F415363

General Info

Members Datasets Scaffolds Average Seq Length
342 195 684 299

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_340437_c1|nmdc:mga05p37_340437_c1_564_1580
Length 326
Sequence MVLTGRCNNTKNVARIIQLNPAQPPAAKSPKPDWLKVRAPGSPSYLRLKGLMRELNLHTVCEEAQCPNIGECWNHGTATFMILGDVCTRACSYCAVAHGRPGAVDEAEPVRVAEAIKTLALSYVVITSVDRDDLADGGASIFASTIREIRARRPECRAERGVGVPAIEVLIPDFQGNEAALRRVLDAQPDVLNHNTETVPRLYRMARSGGRYARTLELLDRSRRYAPAIPTKTGVMVGLGEEHDELVATFEDLREVGCGILTIGQYLRPSIAHAPMVRYYHPDEFAELKRIALDLGFVHVESGPLVRSSYHAHETADAYERAASLG

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
127 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 5.26
Rhizosphere 92.69
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_340437_c1 3300050507 Bacteria 1769
2 Ga0065712_10178737 3300005290 Bacteria 1197
3 Ga0065715_10089397 3300005293 Bacteria 10567
4 Ga0070676_10014925 3300005328 Bacteria 4275
5 Ga0070676_10068389 3300005328 Bacteria 2126
6 Ga0070690_100052964 3300005330 Bacteria 2595
7 Ga0070670_100143173 3300005331 Bacteria 2067
8 Ga0070670_100170151 3300005331 Bacteria 1889
9 Ga0070677_10011350 3300005333 Bacteria 3071
10 Ga0070666_10024570 3300005335 Bacteria 3926
11 Ga0070669_100017879 3300005353 Bacteria 5062
12 Ga0070669_100368472 3300005353 Unclassified 1169
13 Ga0070675_100000927 3300005354 Bacteria 20868
14 Ga0070675_100015119 3300005354 Bacteria 6096
15 Ga0070675_100030346 3300005354 Bacteria 4365
16 Ga0070675_100163903 3300005354 Bacteria 1913
17 Ga0070671_100018170 3300005355 Bacteria 5709
18 Ga0070671_100050845 3300005355 Bacteria 3447
19 Ga0070674_100076066 3300005356 Bacteria 2386
20 Ga0070673_100090481 3300005364 Bacteria 2500
21 Ga0070688_100043789 3300005365 Bacteria 2759
22 Ga0070688_100099367 3300005365 Bacteria 1916
23 Ga0070667_100011722 3300005367 Bacteria 7244
24 Ga0070667_100244898 3300005367 Bacteria 1602
25 Ga0070709_10010573 3300005434 Bacteria 5115
26 Ga0070709_10023337 3300005434 Unclassified 3630
27 Ga0070709_10052288 3300005434 Bacteria 2567
28 Ga0070709_10068030 3300005434 Bacteria 2289
29 Ga0070713_100003916 3300005436 Bacteria 9880
30 Ga0070710_10251691 3300005437 Bacteria 1136
31 Ga0070701_10003064 3300005438 Bacteria 6549
32 Ga0070705_100025114 3300005440 Bacteria 3226
33 Ga0070694_100004429 3300005444 Bacteria 8446
34 Ga0068867_100095430 3300005459 Bacteria 2262
35 Ga0070685_10260987 3300005466 Bacteria 1152
36 Ga0070706_100313894 3300005467 Bacteria 1462
37 Ga0070706_100426170 3300005467 Bacteria 1235
38 Ga0070707_100034376 3300005468 Bacteria 4835
39 Ga0070707_100060118 3300005468 Unclassified 3644
40 Ga0070698_100459481 3300005471 Bacteria 1209
41 Ga0070699_100001665 3300005518 Bacteria 20284
42 Ga0070699_100005807 3300005518 Bacteria 10796
43 Ga0070679_100113960 3300005530 Bacteria 2689
44 Ga0070697_100017630 3300005536 Bacteria 5623
45 Ga0068853_100299501 3300005539 Bacteria 1486
46 Ga0070672_100004971 3300005543 Bacteria 8756
47 Ga0070672_100383723 3300005543 Bacteria 1202
48 Ga0070686_100001688 3300005544 Bacteria 12341
49 Ga0070686_100171724 3300005544 Bacteria 1534
50 Ga0070695_100018085 3300005545 Bacteria 4279
51 Ga0070695_100059849 3300005545 Bacteria 2468
52 Ga0070696_100000194 3300005546 Bacteria 35764
53 Ga0070696_100006559 3300005546 Bacteria 7767
54 Ga0070665_100007832 3300005548 Bacteria 10837
55 Ga0070665_100008240 3300005548 Bacteria 10546
