 1956
110 Ga0075434_100000355 3300006871 Bacteria 33172
111 Ga0075434_100004381 3300006871 Bacteria 12718
112 Ga0075434_100018301 3300006871 Bacteria 6765
113 Ga0075434_100018738 3300006871 Bacteria 6690
114 Ga0075434_100096295 3300006871 Bacteria 2965
115 Ga0075434_100116289 3300006871 Bacteria 2687
116 Ga0075434_100260646 3300006871 Bacteria 1752
117 Ga0075429_100018741 3300006880 Bacteria 5993
118 Ga0075429_100021766 3300006880 Bacteria 5559
119 Ga0075429_100069705 3300006880 Unclassified 3061
120 Ga0068865_100010084 3300006881 Bacteria 5877
121 Ga0075436_100004736 3300006914 Bacteria 9333
122 Ga0075436_100012239 3300006914 Bacteria 5880
123 Ga0075436_100013012 3300006914 Bacteria 5704
124 Ga0075436_100015337 3300006914 Bacteria 5249
125 Ga0075436_100081355 3300006914 Bacteria 2245
126 Ga0097620_100003008 3300006931 Bacteria 17092
127 Ga0097620_100016401 3300006931 Bacteria 7441
128 Ga0097620_100123389 3300006931 Bacteria 2657
129 Ga0075435_100000013 3300007076 Bacteria 106345
130 Ga0075435_100002847 3300007076 Bacteria 11580
131 Ga0075435_100007023 3300007076 Bacteria 7992
132 Ga0075435_100022270 3300007076 Bacteria 4887
133 Ga0075435_100046857 3300007076 Bacteria 3469
134 Ga0075435_100103051 3300007076 Bacteria 2366
135 Ga0105240_10006160 3300009093 Bacteria 17682
136 Ga0105240_10304719 3300009093 Bacteria 1821
137 Ga0111539_10002917 3300009094 Bacteria 22687
138 Ga0111539_10012743 3300009094 Bacteria 10527
139 Ga0111539_10122934 3300009094 Bacteria 3042
140 Ga0114129_10000549 3300009147 Bacteria 45986
141 Ga0114129_10000589 3300009147 Bacteria 44910
142 Ga0114129_10009989 3300009147 Bacteria 13527
143 Ga0114129_10015097 3300009147 Bacteria 10991
144 Ga0114129_10015148 3300009147 Bacteria 10976
145 Ga0114129_10034530 3300009147 Bacteria 7144
146 Ga0114129_10048746 3300009147 Bacteria 5952
147 Ga0114129_10057567 3300009147 Bacteria 5439
148 Ga0114129_10287597 3300009147 Bacteria 2195
149 Ga0105243_10081035 3300009148 Bacteria 2649
150 Ga0105241_10057412 3300009174 Bacteria 2986
151 Ga0105242_10026342 3300009176 Bacteria 4608
152 Ga0105248_10039262 3300009177 Bacteria 5301
153 Ga0105248_10161389 3300009177 Bacteria 2528
154 Ga0105237_10024019 3300009545 Bacteria 6236
155 Ga0105237_10123913 3300009545 Bacteria 2579
156 Ga0105249_10028301 3300009553 Bacteria 5059
157 Ga0105239_10087825 3300010375 Unclassified 3428
158 Ga0157369_10013388 3300013105 Bacteria 9277
159 Ga0157369_10032654 3300013105 Bacteria 5722
160 Ga0157369_10292563 3300013105 Bacteria 1695
161 Ga0163162_10013730 3300013306 Bacteria 7911
162 Ga0157375_10001933 3300013308 Bacteria 17828
163 Ga0157375_10133408 3300013308 Bacteria 2605
164 Ga0157375_10249786 3300013308 Bacteria 1934
165 Ga0163163_10083743 3300014325 Bacteria 3195
166 Ga0157377_10012243 3300014745 Bacteria 4307
167 Ga0157377_10051723 3300014745 Bacteria 2318
168 Ga0157376_10019502 3300014969 Bacteria 5229
169 Ga0207692_10043338 3300025898 Bacteria 2239
170 Ga0207680_10006599 3300025903 Bacteria 5625
