F415304

General Info

Members Datasets Scaffolds Average Seq Length
342 257 684 260

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0352779|Ga0495628_0352779_133_1047
Length 304
Sequence VRRAVSNPYFTQKRYLLLPEITLKRRPATQDDALTQHPDIRFAASFAARSARVAGMLLVTAAMVTAASFAQTVPVPKPAPKARDAAPPSGGPSITGATQAPPNPVIPDPRRNVPSSIFQTFDANQKAQAAKVSAYLSSLSTLVGNFVQVGPDGSKTQGDFYIQKPGKLRFEYDPPSPIDIVADGSSVVVRDRKLATQDVYPLSQTPLRFLLSDRIDLMKDTNVVSVTADDLFISVTIEEKQALVGTSRLLLMIGAKDGQLKQWTVTDPQGYDTTIAVYNLDAGKKLDPNMFKIDFTNYGVPSPG

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
99 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
191 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
194 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
195 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
196 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
197 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
198 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
199 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
200 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
201 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
202 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
203 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
204 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
205 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
206 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
207 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
208 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
209 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
210 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
211 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
212 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
213 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
214 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
215 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
216 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
217 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
218 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
219 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
220 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
221 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
222 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
223 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
224 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
225 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
226 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
227 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
228 2904699407
229 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
230 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
231 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
232 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
233 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
234 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
235 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
236 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
237 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
238 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
239 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
240 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
241 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
242 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
243 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
244 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
245 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