56 Ga0070665_100022556 3300005548 Bacteria 6336
57 Ga0070665_100082059 3300005548 Bacteria 3229
58 Ga0070704_100072698 3300005549 Bacteria 2503
59 Ga0070704_100089360 3300005549 Bacteria 2291
60 Ga0070664_100032358 3300005564 Bacteria 4374
61 Ga0070664_100176355 3300005564 Bacteria 1898
62 Ga0068854_100016468 3300005578 Bacteria 4929
63 Ga0068854_100324877 3300005578 Bacteria 1252
64 Ga0070702_100201127 3300005615 Bacteria 1319
65 Ga0068859_100179801 3300005617 Bacteria 2198
66 Ga0068864_100137249 3300005618 Bacteria 2203
67 Ga0068861_100006009 3300005719 Bacteria 8251
68 Ga0068863_100025295 3300005841 Bacteria 5659
69 Ga0068858_100001917 3300005842 Bacteria 21216
70 Ga0068858_100013947 3300005842 Bacteria 7579
71 Ga0068858_100084574 3300005842 Bacteria 2951
72 Ga0068858_100475920 3300005842 Bacteria 1205
73 Ga0068860_100173070 3300005843 Bacteria 2086
74 Ga0081455_10034061 3300005937 Bacteria 4568
75 Ga0070716_100055872 3300006173 Bacteria 2261
76 Ga0075367_10010524 3300006178 Bacteria 4861
77 Ga0075366_10260293 3300006195 Bacteria 1059
78 Ga0097621_100147501 3300006237 Bacteria 2015
79 Ga0097621_100179889 3300006237 Bacteria 1827
80 Ga0068871_100002129 3300006358 Bacteria 13417
81 Ga0068871_100003129 3300006358 Bacteria 11356
82 Ga0068871_100028010 3300006358 Bacteria 4412
83 Ga0075428_100094510 3300006844 Bacteria 3259
84 Ga0075430_100134127 3300006846 Bacteria 2063
85 Ga0075433_10094842 3300006852 Bacteria 2641
86 Ga0075433_10145978 3300006852 Bacteria 2103
87 Ga0075434_100000035 3300006871 Bacteria 61439
88 Ga0075434_100003265 3300006871 Bacteria 14496
89 Ga0075434_100013410 3300006871 Bacteria 7799
90 Ga0075434_100137092 3300006871 Bacteria 2466
91 Ga0075434_100317602 3300006871 Bacteria 1578
92 Ga0075434_100405734 3300006871 Bacteria 1384
93 Ga0068865_100103551 3300006881 Bacteria 2088
94 Ga0068865_100197307 3300006881 Bacteria 1560
95 Ga0075436_100005504 3300006914 Bacteria 8710
96 Ga0075436_100018921 3300006914 Bacteria 4716
97 Ga0075436_100027310 3300006914 Bacteria 3929
98 Ga0075436_100030314 3300006914 Bacteria 3724
99 Ga0075436_100174752 3300006914 Bacteria 1517
100 Ga0097620_100179790 3300006931 Bacteria 2198
101 Ga0075435_100000016 3300007076 Bacteria 99722
102 Ga0075435_100003396 3300007076 Bacteria 10792
103 Ga0075435_100023246 3300007076 Bacteria 4790
104 Ga0075435_100214523 3300007076 Bacteria 1633
105 Ga0105240_10040751 3300009093 Bacteria 5936
106 Ga0105240_10051949 3300009093 Bacteria 5155
107 Ga0111539_10059217 3300009094 Bacteria 4543
108 Ga0111539_10425389 3300009094 Bacteria 1547
109 Ga0105245_10198656 3300009098 Bacteria 1925
110 Ga0105245_10817260 3300009098 Bacteria 971
111 Ga0105247_10005882 3300009101 Bacteria 7663
112 Ga0105247_10056142 3300009101 Bacteria 2432
113 Ga0114129_10002166 3300009147 Bacteria 27062
114 Ga0114129_10007300 3300009147 Bacteria 15735
115 Ga0114129_10054523 3300009147 Bacteria 5605
116 Ga0114129_10060516 3300009147 Bacteria 5295
117 Ga0114129_10096031 3300009147 Bacteria 4104
118 Ga0114129_10394689 3300009147 Bacteria 1824
119 Ga0105243_10013355 3300009148 Bacteria 6211
120 Ga0105242_10002987 3300009176 Bacteria 13236
121 Ga0105242_10079954 3300009176 Bacteria 2731
122 Ga0105248_10002117 3300009177 Bacteria 21949
123 Ga0105248_10007632 3300009177 Bacteria 11885
124 Ga0105248_10008538 3300009177 Bacteria 11245