171 Ga0207680_10063745 3300025903 Bacteria 2257
172 Ga0207645_10025186 3300025907 Bacteria 3851
173 Ga0207643_10010672 3300025908 Bacteria 4950
174 Ga0207705_10025560 3300025909 Bacteria 4213
175 Ga0207684_10001931 3300025910 Bacteria 21489
176 Ga0207684_10190629 3300025910 Bacteria 1768
177 Ga0207662_10002199 3300025918 Bacteria 9718
178 Ga0207662_10012500 3300025918 Bacteria 4727
179 Ga0207657_10001598 3300025919 Bacteria 24352
180 Ga0207652_10060575 3300025921 Bacteria 3265
181 Ga0207652_10189190 3300025921 Bacteria 1851
182 Ga0207646_10001192 3300025922 Bacteria 32725
183 Ga0207681_10013997 3300025923 Bacteria 4972
184 Ga0207659_10000180 3300025926 Bacteria 37729
185 Ga0207659_10029771 3300025926 Bacteria 3724
186 Ga0207664_10074046 3300025929 Bacteria 2750
187 Ga0207664_10130140 3300025929 Bacteria 2118
188 Ga0207644_10005654 3300025931 Bacteria 8140
189 Ga0207706_10021107 3300025933 Bacteria 5850
190 Ga0207706_10051155 3300025933 Bacteria 3649
191 Ga0207706_10164410 3300025933 Bacteria 1950
192 Ga0207686_10016235 3300025934 Bacteria 4175
193 Ga0207686_10091608 3300025934 Bacteria 2008
194 Ga0207670_10020317 3300025936 Bacteria 4078
195 Ga0207670_10021491 3300025936 Bacteria 3982
196 Ga0207704_10070160 3300025938 Bacteria 2218
197 Ga0207665_10051468 3300025939 Bacteria 2772
198 Ga0207691_10012936 3300025940 Bacteria 7992
199 Ga0207691_10062192 3300025940 Bacteria 3389
200 Ga0207711_10123024 3300025941 Bacteria 2318
201 Ga0207661_10000003 3300025944 Bacteria 611941
202 Ga0207667_10063397 3300025949 Bacteria 3862
203 Ga0207640_10013536 3300025981 Bacteria 4681
204 Ga0207658_10056098 3300025986 Bacteria 2922
205 Ga0207703_10013951 3300026035 Bacteria 6263
206 Ga0207703_10032846 3300026035 Bacteria 4110
207 Ga0207703_10152342 3300026035 Bacteria 2017
208 Ga0207678_10021838 3300026067 Bacteria 5613
209 Ga0207708_10004358 3300026075 Bacteria 10433
210 Ga0207708_10042082 3300026075 Bacteria 3483
211 Ga0207641_10009471 3300026088 Bacteria 8026
212 Ga0207648_10001673 3300026089 Bacteria 24273
213 Ga0207648_10002717 3300026089 Bacteria 18802
214 Ga0207676_10045298 3300026095 Bacteria 3398
215 Ga0207674_10021633 3300026116 Bacteria 6925
216 Ga0207675_100000990 3300026118 Bacteria 28136
217 Ga0207683_10093842 3300026121 Bacteria 2674
218 Ga0207683_10110925 3300026121 Bacteria 2456
219 Ga0207683_10127047 3300026121 Bacteria 2292
220 Ga0209971_1008340 3300027682 Bacteria 2455
221 Ga0207428_10000300 3300027907 Bacteria 65308
222 Ga0207428_10001344 3300027907 Bacteria 26177
223 Ga0207428_10102132 3300027907 Bacteria 2214
224 Ga0268266_10008176 3300028379 Bacteria 9333
225 Ga0268266_10016566 3300028379 Bacteria 6297
226 Ga0268265_10000618 3300028380 Bacteria 35420
227 Ga0268265_10035364 3300028380 Bacteria 3649
228 Ga0268265_10076199 3300028380 Bacteria 2630
229 Ga0268264_10080994 3300028381 Bacteria 2774
230 Ga0265316_10039147 3300031344 Bacteria 3810
231 Ga0373958_0005427 3300034819 Bacteria 1938
232 Ga0373938_0000165 3300034957 Bacteria 9614