246 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
247 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
248 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
249 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
250 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
251 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
252 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
253 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
254 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
255 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
256 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
257 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.52
Metatranscriptomes 0
Isolates 18.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 15.2
Rhizoplane 9.94
Rhizosphere 57.31
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0352779 3300046516 Bacteria 1081
2 JGI24739J22299_10013687 3300001989 Bacteria 2957
3 JGI24739J22299_10070254 3300001989 Bacteria 1090
4 JGI25160J50197_1008826 3300003354 Bacteria 3799
5 JGI25160J50197_1012746 3300003354 Bacteria 2899
6 Ga0065165_1003953 3300005262 Bacteria 9728
7 Ga0065165_1004896 3300005262 Bacteria 7915
8 Ga0065165_1029828 3300005262 Bacteria 1742
9 Ga0070658_10361173 3300005327 Bacteria 1244
10 Ga0070666_10421271 3300005335 Bacteria 962
11 Ga0070680_100352925 3300005336 Bacteria 1251
12 Ga0068868_100022147 3300005338 Bacteria 4792
13 Ga0070661_100158080 3300005344 Bacteria 1715
14 Ga0070668_100248995 3300005347 Bacteria 1474
15 Ga0070668_100405703 3300005347 Bacteria 1164
16 Ga0070669_100329385 3300005353 Bacteria 1235
17 Ga0070673_100234965 3300005364 Bacteria 1591
18 Ga0070709_10001106 3300005434 Bacteria 14867
19 Ga0070714_100120270 3300005435 Bacteria 2335
20 Ga0070713_100016794 3300005436 Bacteria 5513
21 Ga0070713_100034610 3300005436 Bacteria 4061
22 Ga0070710_10006387 3300005437 Bacteria 5661
23 Ga0070711_100282877 3300005439 Bacteria 1313
24 Ga0070694_100203002 3300005444 Bacteria 1478
25 Ga0070663_100029076 3300005455 Bacteria 3771
26 Ga0070663_100055245 3300005455 Bacteria 2841
27 Ga0070678_100062762 3300005456 Bacteria 2745
28 Ga0070678_100211724 3300005456 Bacteria 1606
29 Ga0070662_100057746 3300005457 Bacteria 2821
30 Ga0070679_100112110 3300005530 Bacteria 2713
31 Ga0070679_100289182 3300005530 Bacteria 1590
32 Ga0068853_100027358 3300005539 Bacteria 4791
33 Ga0068853_100183023 3300005539 Bacteria 1901
34 Ga0070693_100112388 3300005547 Bacteria 1678
35 Ga0070665_100081597 3300005548 Bacteria 3239
36 Ga0070665_100400486 3300005548 Bacteria 1380
37 Ga0068855_100040444 3300005563 Bacteria 5533
38 Ga0070664_100218317 3300005564 Bacteria 1705
39 Ga0068857_100036678 3300005577 Bacteria 4344
40 Ga0068854_100045938 3300005578 Bacteria 3107
41 Ga0068854_100353459 3300005578 Bacteria 1203
42 Ga0068856_100013684 3300005614 Bacteria 7844
43 Ga0068856_100239714 3300005614 Bacteria 1829
44 Ga0070702_100221734 3300005615 Bacteria 1265
45 Ga0068864_100159798 3300005618 Bacteria 2048
46 Ga0068864_100232500 3300005618 Bacteria 1705
47 Ga0068870_10055048 3300005840 Bacteria 2118
48 Ga0068858_100192925 3300005842 Bacteria 1925
49 Ga0081540_1061115 3300005983 Bacteria 1798
50 Ga0081539_10067474 3300005985 Bacteria 1934
51 Ga0070717_10000379 3300006028 Bacteria 28424
52 Ga0070716_100179764 3300006173 Bacteria 1388
53 Ga0070712_100056444 3300006175 Bacteria 2755
54 Ga0075367_10117665 3300006178 Bacteria 1635
55 Ga0075369_10014984 3300006186 Bacteria 3104
56 Ga0068871_100196806 3300006358 Bacteria 1739
57 Ga0099825_1030820 3300006941 Bacteria 2335
58 Ga0099823_1017234 3300006944 Bacteria 7041