125 Ga0105248_10063024 3300009177 Bacteria 4161
126 Ga0105248_10144961 3300009177 Bacteria 2680
127 Ga0105248_10209528 3300009177 Bacteria 2196
128 Ga0105238_10365320 3300009551 Bacteria 1433
129 Ga0105246_10034676 3300011119 Bacteria 3366
130 Ga0157371_10220408 3300013102 Bacteria 1362
131 Ga0157374_10011136 3300013296 Bacteria 7774
132 Ga0163162_10675791 3300013306 Bacteria 1155
133 Ga0157375_10251203 3300013308 Bacteria 1929
134 Ga0157375_10318001 3300013308 Bacteria 1721
135 Ga0163163_10167546 3300014325 Bacteria 2243
136 Ga0163163_10173720 3300014325 Bacteria 2201
137 Ga0157377_10090613 3300014745 Bacteria 1805
138 Ga0157379_10045562 3300014968 Bacteria 3914
139 Ga0157379_10053785 3300014968 Bacteria 3597
140 Ga0157379_10201498 3300014968 Bacteria 1800
141 Ga0157376_10077442 3300014969 Bacteria 2844
142 Ga0157376_10099451 3300014969 Bacteria 2538
143 Ga0157376_10335539 3300014969 Bacteria 1442
144 Ga0207653_10022710 3300025885 Bacteria 1994
145 Ga0207682_10007802 3300025893 Bacteria 4251
146 Ga0207682_10038841 3300025893 Bacteria 1933
147 Ga0207642_10263550 3300025899 Unclassified 984
148 Ga0207710_10053173 3300025900 Bacteria 1822
149 Ga0207688_10018078 3300025901 Bacteria 3837
150 Ga0207680_10020414 3300025903 Bacteria 3565
151 Ga0207699_10006878 3300025906 Bacteria 5531
152 Ga0207699_10057534 3300025906 Unclassified 2322
153 Ga0207645_10002680 3300025907 Bacteria 13868
154 Ga0207645_10074977 3300025907 Bacteria 2166
155 Ga0207652_10006422 3300025921 Bacteria 9479
156 Ga0207646_10104759 3300025922 Bacteria 2537
157 Ga0207681_10049346 3300025923 Bacteria 2845
158 Ga0207681_10136977 3300025923 Bacteria 1818
159 Ga0207681_10415539 3300025923 Bacteria 1089
160 Ga0207650_10246325 3300025925 Bacteria 1445
161 Ga0207650_10246360 3300025925 Bacteria 1445
162 Ga0207650_10401105 3300025925 Bacteria 1135
163 Ga0207659_10060138 3300025926 Bacteria 2734
164 Ga0207659_10085319 3300025926 Bacteria 2346
165 Ga0207659_10161679 3300025926 Bacteria 1759
166 Ga0207659_10377217 3300025926 Bacteria 1182
167 Ga0207644_10004331 3300025931 Bacteria 9207
168 Ga0207644_10221941 3300025931 Bacteria 1498
169 Ga0207644_10444858 3300025931 Bacteria 1064
170 Ga0207690_10503298 3300025932 Bacteria 980
171 Ga0207686_10065715 3300025934 Bacteria 2314
172 Ga0207686_10112217 3300025934 Bacteria 1841
173 Ga0207686_10175466 3300025934 Bacteria 1515
174 Ga0207670_10045756 3300025936 Bacteria 2903
175 Ga0207670_10119843 3300025936 Bacteria 1911
176 Ga0207669_10185746 3300025937 Bacteria 1495
177 Ga0207665_10119946 3300025939 Bacteria 1857
178 Ga0207691_10018622 3300025940 Bacteria 6580
179 Ga0207691_10342820 3300025940 Bacteria 1279
180 Ga0207711_10026566 3300025941 Bacteria 4858
181 Ga0207711_10049666 3300025941 Bacteria 3591
182 Ga0207711_10076826 3300025941 Bacteria 2909
183 Ga0207711_10272653 3300025941 Bacteria 1557
184 Ga0207711_10273029 3300025941 Bacteria 1556
185 Ga0207689_10058846 3300025942 Bacteria 3161
186 Ga0207689_10064040 3300025942 Bacteria 3025
187 Ga0207667_10124384 3300025949 Bacteria 2657
188 Ga0207651_10011599 3300025960 Bacteria 4941
189 Ga0207651_10452182 3300025960 Bacteria 1102
190 Ga0207640_10267790 3300025981 Bacteria 1335
191 Ga0207658_10033741 3300025986 Bacteria 3652
192 Ga0207703_10002278 3300026035 Bacteria 16726
193 Ga0207703_10098181 3300026035 Bacteria 2476
194 Ga0207703_10274669 3300026035 Bacteria 1528