233 Ga0373940_0002621 3300035088 Bacteria 3531
234 Ga0373951_0001039 3300035091 Bacteria 7465
235 Ga0373932_0006591 3300035112 Bacteria 2748
236 Ga0373941_0000980 3300035115 Bacteria 5915
237 Ga0373960_0000066 3300035121 Bacteria 14802
238 Ga0373961_0000930 3300035241 Bacteria 9765
239 Ga0373962_0011480 3300035242 Bacteria 2221
240 Ga0373931_0000370 3300035691 Bacteria 18463
241 Ga0373937_0222421 3300036401 Bacteria 1777
242 Ga0451576_0001276 3300045051 Bacteria 43940
243 Ga0451576_0017531 3300045051 Bacteria 7872
244 Ga0451576_0045899 3300045051 Bacteria 4600
245 Ga0451576_0078339 3300045051 Bacteria 3440
246 Ga0495651_0046423 3300046462 Bacteria 3361
247 Ga0495580_0009623 3300046472 Bacteria 7589
248 Ga0495584_0037283 3300046491 Bacteria 2456
249 Ga0495642_0040003 3300046528 Bacteria 1903
250 Ga0495621_0022058 3300046539 Bacteria 2106
251 Ga0495645_0014533 3300046543 Bacteria 5588
252 Ga0495667_0072468 3300046559 Bacteria 2245
253 Ga0495659_0002876 3300046664 Bacteria 5524
254 Ga0495659_0007959 3300046664 Bacteria 3364
255 Ga0495659_0034379 3300046664 Bacteria 1782
256 Ga0495588_0022565 3300046674 Bacteria 3111
257 Ga0495623_0016549 3300046679 Bacteria 4764
258 Ga0495647_0011560 3300046681 Bacteria 3027
259 Ga0495658_0017711 3300046683 Bacteria 3687
260 Ga0495604_0020370 3300047317 Bacteria 5298
261 Ga0495604_0143360 3300047317 Bacteria 1705
262 Ga0495674_0047446 3300047319 Bacteria 3809
263 Ga0495674_0226568 3300047319 Bacteria 1544
264 Ga0495675_0007812 3300047444 Bacteria 6603
265 Ga0495684_0013125 3300047471 Bacteria 6394
266 Ga0496106_0046898 3300048909 Bacteria 3250
267 Ga0496112_0068482 3300048915 Bacteria 3505
268 Ga0501031_0025087 3300049568 Bacteria 3888
269 Ga0501033_0002128 3300049570 Bacteria 17128
270 Ga0501034_0168304 3300049571 Bacteria 2159
271 Ga0501036_0042412 3300049572 Bacteria 3852
272 Ga0501037_0014748 3300049573 Bacteria 5748
273 Ga0501038_0004331 3300049574 Bacteria 13198
274 Ga0501043_0074276 3300049579 Bacteria 2670
275 Ga0501046_0013815 3300049580 Bacteria 6822
276 Ga0501046_0024725 3300049580 Bacteria 4922
277 Ga0501047_0043423 3300049581 Bacteria 4342
278 Ga0501047_0088946 3300049581 Bacteria 2965
279 Ga0501048_0000883 3300049582 Bacteria 22154
280 Ga0501048_0014944 3300049582 Bacteria 5742
281 Ga0501069_0004221 3300049585 Bacteria 7422
282 Ga0501073_0042174 3300049589 Bacteria 3221
283 Ga0501079_0006071 3300049741 Bacteria 9054
284 Ga0501079_0019252 3300049741 Bacteria 5213
285 Ga0501080_0021880 3300049742 Bacteria 5921
286 Ga0501080_0079416 3300049742 Bacteria 3050
287 Ga0501083_0006518 3300049744 Bacteria 8276
288 Ga0501083_0064709 3300049744 Bacteria 2436
289 Ga0501035_0028999 3300049822 Bacteria 5048
290 Ga0501044_0169616 3300049823 Bacteria 2154
291 nmdc:mga00v17_2564_c1 3300050491 Bacteria 9327
292 nmdc:mga00v17_28149_c1 3300050491 Bacteria 3290
293 nmdc:mga0k408_14614_c1 3300050493 Bacteria 4329
294 nmdc:mga0k408_702_c1 3300050493 Bacteria 18324
295 nmdc:mga06z11_1728_c1 3300050494 Bacteria 8212