59 Ga0099794_10043158 3300007265 Bacteria 2152
60 Ga0099795_10039955 3300007788 Bacteria 1664
61 Ga0105240_10083721 3300009093 Bacteria 3913
62 Ga0105240_10321485 3300009093 Bacteria 1764
63 Ga0105245_10138379 3300009098 Bacteria 2291
64 Ga0105247_10023918 3300009101 Bacteria 3681
65 Ga0105241_10235409 3300009174 Bacteria 1545
66 Ga0105237_10159504 3300009545 Bacteria 2253
67 Ga0105237_10206353 3300009545 Bacteria 1965
68 Ga0105238_10011824 3300009551 Bacteria 8792
69 Ga0105238_10266098 3300009551 Bacteria 1694
70 Ga0105239_10007800 3300010375 Bacteria 12246
71 Ga0105239_10151974 3300010375 Bacteria 2584
72 Ga0105239_10237861 3300010375 Bacteria 2044
73 Ga0105239_10616418 3300010375 Bacteria 1238
74 Ga0105246_10233501 3300011119 Bacteria 1450
75 Ga0157369_10373319 3300013105 Bacteria 1481
76 Ga0157369_10407650 3300013105 Bacteria 1410
77 Ga0157374_10036000 3300013296 Bacteria 4532
78 Ga0157374_10639831 3300013296 Bacteria 1075
79 Ga0157378_10387725 3300013297 Bacteria 1373
80 Ga0163162_10043869 3300013306 Bacteria 4477
81 Ga0163162_10167600 3300013306 Bacteria 2320
82 Ga0163162_10322944 3300013306 Bacteria 1676
83 Ga0157372_10913933 3300013307 Bacteria 1018
84 Ga0157375_10115230 3300013308 Bacteria 2790
85 Ga0163163_10002009 3300014325 Bacteria 17183
86 Ga0163163_10078671 3300014325 Bacteria 3294
87 Ga0163163_10394394 3300014325 Bacteria 1442
88 Ga0157376_10090320 3300014969 Bacteria 2651
89 Ga0157376_10919791 3300014969 Bacteria 894
90 Ga0213873_10009327 3300021358 Bacteria 2034
91 Ga0213876_10131096 3300021384 Bacteria 1332
92 Ga0213876_10140322 3300021384 Bacteria 1285
93 Ga0213876_10274334 3300021384 Unclassified 896
94 Ga0213871_10013504 3300021441 Bacteria 1920
95 Ga0209677_104534 3300025253 Bacteria 3966
96 Ga0209233_1000774 3300025261 Bacteria 14413
97 Ga0209233_1001514 3300025261 Bacteria 9126
98 Ga0209233_1003020 3300025261 Bacteria 5994
99 Ga0209455_1007823 3300025272 Bacteria 2973
100 Ga0209455_1011147 3300025272 Bacteria 2232
101 Ga0207426_1002598 3300025302 Bacteria 11213
102 Ga0207426_1012847 3300025302 Bacteria 3129
103 Ga0207697_10184870 3300025315 Bacteria 914
104 Ga0207656_10130064 3300025321 Bacteria 1179
105 Ga0207680_10314165 3300025903 Bacteria 1094
106 Ga0207647_10002640 3300025904 Bacteria 13547
107 Ga0207647_10109655 3300025904 Bacteria 1632
108 Ga0207695_10294175 3300025913 Bacteria 1516
109 Ga0207671_10082879 3300025914 Bacteria 2407
110 Ga0207671_10113563 3300025914 Bacteria 2063
111 Ga0207671_10308285 3300025914 Bacteria 1251
112 Ga0207693_10044308 3300025915 Bacteria 3497
113 Ga0207693_10049659 3300025915 Bacteria 3295
114 Ga0207693_10113942 3300025915 Bacteria 2121
115 Ga0207693_10227828 3300025915 Bacteria 1464
116 Ga0207657_10025091 3300025919 Bacteria 5505
117 Ga0207657_10097810 3300025919 Bacteria 2440
118 Ga0207649_10318364 3300025920 Bacteria 1142
119 Ga0207687_10095141 3300025927 Bacteria 2181
120 Ga0207700_10026216 3300025928 Bacteria 4062
121 Ga0207690_10159049 3300025932 Bacteria 1682
122 Ga0207706_10151305 3300025933 Bacteria 2041
123 Ga0207670_10349196 3300025936 Bacteria 1171
124 Ga0207665_10112896 3300025939 Bacteria 1911
125 Ga0207665_10187257 3300025939 Bacteria 1502
126 Ga0207691_10205511 3300025940 Bacteria 1713
127 Ga0207667_10054948 3300025949 Bacteria 4187
128 Ga0207640_10042133 3300025981 Bacteria 2909
129 Ga0207640_10212181 3300025981 Bacteria 1476
130 Ga0207677_10106942 3300026023 Bacteria 2074
131 Ga0207703_10145850 3300026035 Bacteria 2058
132 Ga0207703_10165060 3300026035 Bacteria 1942
133 Ga0207639_10010563 3300026041 Bacteria 6396
134 Ga0207639_10195129 3300026041 Bacteria 1732
135 Ga0207678_10038029 3300026067 Bacteria 4184