195 Ga0207708_10202827 3300026075 Bacteria 1583
196 Ga0207641_10001898 3300026088 Bacteria 20063
197 Ga0207641_10381919 3300026088 Bacteria 1349
198 Ga0207648_10012098 3300026089 Bacteria 8093
199 Ga0207648_10017499 3300026089 Bacteria 6518
200 Ga0207676_10167075 3300026095 Bacteria 1913
201 Ga0207675_100063631 3300026118 Bacteria 3447
202 Ga0207675_100130439 3300026118 Bacteria 2383
203 Ga0207675_100371215 3300026118 Bacteria 1405
204 Ga0207683_10050912 3300026121 Bacteria 3628
205 Ga0207683_10059807 3300026121 Bacteria 3347
206 Ga0207428_10020617 3300027907 Bacteria 5596
207 Ga0207428_10058270 3300027907 Bacteria 3065
208 Ga0207428_10271737 3300027907 Bacteria 1260
209 Ga0268266_10006925 3300028379 Bacteria 10315
210 Ga0268266_10051002 3300028379 Bacteria 3551
211 Ga0268266_10235617 3300028379 Bacteria 1687
212 Ga0268265_10169075 3300028380 Bacteria 1866
213 Ga0268264_10143328 3300028381 Bacteria 2133
214 Ga0265314_10012728 3300031711 Bacteria 6837
215 Ga0307410_10013385 3300031852 Bacteria 4785
216 Ga0307410_10114010 3300031852 Bacteria 1960
217 Ga0307410_10232495 3300031852 Bacteria 1424
218 Ga0307407_10070530 3300031903 Bacteria 2077
219 Ga0307412_10127868 3300031911 Bacteria 1840
220 Ga0307412_10173820 3300031911 Bacteria 1613
221 Ga0307409_100004412 3300031995 Bacteria 7900
222 Ga0307409_100027239 3300031995 Bacteria 4047
223 Ga0307409_100774864 3300031995 Bacteria 965
224 Ga0307416_100459146 3300032002 Bacteria 1328
225 Ga0307414_10015440 3300032004 Bacteria 4610
226 Ga0307414_10053882 3300032004 Bacteria 2808
227 Ga0307411_10204794 3300032005 Bacteria 1518
228 Ga0307411_10373722 3300032005 Bacteria 1170
229 Ga0307411_10439440 3300032005 Bacteria 1088
230 Ga0373930_0001490 3300034816 Bacteria 3498
231 Ga0373958_0013890 3300034819 Bacteria 1401
232 Ga0373959_0002314 3300034820 Bacteria 3031
233 Ga0373951_0000318 3300035091 Bacteria 15075
234 Ga0373952_0001048 3300035092 Bacteria 5041
235 Ga0373939_0001353 3300035114 Bacteria 5938
236 Ga0373941_0001475 3300035115 Bacteria 4971
237 Ga0373941_0017864 3300035115 Bacteria 1951
238 Ga0373960_0001807 3300035121 Bacteria 4792
239 Ga0373942_0002138 3300035207 Bacteria 4893
240 Ga0373961_0001320 3300035241 Bacteria 7514
241 Ga0373962_0001029 3300035242 Bacteria 6456
242 Ga0373937_0092651 3300036401 Bacteria 2801
243 Ga0373937_0154966 3300036401 Bacteria 2147
244 Ga0373937_0853407 3300036401 Bacteria 859
245 Ga0395899_0320487 3300037312 Bacteria 1044
246 Ga0395905_0020116 3300037471 Bacteria 6324
247 Ga0436364_0223293 3300037853 Unclassified 4473
248 Ga0436365_1924632 3300039437 Bacteria 1336
249 Ga0436362_0144649 3300039453 Bacteria 4996
250 Ga0450894_001618 3300042131 Bacteria 3183
251 Ga0450918_009427 3300042531 Bacteria 1712
252 Ga0451577_0000818 3300042876 Bacteria 46723
253 Ga0453683_0019117 3300044673 Bacteria 4389
254 Ga0453683_0116812 3300044673 Bacteria 1679
255 Ga0466963_0054829 3300044694 Bacteria 2651
256 Ga0453684_0000803 3300044712 Bacteria 107106
257 Ga0451576_0006949 3300045051 Bacteria 13705
258 Ga0451576_0034542 3300045051 Bacteria 5369
259 Ga0495664_0306738 3300046477 Bacteria 958
260 Ga0495618_0124786 3300046514 Bacteria 1649
261 Ga0495665_0242970 3300046531 Bacteria 928
262 Ga0495640_0102592 3300046533 Bacteria 1877
263 Ga0495621_0149454 3300046539 Bacteria 918
264 Ga0495634_0099528 3300046642 Bacteria 1880