296 nmdc:mga06z11_19969_c1 3300050494 Bacteria 3090
297 nmdc:mga06z11_24427_c1 3300050494 Bacteria 2851
298 nmdc:mga07m45_3738_c1 3300050496 Bacteria 7366
299 nmdc:mga05p37_16706_c1 3300050507 Bacteria 8845
300 nmdc:mga05p37_237691_c1 3300050507 Bacteria 2192
301 nmdc:mga05p37_26420_c1 3300050507 Bacteria 7062
302 nmdc:mga05p37_308915_c1 3300050507 Bacteria 1875
303 nmdc:mga05p37_32281_c1 3300050507 Bacteria 6403
304 nmdc:mga05p37_63165_c1 3300050507 Bacteria 4557
305 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
306 nmdc:mga05p37_7173_c1 3300050507 Bacteria 13142
307 nmdc:mga05p37_72192_c1 3300050507 Bacteria 4247
308 nmdc:mga05p37_7398_c1 3300050507 Bacteria 12955
309 nmdc:mga09592_102558_c1 3300050508 Unclassified 2451
310 nmdc:mga09592_202701_c1 3300050508 Bacteria 1718
311 nmdc:mga06r32_3026_c1 3300050510 Bacteria 15061
312 nmdc:mga08y16_15366_c1 3300050511 Bacteria 8050
313 nmdc:mga08y16_251_c1 3300050511 Bacteria 48220
314 nmdc:mga08y16_28199_c1 3300050511 Bacteria 5919
315 nmdc:mga08y16_297493_c1 3300050511 Bacteria 1664
316 nmdc:mga08y16_29953_c1 3300050511 Bacteria 5731
317 nmdc:mga0n895_13466_c1 3300050512 Bacteria 7379
318 nmdc:mga0n895_142461_c1 3300050512 Bacteria 2426
319 nmdc:mga0n895_18451_c1 3300050512 Bacteria 6457
320 nmdc:mga0n895_21788_c1 3300050512 Bacteria 5998
321 nmdc:mga0n895_291498_c1 3300050512 Bacteria 1655
322 nmdc:mga0n895_37902_c1 3300050512 Bacteria 4667
323 nmdc:mga0n895_47612_c1 3300050512 Bacteria 4192
324 nmdc:mga0n895_70913_c1 3300050512 Bacteria 3454
325 nmdc:mga0n895_72_c1 3300050512 Bacteria 58012
326 nmdc:mga0rr50_121908_c1 3300050513 Bacteria 2077
327 nmdc:mga0rr50_16032_c1 3300050513 Bacteria 4964
328 nmdc:mga0rr50_22576_c1 3300050513 Bacteria 4322
329 nmdc:mga0rr50_55678_c1 3300050513 Bacteria 2952
330 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
331 nmdc:mga08x19_12525_c1 3300050514 Bacteria 5112
332 nmdc:mga08x19_19173_c1 3300050514 Bacteria 4196
333 nmdc:mga08x19_3526_c1 3300050514 Bacteria 9309
334 nmdc:mga08x19_4432_c1 3300050514 Bacteria 8325
335 nmdc:mga08x19_5582_c1 3300050514 Bacteria 7435
336 nmdc:mga08x19_58052_c1 3300050514 Bacteria 2503
337 nmdc:mga0a205_270947_c1 3300050515 Bacteria 1575
338 nmdc:mga0a205_75195_c1 3300050515 Bacteria 3264
339 nmdc:mga0a205_86542_c1 3300050515 Bacteria 3027
340 nmdc:mga0a205_96250_c1 3300050515 Bacteria 2859
341 nmdc:mga0a205_9824_c1 3300050515 Bacteria 8777
342 Ga0501084_0009038 3300054114 Bacteria 8244
343 Ga0501082_0030731 3300060353 Bacteria 4629
344 Ga0070717_10021415
345 Ga0065715_10017418
346 Ga0070658_10017628
347 Ga0070676_10018793
348 Ga0070683_100000026
349 Ga0070683_100067881
350 Ga0070690_100037422
351 Ga0070690_100084310
352 Ga0070660_100004231
353 Ga0070689_100025651
354 Ga0070689_100042597
355 Ga0070689_100049464
356 Ga0070687_100002717
357 Ga0070687_100009964
358 Ga0070692_10001997
359 Ga0070669_100018377
360 Ga0070675_100008302
361 Ga0070675_100077919
362 Ga0070671_100002840
363 Ga0070671_100015604