136 Ga0207678_10164476 3300026067 Bacteria 1895
137 Ga0207678_10182790 3300026067 Bacteria 1790
138 Ga0207708_10181359 3300026075 Bacteria 1672
139 Ga0207702_10019515 3300026078 Bacteria 5609
140 Ga0207676_10231091 3300026095 Bacteria 1653
141 Ga0207674_10008231 3300026116 Bacteria 12077
142 Ga0207683_10046557 3300026121 Bacteria 3796
143 Ga0207698_10329556 3300026142 Bacteria 1433
144 Ga0209389_1000033 3300027296 Bacteria 131516
145 Ga0209389_1000071 3300027296 Bacteria 97411
146 Ga0209589_1000040 3300027357 Bacteria 126550
147 Ga0209489_100045 3300027361 Bacteria 158225
148 Ga0209489_100209 3300027361 Bacteria 96349
149 Ga0209700_100011 3300027363 Bacteria 362159
150 Ga0209588_1052680 3300027671 Bacteria 1316
151 Ga0268266_10124215 3300028379 Bacteria 2300
152 Ga0268266_10136657 3300028379 Bacteria 2196
153 Ga0268265_10305810 3300028380 Bacteria 1433
154 Ga0265337_1011010 3300028556 Bacteria 3137
155 Ga0265319_1035995 3300028563 Bacteria 1695
156 Ga0265338_10001474 3300028800 Bacteria 38131
157 Ga0265324_10035628 3300029957 Bacteria 1732
158 Ga0265332_10000558 3300031238 Bacteria 25083
159 Ga0265325_10058694 3300031241 Bacteria 1959
160 Ga0265329_10071873 3300031242 Bacteria 1095
161 Ga0265340_10004461 3300031247 Bacteria 7825
162 Ga0265340_10064241 3300031247 Bacteria 1750
163 Ga0265339_10030025 3300031249 Bacteria 3080
164 Ga0265339_10045800 3300031249 Bacteria 2406
165 Ga0265331_10024519 3300031250 Bacteria 3050
166 Ga0265316_10069875 3300031344 Bacteria 2710
167 Ga0307508_10244141 3300031616 Bacteria 1393
168 Ga0265342_10002635 3300031712 Bacteria 15340
169 Ga0307415_100317018 3300032126 Bacteria 1298
170 Ga0373951_0071277 3300035091 Bacteria 886
171 Ga0373933_0000031 3300035724 Bacteria 85038
172 Ga0373937_0185717 3300036401 Bacteria 1953
173 Ga0373925_0020848 3300037068 Bacteria 4777
174 Ga0395905_0050821 3300037471 Bacteria 3883
175 Ga0436364_0074564 3300037853 Bacteria 1841
176 Ga0436364_1155744 3300037853 Bacteria 3283
177 Ga0436364_1245508 3300037853 Bacteria 2189
178 Ga0436365_0122255 3300039437 Bacteria 6640
179 Ga0436365_0836077 3300039437 Bacteria 1512
180 Ga0436365_0940700 3300039437 Bacteria 3433
181 Ga0436360_1141211 3300039438 Bacteria 4515
182 Ga0436360_1282396 3300039438 Bacteria 2550
183 Ga0436361_0139900 3300039447 Bacteria 2693
184 Ga0436362_0376712 3300039453 Bacteria 864
185 Ga0436362_0634832 3300039453 Bacteria 7794
186 Ga0451793_1932595 3300041452 Bacteria 1088
187 Ga0466972_0012943 3300044658 Bacteria 4190
188 Ga0466966_0068267 3300044684 Bacteria 2232
189 Ga0466963_0141158 3300044694 Bacteria 1669
190 Ga0466968_0006021 3300044735 Bacteria 4550
191 Ga0495592_0199731 3300046454 Bacteria 1350
192 Ga0495639_0010176 3300046475 Bacteria 4045
193 Ga0495639_0154823 3300046475 Bacteria 1107
194 Ga0495606_0137290 3300046507 Bacteria 1447
195 Ga0495608_0220551 3300046511 Bacteria 1190
196 Ga0495616_0077624 3300046513 Bacteria 1594
197 Ga0495648_0000286 3300046524 Bacteria 57430
198 Ga0495667_0076678 3300046559 Bacteria 2175
199 Ga0495667_0203502 3300046559 Bacteria 1267
200 Ga0495656_0122236 3300046615 Bacteria 1230
201 Ga0495668_0127929 3300046616 Bacteria 1391
202 Ga0495668_0130570 3300046616 Bacteria 1375
203 Ga0495635_0186807 3300046663 Bacteria 1407
204 Ga0495635_0215337 3300046663 Bacteria 1300
205 Ga0495647_0034381 3300046681 Bacteria 1898
206 Ga0495589_0107937 3300046794 Bacteria 1345
207 Ga0495672_0092605 3300047320 Bacteria 1656
208 Ga0496100_0006499 3300048903 Bacteria 6377
209 Ga0496100_0027954 3300048903 Bacteria 3474
210 Ga0496100_0119208 3300048903 Bacteria 1844
211 Ga0496100_0230668 3300048903 Bacteria 1362