265 Ga0495657_0067730 3300046675 Bacteria 2342
266 Ga0495658_0113440 3300046683 Bacteria 1632
267 Ga0495669_0007170 3300046684 Bacteria 4671
268 Ga0495613_0002008 3300046689 Bacteria 15446
269 Ga0495604_0014988 3300047317 Bacteria 6184
270 Ga0495674_0026541 3300047319 Bacteria 5299
271 Ga0495674_0134807 3300047319 Bacteria 2079
272 Ga0495677_0083733 3300047445 Bacteria 1198
273 Ga0495684_0000131 3300047471 Bacteria 54636
274 Ga0496102_0086375 3300048905 Unclassified 2897
275 Ga0496102_0375149 3300048905 Bacteria 1339
276 Ga0496103_0149338 3300048906 Bacteria 1497
277 Ga0496104_0347386 3300048907 Bacteria 1396
278 Ga0496105_0051194 3300048908 Bacteria 3412
279 Ga0496105_0105718 3300048908 Bacteria 2324
280 Ga0496105_0408760 3300048908 Bacteria 1076
281 Ga0496108_0056225 3300048911 Bacteria 3305
282 Ga0496109_0102505 3300048912 Bacteria 2656
283 Ga0496109_0314806 3300048912 Bacteria 1477
284 Ga0496110_0189400 3300048913 Bacteria 1868
285 Ga0496112_0011607 3300048915 Bacteria 8056
286 Ga0496112_0117816 3300048915 Bacteria 2626
287 Ga0496112_0269052 3300048915 Bacteria 1652
288 Ga0496112_0295737 3300048915 Bacteria 1565
289 Ga0496113_0159395 3300048916 Bacteria 1783
290 Ga0496113_0159456 3300048916 Bacteria 1783
291 Ga0496114_0448353 3300048917 Bacteria 1143
292 Ga0501034_0009130 3300049571 Bacteria 10410
293 Ga0501041_0224915 3300049577 Bacteria 1178
294 Ga0501047_0169935 3300049581 Bacteria 2049
295 Ga0501072_0030288 3300049588 Bacteria 4232
296 Ga0501073_0027386 3300049589 Bacteria 4076
297 Ga0501076_0236345 3300049592 Bacteria 1494
298 Ga0501079_0229595 3300049741 Bacteria 1450
299 Ga0501081_0463691 3300049743 Bacteria 942
300 Ga0501045_0431217 3300049824 Bacteria 980
301 nmdc:mga00v17_276074_c1 3300050491 Bacteria 1091
302 nmdc:mga07m45_45579_c2 3300050496 Bacteria 1326
303 nmdc:mga05p37_119817_c1 3300050507 Bacteria 3233
304 nmdc:mga05p37_229797_c1 3300050507 Bacteria 2236
305 nmdc:mga05p37_371566_c1 3300050507 Bacteria 1678
306 nmdc:mga05p37_39241_c1 3300050507 Bacteria 5812
307 nmdc:mga05p37_53679_c1 3300050507 Bacteria 4957
308 nmdc:mga05p37_7616_c1 3300050507 Bacteria 12779
309 nmdc:mga08y16_24041_c1 3300050511 Bacteria 6434
310 nmdc:mga08y16_35322_c1 3300050511 Bacteria 5249
311 nmdc:mga0n895_115638_c1 3300050512 Bacteria 2701
312 nmdc:mga0n895_115793_c1 3300050512 Bacteria 2699
313 nmdc:mga0n895_309_c1 3300050512 Bacteria 32356
314 nmdc:mga0n895_409355_c1 3300050512 Bacteria 1371
315 nmdc:mga0n895_555_c1 3300050512 Bacteria 25552
316 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
317 nmdc:mga0rr50_423032_c1 3300050513 Bacteria 1127
318 nmdc:mga0rr50_53469_c1 3300050513 Bacteria 3004
319 nmdc:mga0rr50_736_c1 3300050513 Bacteria 17662
320 nmdc:mga0rr50_81055_c1 3300050513 Bacteria 2503
321 nmdc:mga0rr50_83845_c1 3300050513 Bacteria 2466
322 nmdc:mga08x19_11212_c1 3300050514 Bacteria 5395
323 nmdc:mga08x19_161690_c1 3300050514 Bacteria 1521
324 nmdc:mga08x19_23460_c1 3300050514 Bacteria 3827
325 nmdc:mga08x19_71647_c1 3300050514 Bacteria 2260
326 nmdc:mga08x19_97_c1 3300050514 Bacteria 77512
327 nmdc:mga0a205_126428_c1 3300050515 Bacteria 2456
328 nmdc:mga0a205_144_c1 3300050515 Bacteria 21588
329 nmdc:mga0a205_2475_c1 3300050515 Bacteria 16288
330 Ga0495601_0008562 3300053077 Bacteria 6042
331 Ga0495601_0181839 3300053077 Bacteria 1375
332 Ga0495595_0017684 3300053084 Bacteria 3070