364 Ga0070674_100009653
365 Ga0070673_100019887
366 Ga0070673_100059048
367 Ga0070673_100136805
368 Ga0070688_100045556
369 Ga0070688_100056570
370 Ga0070667_100024324
371 Ga0070709_10011442
372 Ga0070701_10022129
373 Ga0070705_100000892
374 Ga0070700_100001458
375 Ga0070700_100010861
376 Ga0070700_100077626
377 Ga0070694_100000976
378 Ga0070708_100138598
379 Ga0070663_100053449
380 Ga0070678_100185690
381 Ga0070662_100020542
382 Ga0070681_10009924
383 Ga0068867_100000222
384 Ga0068867_100013794
385 Ga0070685_10029561
386 Ga0070706_100006243
387 Ga0070706_100013769
388 Ga0070707_100001342
389 Ga0070707_100003317
390 Ga0070698_100003090
391 Ga0070698_100006173
392 Ga0070698_100008092
393 Ga0070698_100020003
394 Ga0070699_100000868
395 Ga0070699_100001619
396 Ga0070699_100005576
397 Ga0070699_100008613
398 Ga0070699_100183535
399 Ga0070684_100000052
400 Ga0070684_100040920
401 Ga0070697_100107781
402 Ga0070672_100002667
403 Ga0070672_100113054
404 Ga0070686_100000977
405 Ga0070695_100000255
406 Ga0070695_100049106
407 Ga0070696_100001147
408 Ga0070696_100007261
409 Ga0070696_100015111
410 Ga0070665_100002974
411 Ga0070665_100006522
412 Ga0070704_100001231
413 Ga0070704_100073463
414 Ga0068855_100027775
415 Ga0068857_100015171
416 Ga0068854_100005596
417 Ga0068859_100003008
418 Ga0068859_100016398
419 Ga0068859_100123392
420 Ga0068864_100057372
421 Ga0068864_100190306
422 Ga0068866_10073277
423 Ga0068861_100003182
424 Ga0068870_10002866
425 Ga0068863_100011829
426 Ga0068863_100034346
427 Ga0068858_100013977
428 Ga0068858_100042987
429 Ga0068858_100090423
430 Ga0068860_100037727
431 Ga0068862_100007800
432 Ga0068862_100034358
433 Ga0075368_10018335
434 Ga0075364_10001115
435 Ga0075364_10005958
436 Ga0075362_10001884
437 Ga0075362_10023930
438 Ga0075367_10014687
439 Ga0075367_10023833
440 Ga0075367_10033623
441 Ga0075367_10061216
442 Ga0075366_10002498
443 Ga0075370_10003032
444 Ga0075428_100054775
445 Ga0075428_100240273
446 Ga0075430_100051608
447 Ga0075431_100041768
448 Ga0075431_100101911
449 Ga0075433_10069955
450 Ga0075433_10077417
451 Ga0075433_10127726
452 Ga0075433_10167317
453 Ga0075434_100000355
454 Ga0075434_100004381
455 Ga0075434_100018301
456 Ga0075434_100018738
457 Ga0075434_100096295
458 Ga0075434_100116289
459 Ga0075434_100260646
460 Ga0075429_100018741
461 Ga0075429_100021766
462 Ga0075429_100069705
463 Ga0068865_100010084
464 Ga0075436_100004736
465 Ga0075436_100012239
466 Ga0075436_100013012
467 Ga0075436_100015337
468 Ga0075436_100081355
469 Ga0097620_100003008
470 Ga0097620_100016401
471 Ga0097620_100123389
472 Ga0075435_100000013
473 Ga0075435_100002847
474 Ga0075435_100007023
475 Ga0075435_100022270
476 Ga0075435_100046857
477 Ga0075435_100103051
478 Ga0105240_10006160
479 Ga0105240_10304719
480 Ga0111539_10002917
481 Ga0111539_10012743
482 Ga0111539_10122934
483 Ga0114129_10000549
484 Ga0114129_10000589
485 Ga0114129_10009989
486 Ga0114129_10015097
487 Ga0114129_10015148
488 Ga0114129_10034530
489 Ga0114129_10048746