212 Ga0496101_0027335 3300048904 Bacteria 3974
213 Ga0496101_0100951 3300048904 Bacteria 2160
214 Ga0496102_0011927 3300048905 Bacteria 7505
215 Ga0496102_0017532 3300048905 Bacteria 6272
216 Ga0496102_0049981 3300048905 Bacteria 3806
217 Ga0496102_0063759 3300048905 Bacteria 3375
218 Ga0496103_0224769 3300048906 Bacteria 1207
219 Ga0496104_0049045 3300048907 Bacteria 3982
220 Ga0496104_0190774 3300048907 Bacteria 1960
221 Ga0496105_0044849 3300048908 Bacteria 3648
222 Ga0496105_0273620 3300048908 Bacteria 1363
223 Ga0496106_0028340 3300048909 Bacteria 4172
224 Ga0496106_0037784 3300048909 Bacteria 3612
225 Ga0496106_0316744 3300048909 Bacteria 1252
226 Ga0496107_0002944 3300048910 Bacteria 11270
227 Ga0496108_0227990 3300048911 Bacteria 1619
228 Ga0496109_0009866 3300048912 Bacteria 8152
229 Ga0496110_0099672 3300048913 Bacteria 2604
230 Ga0496110_0102185 3300048913 Bacteria 2571
231 Ga0496110_0254821 3300048913 Bacteria 1597
232 Ga0496112_0001974 3300048915 Bacteria 16209
233 Ga0496112_0049402 3300048915 Bacteria 4124
234 Ga0496112_0204790 3300048915 Bacteria 1931
235 Ga0496113_0139985 3300048916 Bacteria 1903
236 Ga0496114_0278249 3300048917 Bacteria 1475
237 Ga0496114_0313792 3300048917 Bacteria 1385
238 Ga0496115_0003266 3300048918 Bacteria 11628
239 Ga0496115_0182715 3300048918 Bacteria 1733
240 Ga0496118_0007461 3300048921 Bacteria 11580
241 Ga0496121_0029504 3300048924 Bacteria 5070
242 Ga0496121_0058786 3300048924 Bacteria 3175
243 Ga0496123_0078331 3300048926 Bacteria 2025
244 Ga0496123_0234423 3300048926 Bacteria 916
245 Ga0496126_0247840 3300048929 Bacteria 1485
246 Ga0496126_0360413 3300048929 Bacteria 1187
247 Ga0501032_0100504 3300049569 Bacteria 1916
248 Ga0501034_0056834 3300049571 Bacteria 3935
249 Ga0501036_0190918 3300049572 Bacteria 1723
250 Ga0501036_0241669 3300049572 Bacteria 1514
251 Ga0501037_0299747 3300049573 Bacteria 1116
252 Ga0501038_0355893 3300049574 Bacteria 1139
253 Ga0501039_0155619 3300049575 Bacteria 1796
254 Ga0501039_0454013 3300049575 Bacteria 1006
255 Ga0501040_0059697 3300049576 Bacteria 2620
256 Ga0501042_0052089 3300049578 Bacteria 2919
257 Ga0501043_0077830 3300049579 Bacteria 2605
258 Ga0501043_0122604 3300049579 Bacteria 2038
259 Ga0501047_0346590 3300049581 Bacteria 1322
260 Ga0501067_0012233 3300049583 Bacteria 4755
261 Ga0501070_0157873 3300049586 Bacteria 1870
262 Ga0501080_0144295 3300049742 Bacteria 2200
263 Ga0501083_0090320 3300049744 Bacteria 2023
264 Ga0501035_0044770 3300049822 Bacteria 3983
265 Ga0501035_0254773 3300049822 Bacteria 1489
266 Ga0501044_0135960 3300049823 Bacteria 2449
267 nmdc:mga0yw44_90399_c1 3300050492 Bacteria 1934
268 nmdc:mga08y16_781517_c1 3300050511 Bacteria 949
269 Ga0495601_0087920 3300053077 Bacteria 1998
270 Ga0495619_0042889 3300053085 Bacteria 2964
271 Ga0500578_0144727 3300053086 Bacteria 1484
272 Ga0500640_065758 3300053095 Bacteria 1563
273 Ga0500642_0173138 3300053130 Bacteria 1010
274 Ga0500588_0025968 3300053146 Bacteria 1633
275 Ga0500590_086805 3300053148 Bacteria 1525
276 Ga0500638_099378 3300053162 Bacteria 1359
277 Ga0500636_0003176 3300053177 Bacteria 9198
278 Ga0500661_018844 3300055283 Bacteria 1229
279 2507505258 2507262055 Bacteria 8048963
280 2513658824 2513237096 Bacteria 8722461
281 2513695123 2513237101 Bacteria 7952346
282 2513860831 2513237137 Bacteria 9558895
283 2513921088 2513237145 Bacteria 8979722
284 2515627453 2515154112 Bacteria 8294334
285 2517888853 2517572143 Bacteria 9484767
286 2524469479 2524023210 Bacteria 9029266
287 2528852950 2528768022 Bacteria 10457665
288 2617373772 2617270741 Bacteria 8201522
289 2671122459 2667528175 Bacteria 7532676
290 2723841654 2721755755 Bacteria 8322773
