F415205

General Info

Members Datasets Scaffolds Average Seq Length
342 192 684 196

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10026515|Ga0265318_100265153
Length 218
Sequence VILSQTARISLRPRSGSIRYPSGVRLLLLSRHGRSVQNAAGTVNGDPRLDRGLDPDGVAQSEALAPQLAGIEIDLCVTSEFPRARRTAELALAGRPVPTVVDPDLDDIRVGDLEGRTLAAYRDWKHGRTRDEPFPGGESLDDAARRYADAFERLLARPEEILLVVCHEIPVRYALNAAAGTDDLDRPLHDIPNATPYLFDAGSLRRAVDGIRALAGRG

Samples

Sample ID Description Type Environment
1 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
122 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
123 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
124 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.57
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265318_10026515 3300028577 Bacteria 2281
2 rootH1_10094344 3300003316 Bacteria 1187
3 Ga0070658_10539665 3300005327 Bacteria 1009
4 Ga0070683_100009393 3300005329 Bacteria 8363
5 Ga0070683_100022110 3300005329 Bacteria 5681
6 Ga0070683_100065026 3300005329 Bacteria 3395
7 Ga0070683_100614078 3300005329 Unclassified 1041
8 Ga0070690_100543187 3300005330 Bacteria 875
9 Ga0070680_100552426 3300005336 Unclassified 987
10 Ga0070682_100025874 3300005337 Bacteria 3506
11 Ga0070682_100478920 3300005337 Bacteria 959
12 Ga0070660_100025081 3300005339 Bacteria 4430
13 Ga0070660_100027280 3300005339 Bacteria 4260
14 Ga0070660_100028534 3300005339 Bacteria 4176
15 Ga0070660_100033835 3300005339 Bacteria 3856
16 Ga0070687_100087489 3300005343 Bacteria 1715
17 Ga0070661_100328290 3300005344 Bacteria 1196
18 Ga0070661_100659179 3300005344 Bacteria 850
19 Ga0070671_100800891 3300005355 Bacteria 820
20 Ga0070671_101189140 3300005355 Bacteria 671
21 Ga0070674_100158103 3300005356 Bacteria 1717
22 Ga0070673_100242401 3300005364 Bacteria 1568
23 Ga0070659_100101241 3300005366 Bacteria 2319
24 Ga0070709_10232453 3300005434 Bacteria 1320
25 Ga0070713_100713865 3300005436 Bacteria 958
26 Ga0070711_100218254 3300005439 Bacteria 1481
27 Ga0070708_100620753 3300005445 Bacteria 1019
28 Ga0070663_100246298 3300005455 Bacteria 1413
29 Ga0070678_100043953 3300005456 Bacteria 3186
30 Ga0070681_10038675 3300005458 Bacteria 4782
31 Ga0070681_10039463 3300005458 Bacteria 4733
32 Ga0070681_10145210 3300005458 Viruses 2302
33 Ga0070681_10185934 3300005458 Bacteria 1998
34 Ga0070681_10211244 3300005458 Bacteria 1857
35 Ga0070706_100049438 3300005467 Bacteria 3881
36 Ga0070698_100224121 3300005471 Bacteria 1813
37 Ga0070699_100061609 3300005518 Unclassified 3251
38 Ga0070679_100110078 3300005530 Bacteria 2740
39 Ga0070679_100117137 3300005530 Bacteria 2649
40 Ga0070679_100242416 3300005530 Bacteria 1760
41 Ga0070679_100283613 3300005530 Unclassified 1608
42 Ga0070679_100325623 3300005530 Bacteria 1486
43 Ga0070679_100636763 3300005530 Bacteria 1009
44 Ga0070684_100070977 3300005535 Bacteria 3065
45 Ga0070684_100087304 3300005535 Bacteria 2770
46 Ga0070684_100937703 3300005535 Bacteria 811
47 Ga0070693_100056457 3300005547 Bacteria 2266
48 Ga0068855_100059990 3300005563 Bacteria 4450
49 Ga0068855_100163212 3300005563 Bacteria 2527
50 Ga0070664_100382415 3300005564 Bacteria 1285