490 Ga0114129_10057567
491 Ga0114129_10287597
492 Ga0105243_10081035
493 Ga0105241_10057412
494 Ga0105242_10026342
495 Ga0105248_10039262
496 Ga0105248_10161389
497 Ga0105237_10024019
498 Ga0105237_10123913
499 Ga0105249_10028301
500 Ga0105239_10087825
501 Ga0157369_10013388
502 Ga0157369_10032654
503 Ga0157369_10292563
504 Ga0163162_10013730
505 Ga0157375_10001933
506 Ga0157375_10133408
507 Ga0157375_10249786
508 Ga0163163_10083743
509 Ga0157377_10012243
510 Ga0157377_10051723
511 Ga0157376_10019502
512 Ga0207692_10043338
513 Ga0207680_10006599
514 Ga0207680_10063745
515 Ga0207645_10025186
516 Ga0207643_10010672
517 Ga0207705_10025560
518 Ga0207684_10001931
519 Ga0207684_10190629
520 Ga0207662_10002199
521 Ga0207662_10012500
522 Ga0207657_10001598
523 Ga0207652_10060575
524 Ga0207652_10189190
525 Ga0207646_10001192
526 Ga0207681_10013997
527 Ga0207659_10000180
528 Ga0207659_10029771
529 Ga0207664_10074046
530 Ga0207664_10130140
531 Ga0207644_10005654
532 Ga0207706_10021107
533 Ga0207706_10051155
534 Ga0207706_10164410
535 Ga0207686_10016235
536 Ga0207686_10091608
537 Ga0207670_10020317
538 Ga0207670_10021491
539 Ga0207704_10070160
540 Ga0207665_10051468
541 Ga0207691_10012936
542 Ga0207691_10062192
543 Ga0207711_10123024
544 Ga0207661_10000003
545 Ga0207667_10063397
546 Ga0207640_10013536
547 Ga0207658_10056098
548 Ga0207703_10013951
549 Ga0207703_10032846
550 Ga0207703_10152342
551 Ga0207678_10021838
552 Ga0207708_10004358
553 Ga0207708_10042082
554 Ga0207641_10009471
555 Ga0207648_10001673
556 Ga0207648_10002717
557 Ga0207676_10045298
558 Ga0207674_10021633
559 Ga0207675_100000990
560 Ga0207683_10093842
561 Ga0207683_10110925
562 Ga0207683_10127047
563 Ga0209971_1008340
564 Ga0207428_10000300
565 Ga0207428_10001344
566 Ga0207428_10102132
567 Ga0268266_10008176
568 Ga0268266_10016566
569 Ga0268265_10000618
570 Ga0268265_10035364
571 Ga0268265_10076199
572 Ga0268264_10080994
573 Ga0265316_10039147
574 Ga0373958_0005427
575 Ga0373938_0000165
576 Ga0373940_0002621
577 Ga0373951_0001039
578 Ga0373932_0006591
579 Ga0373941_0000980
580 Ga0373960_0000066
581 Ga0373961_0000930
582 Ga0373962_0011480
583 Ga0373931_0000370
584 Ga0373937_0222421
585 Ga0451576_0001276
586 Ga0451576_0017531
587 Ga0451576_0045899
588 Ga0451576_0078339
589 Ga0495651_0046423
590 Ga0495580_0009623
591 Ga0495584_0037283
592 Ga0495642_0040003
593 Ga0495621_0022058
594 Ga0495645_0014533
595 Ga0495667_0072468
596 Ga0495659_0002876
597 Ga0495659_0007959
598 Ga0495659_0034379
599 Ga0495588_0022565
600 Ga0495623_0016549
601 Ga0495647_0011560
602 Ga0495658_0017711
603 Ga0495604_0020370
604 Ga0495604_0143360
605 Ga0495674_0047446
606 Ga0495674_0226568
607 Ga0495675_0007812
608 Ga0495684_0013125
609 Ga0496106_0046898
610 Ga0496112_0068482
611 Ga0501031_0025087
612 Ga0501033_0002128
613 Ga0501034_0168304
614 Ga0501036_0042412
615 Ga0501037_0014748
616 Ga0501038_0004331
617 Ga0501043_0074276
618 Ga0501046_0013815
619 Ga0501046_0024725
620 Ga0501047_0043423
621 Ga0501047_0088946