291 2728755002 2728368998 Bacteria 8720350
292 2824667571 2824661429 Bacteria 9877870
293 2844315348 2844315083 Bacteria 8138177
294 2847931085 2847930680 Bacteria 9342022
295 2849083047 2849076700 Bacteria 7039503
296 2874594456 2874590934 Bacteria 8299676
297 2874608053 2874604998 Bacteria 7834745
298 2874613424 2874612657 Bacteria 8252029
299 2874649829 2874645413 Bacteria 8214782
300 2876773948 2876771140 Bacteria 8287509
301 2876821828 2876818435 Bacteria 8274608
302 2879078328 2879074833 Bacteria 8279565
303 2879085919 2879083081 Bacteria 8587928
304 2879130589 2879127579 Bacteria 8294491
305 2879147134 2879142872 Bacteria 8267021
306 2885371016 2885366525 Bacteria 8326213
307 2885382838 2885374607 Bacteria 8927485
308 2885389314 2885383462 Bacteria 9473874
309 2888390669 2888388044 Bacteria 7304136
310 2903732209 2903727486 Bacteria 8281579
311 2903751486 2903748898 Bacteria 9972761
312 2903771848 2903768456 Bacteria 9749579
313 2904708693
314 2906604286 2906602504 Bacteria 8295279
315 2906628947 2906626472 Bacteria 8826946
316 2906642321 2906635258 Bacteria 8601019
317 2906648166 2906643746 Bacteria 8722424
318 2906667349 2906660503 Bacteria 8595048
319 2922363989 2922361189 Bacteria 7436256
320 2935615713 2935608549 Bacteria 8203142
321 2935679168 2935675223 Bacteria 9928132
322 2935825489 2935819856 Bacteria 8261050
323 2935853278 2935847175 Bacteria 8228321
324 2935962648 2935959822 Bacteria 7869783
325 2935980693 2935975950 Bacteria 8347125
326 3005475075 3005474847 Bacteria 9259049
327 3005592200 3005587118 Bacteria 7794411
328 3005595062 3005594810 Bacteria 8716512
329 3005711010 3005710791 Bacteria 7622528
330 8006936211 8006933436 Bacteria 10410654
331 8006967468 8006964411 Bacteria 8966052
332 8006976157 8006973647 Bacteria 10679141
333 8006996500 8006994254 Bacteria 8309700
334 8016586354 8016583857 Bacteria 10421953
335 8019562422 8019555841 Bacteria 9642137
336 8019572494 8019565922 Bacteria 9639779
337 8019595298 8019586578 Bacteria 10212056
338 8019622982 8019619141 Bacteria 9218857
339 8019630125 8019629233 Bacteria 8687553
340 8019640491 8019638758 Bacteria 9062356
341 8019666957 8019659431 Bacteria 8577854
342 8019679274 8019678201 Bacteria 8863603
343 Ga0495628_0352779
344 JGI24739J22299_10013687
345 JGI24739J22299_10070254
346 JGI25160J50197_1008826
347 JGI25160J50197_1012746
348 Ga0065165_1003953
349 Ga0065165_1004896
350 Ga0065165_1029828
351 Ga0070658_10361173
352 Ga0070666_10421271
353 Ga0070680_100352925
354 Ga0068868_100022147
355 Ga0070661_100158080
356 Ga0070668_100248995
357 Ga0070668_100405703
358 Ga0070669_100329385
359 Ga0070673_100234965
360 Ga0070709_10001106
361 Ga0070714_100120270
362 Ga0070713_100016794
363 Ga0070713_100034610
364 Ga0070710_10006387
365 Ga0070711_100282877
366 Ga0070694_100203002
367 Ga0070663_100029076
368 Ga0070663_100055245
369 Ga0070678_100062762
370 Ga0070678_100211724
371 Ga0070662_100057746
372 Ga0070679_100112110
373 Ga0070679_100289182
374 Ga0068853_100027358
375 Ga0068853_100183023
376 Ga0070693_100112388
377 Ga0070665_100081597
378 Ga0070665_100400486
379 Ga0068855_100040444
380 Ga0070664_100218317
381 Ga0068857_100036678
382 Ga0068854_100045938
383 Ga0068854_100353459
384 Ga0068856_100013684
385 Ga0068856_100239714
386 Ga0070702_100221734
387 Ga0068864_100159798
388 Ga0068864_100232500
389 Ga0068870_10055048
390 Ga0068858_100192925
391 Ga0081540_1061115
392 Ga0081539_10067474
393 Ga0070717_10000379
394 Ga0070716_100179764
395 Ga0070712_100056444
396 Ga0075367_10117665
397 Ga0075369_10014984
398 Ga0068871_100196806
399 Ga0099825_1030820
400 Ga0099823_1017234
401 Ga0099794_10043158