333 Ga0495619_0000953 3300053085 Bacteria 18948
334 Ga0495619_0067915 3300053085 Bacteria 2381
335 Ga0500568_0012049 3300053139 Bacteria 3986
336 Ga0590071_000758 3300059421 Bacteria 9033
337 Ga0590075_000352 3300059424 Bacteria 12811
338 Ga0590075_000883 3300059424 Bacteria 7864
339 Ga0590077_000223 3300059426 Bacteria 16325
340 Ga0590077_000904 3300059426 Bacteria 7574
341 Ga0501082_0191536 3300060353 Bacteria 1779
342 Ga0530510_0036385 3300061734 Bacteria 3549
343 nmdc:mga05p37_340437_c1
344 Ga0065712_10178737
345 Ga0065715_10089397
346 Ga0070676_10014925
347 Ga0070676_10068389
348 Ga0070690_100052964
349 Ga0070670_100143173
350 Ga0070670_100170151
351 Ga0070677_10011350
352 Ga0070666_10024570
353 Ga0070669_100017879
354 Ga0070669_100368472
355 Ga0070675_100000927
356 Ga0070675_100015119
357 Ga0070675_100030346
358 Ga0070675_100163903
359 Ga0070671_100018170
360 Ga0070671_100050845
361 Ga0070674_100076066
362 Ga0070673_100090481
363 Ga0070688_100043789
364 Ga0070688_100099367
365 Ga0070667_100011722
366 Ga0070667_100244898
367 Ga0070709_10010573
368 Ga0070709_10023337
369 Ga0070709_10052288
370 Ga0070709_10068030
371 Ga0070713_100003916
372 Ga0070710_10251691
373 Ga0070701_10003064
374 Ga0070705_100025114
375 Ga0070694_100004429
376 Ga0068867_100095430
377 Ga0070685_10260987
378 Ga0070706_100313894
379 Ga0070706_100426170
380 Ga0070707_100034376
381 Ga0070707_100060118
382 Ga0070698_100459481
383 Ga0070699_100001665
384 Ga0070699_100005807
385 Ga0070679_100113960
386 Ga0070697_100017630
387 Ga0068853_100299501
388 Ga0070672_100004971
389 Ga0070672_100383723
390 Ga0070686_100001688
391 Ga0070686_100171724
392 Ga0070695_100018085
393 Ga0070695_100059849
394 Ga0070696_100000194
395 Ga0070696_100006559
396 Ga0070665_100007832
397 Ga0070665_100008240
398 Ga0070665_100022556
399 Ga0070665_100082059
400 Ga0070704_100072698
401 Ga0070704_100089360
402 Ga0070664_100032358
403 Ga0070664_100176355
404 Ga0068854_100016468
405 Ga0068854_100324877
406 Ga0070702_100201127
407 Ga0068859_100179801
408 Ga0068864_100137249
409 Ga0068861_100006009
410 Ga0068863_100025295
411 Ga0068858_100001917
412 Ga0068858_100013947
413 Ga0068858_100084574
414 Ga0068858_100475920
415 Ga0068860_100173070
416 Ga0081455_10034061
417 Ga0070716_100055872
418 Ga0075367_10010524
419 Ga0075366_10260293
420 Ga0097621_100147501
421 Ga0097621_100179889
422 Ga0068871_100002129
423 Ga0068871_100003129
424 Ga0068871_100028010
425 Ga0075428_100094510
426 Ga0075430_100134127
427 Ga0075433_10094842
428 Ga0075433_10145978
429 Ga0075434_100000035
430 Ga0075434_100003265
431 Ga0075434_100013410
432 Ga0075434_100137092
433 Ga0075434_100317602
434 Ga0075434_100405734
435 Ga0068865_100103551
436 Ga0068865_100197307
437 Ga0075436_100005504
438 Ga0075436_100018921
439 Ga0075436_100027310
440 Ga0075436_100030314
441 Ga0075436_100174752
442 Ga0097620_100179790
443 Ga0075435_100000016
444 Ga0075435_100003396
445 Ga0075435_100023246
446 Ga0075435_100214523
447 Ga0105240_10040751
448 Ga0105240_10051949
449 Ga0111539_10059217
450 Ga0111539_10425389
451 Ga0105245_10198656
452 Ga0105245_10817260
453 Ga0105247_10005882
454 Ga0105247_10056142
455 Ga0114129_10002166
456 Ga0114129_10007300
457 Ga0114129_10054523
458 Ga0114129_10060516
459 Ga0114129_10096031
460 Ga0114129_10394689
461 Ga0105243_10013355
462 Ga0105242_10002987
463 Ga0105242_10079954