51 Ga0068857_100385511 3300005577 Bacteria 1302
52 Ga0068856_100012546 3300005614 Bacteria 8203
53 Ga0068856_100050875 3300005614 Bacteria 4085
54 Ga0068852_100047751 3300005616 Unclassified 3654
55 Ga0068864_100414561 3300005618 Bacteria 1282
56 Ga0068870_10104193 3300005840 Bacteria 1609
57 Ga0081455_10022035 3300005937 Bacteria 5964
58 Ga0070715_10129140 3300006163 Bacteria 1214
59 Ga0070716_100363373 3300006173 Bacteria 1029
60 Ga0070712_100088862 3300006175 Bacteria 2259
61 Ga0097621_100179064 3300006237 Bacteria 1831
62 Ga0075428_100263434 3300006844 Bacteria 1856
63 Ga0075433_10162375 3300006852 Unclassified 1989
64 Ga0075433_10494023 3300006852 Bacteria 1077
65 Ga0075435_100403618 3300007076 Bacteria 1176
66 Ga0075435_100431085 3300007076 Bacteria 1136
67 Ga0075435_100742736 3300007076 Bacteria 854
68 Ga0105240_10011956 3300009093 Bacteria 12032
69 Ga0105240_10060257 3300009093 Bacteria 4732
70 Ga0105245_10061740 3300009098 Bacteria 3379
71 Ga0105245_10226178 3300009098 Bacteria 1808
72 Ga0105245_10543305 3300009098 Bacteria 1183
73 Ga0114129_10161727 3300009147 Bacteria 3058
74 Ga0114129_10255478 3300009147 Unclassified 2351
75 Ga0114129_10293086 3300009147 Bacteria 2171
76 Ga0105241_10032616 3300009174 Bacteria 3906
77 Ga0105242_10110526 3300009176 Bacteria 2342
78 Ga0105238_10326987 3300009551 Bacteria 1519
79 Ga0105249_10351801 3300009553 Bacteria 1493
80 Ga0105239_10305299 3300010375 Unclassified 1792
81 Ga0105246_10099580 3300011119 Bacteria 2113
82 Ga0157373_10110175 3300013100 Bacteria 1936
83 Ga0157371_10107134 3300013102 Bacteria 1983
84 Ga0157371_10181637 3300013102 Bacteria 1505
85 Ga0157370_10109220 3300013104 Bacteria 2586
86 Ga0157369_10994810 3300013105 Bacteria 859
87 Ga0157369_11257750 3300013105 Unclassified 755
88 Ga0157374_10526709 3300013296 Bacteria 1188
89 Ga0163162_10397324 3300013306 Unclassified 1511
90 Ga0163162_10657287 3300013306 Bacteria 1172
91 Ga0157372_10095290 3300013307 Bacteria 3391
92 Ga0157372_10433151 3300013307 Bacteria 1533
93 Ga0157372_10435496 3300013307 Unclassified 1528
94 Ga0157375_10522384 3300013308 Bacteria 1350
95 Ga0157377_10033480 3300014745 Bacteria 2805
96 Ga0157377_10602406 3300014745 Bacteria 784
97 Ga0157376_10614077 3300014969 Bacteria 1084
98 Ga0157376_10875950 3300014969 Bacteria 915
99 Ga0182006_1062212 3300015261 Bacteria 1405
100 Ga0197907_10886183 3300020069 Bacteria 4149
101 Ga0206354_10728977 3300020081 Bacteria 2691
102 Ga0206354_11166200 3300020081 Bacteria 2434
103 Ga0206353_10709567 3300020082 Bacteria 2532
104 Ga0207699_10238030 3300025906 Bacteria 1249
105 Ga0207699_10724722 3300025906 Bacteria 729
106 Ga0207643_10085797 3300025908 Bacteria 1829
107 Ga0207705_10055635 3300025909 Bacteria 2853
108 Ga0207705_10154234 3300025909 Bacteria 1722
109 Ga0207684_10691015 3300025910 Bacteria 867
110 Ga0207654_10012848 3300025911 Bacteria 4296
111 Ga0207654_10359271 3300025911 Unclassified 1004
112 Ga0207707_10020158 3300025912 Bacteria 5820
113 Ga0207707_10125605 3300025912 Bacteria 2243
114 Ga0207707_10155576 3300025912 Bacteria 1999
115 Ga0207707_10194839 3300025912 Bacteria 1768