402 Ga0099795_10039955
403 Ga0105240_10083721
404 Ga0105240_10321485
405 Ga0105245_10138379
406 Ga0105247_10023918
407 Ga0105241_10235409
408 Ga0105237_10159504
409 Ga0105237_10206353
410 Ga0105238_10011824
411 Ga0105238_10266098
412 Ga0105239_10007800
413 Ga0105239_10151974
414 Ga0105239_10237861
415 Ga0105239_10616418
416 Ga0105246_10233501
417 Ga0157369_10373319
418 Ga0157369_10407650
419 Ga0157374_10036000
420 Ga0157374_10639831
421 Ga0157378_10387725
422 Ga0163162_10043869
423 Ga0163162_10167600
424 Ga0163162_10322944
425 Ga0157372_10913933
426 Ga0157375_10115230
427 Ga0163163_10002009
428 Ga0163163_10078671
429 Ga0163163_10394394
430 Ga0157376_10090320
431 Ga0157376_10919791
432 Ga0213873_10009327
433 Ga0213876_10131096
434 Ga0213876_10140322
435 Ga0213876_10274334
436 Ga0213871_10013504
437 Ga0209677_104534
438 Ga0209233_1000774
439 Ga0209233_1001514
440 Ga0209233_1003020
441 Ga0209455_1007823
442 Ga0209455_1011147
443 Ga0207426_1002598
444 Ga0207426_1012847
445 Ga0207697_10184870
446 Ga0207656_10130064
447 Ga0207680_10314165
448 Ga0207647_10002640
449 Ga0207647_10109655
450 Ga0207695_10294175
451 Ga0207671_10082879
452 Ga0207671_10113563
453 Ga0207671_10308285
454 Ga0207693_10044308
455 Ga0207693_10049659
456 Ga0207693_10113942
457 Ga0207693_10227828
458 Ga0207657_10025091
459 Ga0207657_10097810
460 Ga0207649_10318364
461 Ga0207687_10095141
462 Ga0207700_10026216
463 Ga0207690_10159049
464 Ga0207706_10151305
465 Ga0207670_10349196
466 Ga0207665_10112896
467 Ga0207665_10187257
468 Ga0207691_10205511
469 Ga0207667_10054948
470 Ga0207640_10042133
471 Ga0207640_10212181
472 Ga0207677_10106942
473 Ga0207703_10145850
474 Ga0207703_10165060
475 Ga0207639_10010563
476 Ga0207639_10195129
477 Ga0207678_10038029
478 Ga0207678_10164476
479 Ga0207678_10182790
480 Ga0207708_10181359
481 Ga0207702_10019515
482 Ga0207676_10231091
483 Ga0207674_10008231
484 Ga0207683_10046557
485 Ga0207698_10329556
486 Ga0209389_1000033
487 Ga0209389_1000071
488 Ga0209589_1000040
489 Ga0209489_100045
490 Ga0209489_100209
491 Ga0209700_100011
492 Ga0209588_1052680
493 Ga0268266_10124215
494 Ga0268266_10136657
495 Ga0268265_10305810
496 Ga0265337_1011010
497 Ga0265319_1035995
498 Ga0265338_10001474
499 Ga0265324_10035628
500 Ga0265332_10000558
501 Ga0265325_10058694
502 Ga0265329_10071873
503 Ga0265340_10004461
504 Ga0265340_10064241
505 Ga0265339_10030025
506 Ga0265339_10045800
507 Ga0265331_10024519
508 Ga0265316_10069875
509 Ga0307508_10244141
510 Ga0265342_10002635
511 Ga0307415_100317018
512 Ga0373951_0071277
513 Ga0373933_0000031
514 Ga0373937_0185717
515 Ga0373925_0020848
516 Ga0395905_0050821
517 Ga0436364_0074564
518 Ga0436364_1155744
519 Ga0436364_1245508
520 Ga0436365_0122255
521 Ga0436365_0836077
522 Ga0436365_0940700
523 Ga0436360_1141211
524 Ga0436360_1282396
525 Ga0436361_0139900
526 Ga0436362_0376712
527 Ga0436362_0634832
528 Ga0451793_1932595
529 Ga0466972_0012943
530 Ga0466966_0068267
531 Ga0466963_0141158
532 Ga0466968_0006021
533 Ga0495592_0199731
534 Ga0495639_0010176
535 Ga0495639_0154823
536 Ga0495606_0137290
537 Ga0495608_0220551
538 Ga0495616_0077624
539 Ga0495648_0000286
540 Ga0495667_0076678
541 Ga0495667_0203502
542 Ga0495656_0122236
543 Ga0495668_0127929
544 Ga0495668_0130570
545 Ga0495635_0186807
546 Ga0495635_0215337
547 Ga0495647_0034381
548 Ga0495589_0107937
549 Ga0495672_0092605
550 Ga0496100_0006499
551 Ga0496100_0027954
552 Ga0496100_0119208
553 Ga0496100_0230668
554 Ga0496101_0027335
555 Ga0496101_0100951
556 Ga0496102_0011927
557 Ga0496102_0017532
558 Ga0496102_0049981
559 Ga0496102_0063759
560 Ga0496103_0224769
561 Ga0496104_0049045
562 Ga0496104_0190774
563 Ga0496105_0044849