464 Ga0105248_10002117
465 Ga0105248_10007632
466 Ga0105248_10008538
467 Ga0105248_10063024
468 Ga0105248_10144961
469 Ga0105248_10209528
470 Ga0105238_10365320
471 Ga0105246_10034676
472 Ga0157371_10220408
473 Ga0157374_10011136
474 Ga0163162_10675791
475 Ga0157375_10251203
476 Ga0157375_10318001
477 Ga0163163_10167546
478 Ga0163163_10173720
479 Ga0157377_10090613
480 Ga0157379_10045562
481 Ga0157379_10053785
482 Ga0157379_10201498
483 Ga0157376_10077442
484 Ga0157376_10099451
485 Ga0157376_10335539
486 Ga0207653_10022710
487 Ga0207682_10007802
488 Ga0207682_10038841
489 Ga0207642_10263550
490 Ga0207710_10053173
491 Ga0207688_10018078
492 Ga0207680_10020414
493 Ga0207699_10006878
494 Ga0207699_10057534
495 Ga0207645_10002680
496 Ga0207645_10074977
497 Ga0207652_10006422
498 Ga0207646_10104759
499 Ga0207681_10049346
500 Ga0207681_10136977
501 Ga0207681_10415539
502 Ga0207650_10246325
503 Ga0207650_10246360
504 Ga0207650_10401105
505 Ga0207659_10060138
506 Ga0207659_10085319
507 Ga0207659_10161679
508 Ga0207659_10377217
509 Ga0207644_10004331
510 Ga0207644_10221941
511 Ga0207644_10444858
512 Ga0207690_10503298
513 Ga0207686_10065715
514 Ga0207686_10112217
515 Ga0207686_10175466
516 Ga0207670_10045756
517 Ga0207670_10119843
518 Ga0207669_10185746
519 Ga0207665_10119946
520 Ga0207691_10018622
521 Ga0207691_10342820
522 Ga0207711_10026566
523 Ga0207711_10049666
524 Ga0207711_10076826
525 Ga0207711_10272653
526 Ga0207711_10273029
527 Ga0207689_10058846
528 Ga0207689_10064040
529 Ga0207667_10124384
530 Ga0207651_10011599
531 Ga0207651_10452182
532 Ga0207640_10267790
533 Ga0207658_10033741
534 Ga0207703_10002278
535 Ga0207703_10098181
536 Ga0207703_10274669
537 Ga0207708_10202827
538 Ga0207641_10001898
539 Ga0207641_10381919
540 Ga0207648_10012098
541 Ga0207648_10017499
542 Ga0207676_10167075
543 Ga0207675_100063631
544 Ga0207675_100130439
545 Ga0207675_100371215
546 Ga0207683_10050912
547 Ga0207683_10059807
548 Ga0207428_10020617
549 Ga0207428_10058270
550 Ga0207428_10271737
551 Ga0268266_10006925
552 Ga0268266_10051002
553 Ga0268266_10235617
554 Ga0268265_10169075
555 Ga0268264_10143328
556 Ga0265314_10012728
557 Ga0307410_10013385
558 Ga0307410_10114010
559 Ga0307410_10232495
560 Ga0307407_10070530
561 Ga0307412_10127868
562 Ga0307412_10173820
563 Ga0307409_100004412
564 Ga0307409_100027239
565 Ga0307409_100774864
566 Ga0307416_100459146
567 Ga0307414_10015440
568 Ga0307414_10053882
569 Ga0307411_10204794
570 Ga0307411_10373722
571 Ga0307411_10439440
572 Ga0373930_0001490
573 Ga0373958_0013890
574 Ga0373959_0002314
575 Ga0373951_0000318
576 Ga0373952_0001048
577 Ga0373939_0001353
578 Ga0373941_0001475
579 Ga0373941_0017864
580 Ga0373960_0001807
581 Ga0373942_0002138
582 Ga0373961_0001320
583 Ga0373962_0001029
584 Ga0373937_0092651
585 Ga0373937_0154966
586 Ga0373937_0853407
587 Ga0395899_0320487
588 Ga0395905_0020116
589 Ga0436364_0223293
590 Ga0436365_1924632
591 Ga0436362_0144649
592 Ga0450894_001618
593 Ga0450918_009427
594 Ga0451577_0000818
595 Ga0453683_0019117
596 Ga0453683_0116812
597 Ga0466963_0054829
598 Ga0453684_0000803
599 Ga0451576_0006949
600 Ga0451576_0034542
601 Ga0495664_0306738
602 Ga0495618_0124786
603 Ga0495665_0242970
604 Ga0495640_0102592
605 Ga0495621_0149454
606 Ga0495634_0099528
607 Ga0495657_0067730
608 Ga0495658_0113440
609 Ga0495669_0007170
610 Ga0495613_0002008