622 Ga0501048_0000883
623 Ga0501048_0014944
624 Ga0501069_0004221
625 Ga0501073_0042174
626 Ga0501079_0006071
627 Ga0501079_0019252
628 Ga0501080_0021880
629 Ga0501080_0079416
630 Ga0501083_0006518
631 Ga0501083_0064709
632 Ga0501035_0028999
633 Ga0501044_0169616
634 nmdc:mga00v17_2564_c1
635 nmdc:mga00v17_28149_c1
636 nmdc:mga0k408_14614_c1
637 nmdc:mga0k408_702_c1
638 nmdc:mga06z11_1728_c1
639 nmdc:mga06z11_19969_c1
640 nmdc:mga06z11_24427_c1
641 nmdc:mga07m45_3738_c1
642 nmdc:mga05p37_16706_c1
643 nmdc:mga05p37_237691_c1
644 nmdc:mga05p37_26420_c1
645 nmdc:mga05p37_308915_c1
646 nmdc:mga05p37_32281_c1
647 nmdc:mga05p37_63165_c1
648 nmdc:mga05p37_644_c1
649 nmdc:mga05p37_7173_c1
650 nmdc:mga05p37_72192_c1
651 nmdc:mga05p37_7398_c1
652 nmdc:mga09592_102558_c1
653 nmdc:mga09592_202701_c1
654 nmdc:mga06r32_3026_c1
655 nmdc:mga08y16_15366_c1
656 nmdc:mga08y16_251_c1
657 nmdc:mga08y16_28199_c1
658 nmdc:mga08y16_297493_c1
659 nmdc:mga08y16_29953_c1
660 nmdc:mga0n895_13466_c1
661 nmdc:mga0n895_142461_c1
662 nmdc:mga0n895_18451_c1
663 nmdc:mga0n895_21788_c1
664 nmdc:mga0n895_291498_c1
665 nmdc:mga0n895_37902_c1
666 nmdc:mga0n895_47612_c1
667 nmdc:mga0n895_70913_c1
668 nmdc:mga0n895_72_c1
669 nmdc:mga0rr50_121908_c1
670 nmdc:mga0rr50_16032_c1
671 nmdc:mga0rr50_22576_c1
672 nmdc:mga0rr50_55678_c1
673 nmdc:mga0rr50_9_c1
674 nmdc:mga08x19_12525_c1
675 nmdc:mga08x19_19173_c1
676 nmdc:mga08x19_3526_c1
677 nmdc:mga08x19_4432_c1
678 nmdc:mga08x19_5582_c1
679 nmdc:mga08x19_58052_c1
680 nmdc:mga0a205_270947_c1
681 nmdc:mga0a205_75195_c1
682 nmdc:mga0a205_86542_c1
683 nmdc:mga0a205_96250_c1
684 nmdc:mga0a205_9824_c1
685 Ga0501084_0009038
686 Ga0501082_0030731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

31

426

0.92

PF00083

Sugar_tr

Sugar (and other) transporter

27

208

0.86

PF06609

TRI12

Fungal trichothecene efflux pump (TRI12)

4

494

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.9133 13 423
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8884 11 422
6vs2-assembly1.cif.gz_A protein d 0.8643 11 502
6vs2-assembly1.cif.gz_A protein d 0.8602 11 502
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.856 13 502
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.961 17 205 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9541 11 186 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9495 16 217 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9462 17 205 1.20.1250.20
af_P9WJW9_9_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9453 17 227 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V6RA21-F1-model_v4 EmrB/QacA family drug resistance transporter 0.9635 1 508 GO:0005886
GO:0022857
AF-A0A3M4BB01-F1-model_v4 Drug resistance transporter, EmrB/QacA protein 0.961 11 509 GO:0005886
GO:0022857
AF-C5TC24-F1-model_v4 Drug resistance transporter, EmrB/QacA subfamily 0.9594 27 504 GO:0005886
GO:0022857
AF-A0A5C7MCL8-F1-model_v4 deleted 0.9583 12 513
AF-A0A014DC01-F1-model_v4 deleted 0.9568 13 510

Map