564 Ga0496105_0273620
565 Ga0496106_0028340
566 Ga0496106_0037784
567 Ga0496106_0316744
568 Ga0496107_0002944
569 Ga0496108_0227990
570 Ga0496109_0009866
571 Ga0496110_0099672
572 Ga0496110_0102185
573 Ga0496110_0254821
574 Ga0496112_0001974
575 Ga0496112_0049402
576 Ga0496112_0204790
577 Ga0496113_0139985
578 Ga0496114_0278249
579 Ga0496114_0313792
580 Ga0496115_0003266
581 Ga0496115_0182715
582 Ga0496118_0007461
583 Ga0496121_0029504
584 Ga0496121_0058786
585 Ga0496123_0078331
586 Ga0496123_0234423
587 Ga0496126_0247840
588 Ga0496126_0360413
589 Ga0501032_0100504
590 Ga0501034_0056834
591 Ga0501036_0190918
592 Ga0501036_0241669
593 Ga0501037_0299747
594 Ga0501038_0355893
595 Ga0501039_0155619
596 Ga0501039_0454013
597 Ga0501040_0059697
598 Ga0501042_0052089
599 Ga0501043_0077830
600 Ga0501043_0122604
601 Ga0501047_0346590
602 Ga0501067_0012233
603 Ga0501070_0157873
604 Ga0501080_0144295
605 Ga0501083_0090320
606 Ga0501035_0044770
607 Ga0501035_0254773
608 Ga0501044_0135960
609 nmdc:mga0yw44_90399_c1
610 nmdc:mga08y16_781517_c1
611 Ga0495601_0087920
612 Ga0495619_0042889
613 Ga0500578_0144727
614 Ga0500640_065758
615 Ga0500642_0173138
616 Ga0500588_0025968
617 Ga0500590_086805
618 Ga0500638_099378
619 Ga0500636_0003176
620 Ga0500661_018844
621 2507505258
622 2513658824
623 2513695123
624 2513860831
625 2513921088
626 2515627453
627 2517888853
628 2524469479
629 2528852950
630 2617373772
631 2671122459
632 2723841654
633 2728755002
634 2824667571
635 2844315348
636 2847931085
637 2849083047
638 2874594456
639 2874608053
640 2874613424
641 2874649829
642 2876773948
643 2876821828
644 2879078328
645 2879085919
646 2879130589
647 2879147134
648 2885371016
649 2885382838
650 2885389314
651 2888390669
652 2903732209
653 2903751486
654 2903771848
655 2904708693
656 2906604286
657 2906628947
658 2906642321
659 2906648166
660 2906667349
661 2922363989
662 2935615713
663 2935679168
664 2935825489
665 2935853278
666 2935962648
667 2935980693
668 3005475075
669 3005592200
670 3005595062
671 3005711010
672 8006936211
673 8006967468
674 8006976157
675 8006996500
676 8016586354
677 8019562422
678 8019572494
679 8019595298
680 8019622982
681 8019630125
682 8019640491
683 8019666957
684 8019679274

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

137

294

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8veh-assembly4.cif.gz_D crystal structure of outer membrane lipoprotein carrier protein (lola) from rickettsia bellii 0.8455 81 248
8v1k-assembly2.cif.gz_B crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis 0.7774 83 249
3ksn-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.7705 84 254
1ua8-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.7614 83 255
8orn-assembly2.cif.gz_C crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.7383 77 249
ID Description Score Start End Superfamily
af_Q58135_115_168_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7854 170 212 3.10.450.750
af_O13710_24_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7433 186 220 3.40.50.300
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7287 82 249 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7121 83 255 2.50.20.10
3nuzD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7065 178 210 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A346QWX4-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9766 98 249
AF-A0A533J363-F1-model_v4 deleted 0.9675 75 258
AF-A0A533J363-F1-model_v4 deleted 0.9623 75 258
AF-A0A383BQ27-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9491 78 194
AF-A0A7Y4TDU3-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9475 67 247

Map