611 Ga0495604_0014988
612 Ga0495674_0026541
613 Ga0495674_0134807
614 Ga0495677_0083733
615 Ga0495684_0000131
616 Ga0496102_0086375
617 Ga0496102_0375149
618 Ga0496103_0149338
619 Ga0496104_0347386
620 Ga0496105_0051194
621 Ga0496105_0105718
622 Ga0496105_0408760
623 Ga0496108_0056225
624 Ga0496109_0102505
625 Ga0496109_0314806
626 Ga0496110_0189400
627 Ga0496112_0011607
628 Ga0496112_0117816
629 Ga0496112_0269052
630 Ga0496112_0295737
631 Ga0496113_0159395
632 Ga0496113_0159456
633 Ga0496114_0448353
634 Ga0501034_0009130
635 Ga0501041_0224915
636 Ga0501047_0169935
637 Ga0501072_0030288
638 Ga0501073_0027386
639 Ga0501076_0236345
640 Ga0501079_0229595
641 Ga0501081_0463691
642 Ga0501045_0431217
643 nmdc:mga00v17_276074_c1
644 nmdc:mga07m45_45579_c2
645 nmdc:mga05p37_119817_c1
646 nmdc:mga05p37_229797_c1
647 nmdc:mga05p37_371566_c1
648 nmdc:mga05p37_39241_c1
649 nmdc:mga05p37_53679_c1
650 nmdc:mga05p37_7616_c1
651 nmdc:mga08y16_24041_c1
652 nmdc:mga08y16_35322_c1
653 nmdc:mga0n895_115638_c1
654 nmdc:mga0n895_115793_c1
655 nmdc:mga0n895_309_c1
656 nmdc:mga0n895_409355_c1
657 nmdc:mga0n895_555_c1
658 nmdc:mga0rr50_13_c1
659 nmdc:mga0rr50_423032_c1
660 nmdc:mga0rr50_53469_c1
661 nmdc:mga0rr50_736_c1
662 nmdc:mga0rr50_81055_c1
663 nmdc:mga0rr50_83845_c1
664 nmdc:mga08x19_11212_c1
665 nmdc:mga08x19_161690_c1
666 nmdc:mga08x19_23460_c1
667 nmdc:mga08x19_71647_c1
668 nmdc:mga08x19_97_c1
669 nmdc:mga0a205_126428_c1
670 nmdc:mga0a205_144_c1
671 nmdc:mga0a205_2475_c1
672 Ga0495601_0008562
673 Ga0495601_0181839
674 Ga0495595_0017684
675 Ga0495619_0000953
676 Ga0495619_0067915
677 Ga0500568_0012049
678 Ga0590071_000758
679 Ga0590075_000352
680 Ga0590075_000883
681 Ga0590077_000223
682 Ga0590077_000904
683 Ga0501082_0191536
684 Ga0530510_0036385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16881

LIAS_N

N-terminal domain of lipoyl synthase of Radical_SAM family

9

66

0.93

PF04055

Radical_SAM

Radical SAM superfamily

81

253

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9792 9 291
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9466 9 282
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.943 10 282
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9365 9 291
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9362 10 282
ID Description Score Start End Superfamily
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9882 53 268 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9872 58 266 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9834 9 261 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9825 58 266 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9805 47 256 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A535Q8R3-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) (Lip-syn) (LS) (Lipoate synthase) (Lipoic acid synthase) (Sulfur insertion protein LipA) 0.995 59 284 GO:0005737
GO:0016992
GO:0046872
GO:0051539
AF-A0A2V6MF02-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9944 49 283 GO:0016992
GO:0046872
GO:0051539
AF-X1G6A7-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9944 61 288 GO:0016992
GO:0046872
GO:0051539
AF-X1JI93-F1-model_v4 lipoyl synthase (EC 2.8.1.8) 0.9941 67 287 GO:0016992
GO:0046872
GO:0051539
AF-A0A520LKY5-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.994 148 282 GO:0016992
GO:0046872
GO:0051539

Map