116 Ga0207695_10031863 3300025913 Bacteria 5776
117 Ga0207695_10040842 3300025913 Bacteria 4969
118 Ga0207693_10037988 3300025915 Bacteria 3793
119 Ga0207693_10041627 3300025915 Bacteria 3616
120 Ga0207663_10396857 3300025916 Bacteria 1054
121 Ga0207663_10533480 3300025916 Bacteria 915
122 Ga0207660_10025141 3300025917 Bacteria 4040
123 Ga0207660_10061578 3300025917 Bacteria 2701
124 Ga0207660_10431722 3300025917 Unclassified 1064
125 Ga0207657_10016744 3300025919 Bacteria 7058
126 Ga0207657_10030371 3300025919 Bacteria 4905
127 Ga0207657_10033430 3300025919 Bacteria 4636
128 Ga0207657_10044921 3300025919 Bacteria 3881
129 Ga0207649_10020446 3300025920 Bacteria 3797
130 Ga0207649_10111754 3300025920 Bacteria 1827
131 Ga0207652_10009237 3300025921 Bacteria 7931
132 Ga0207652_10026768 3300025921 Bacteria 4806
133 Ga0207652_10174559 3300025921 Bacteria 1930
134 Ga0207652_10182112 3300025921 Bacteria 1888
135 Ga0207652_10291650 3300025921 Bacteria 1472
136 Ga0207652_10296695 3300025921 Viruses 1459
137 Ga0207687_10792763 3300025927 Bacteria 808
138 Ga0207700_10134108 3300025928 Bacteria 2026
139 Ga0207700_10202707 3300025928 Bacteria 1673
140 Ga0207700_10646557 3300025928 Bacteria 943
141 Ga0207664_10027204 3300025929 Bacteria 4333
142 Ga0207664_10049399 3300025929 Bacteria 3312
143 Ga0207664_10049577 3300025929 Bacteria 3307
144 Ga0207644_10343966 3300025931 Bacteria 1210
145 Ga0207690_10391035 3300025932 Unclassified 1107
146 Ga0207686_10042227 3300025934 Bacteria 2786
147 Ga0207669_10128716 3300025937 Bacteria 1735
148 Ga0207665_10612985 3300025939 Bacteria 851
149 Ga0207661_10002588 3300025944 Bacteria 12440
150 Ga0207661_10003871 3300025944 Bacteria 10436
151 Ga0207661_10045402 3300025944 Bacteria 3478
152 Ga0207661_10581976 3300025944 Unclassified 1027
153 Ga0207679_10322273 3300025945 Bacteria 1338
154 Ga0207658_10008339 3300025986 Bacteria 7056
155 Ga0207677_10047825 3300026023 Bacteria 2875
156 Ga0207678_10281165 3300026067 Bacteria 1428
157 Ga0207702_10035677 3300026078 Bacteria 4158
158 Ga0207702_10143494 3300026078 Bacteria 2164
159 Ga0207702_11082892 3300026078 Bacteria 795
160 Ga0207683_10007827 3300026121 Bacteria 9148
161 Ga0207683_10667178 3300026121 Bacteria 963
162 Ga0207698_10209580 3300026142 Unclassified 1752
163 Ga0265319_1005681 3300028563 Bacteria 5922
164 Ga0265322_10026683 3300028654 Bacteria 1651
165 Ga0265338_10008527 3300028800 Bacteria 12416
166 Ga0265338_10161169 3300028800 Bacteria 1732
167 Ga0265325_10094519 3300031241 Bacteria 1470
168 Ga0265325_10128002 3300031241 Bacteria 1218
169 Ga0265339_10056474 3300031249 Bacteria 2126
170 Ga0265316_10035332 3300031344 Bacteria 4050
171 Ga0307408_100038815 3300031548 Bacteria 3362
172 Ga0265313_10082935 3300031595 Bacteria 1452
173 Ga0265313_10083915 3300031595 Bacteria 1442
174 Ga0265342_10011318 3300031712 Bacteria 6116
175 Ga0307405_10441183 3300031731 Bacteria 1030
176 Ga0307413_10258755 3300031824 Bacteria 1296
177 Ga0307406_10016699 3300031901 Bacteria 4272
178 Ga0307406_10022635 3300031901 Bacteria 3730
179 Ga0307407_10135126 3300031903 Bacteria 1583
180 Ga0307409_100342335 3300031995 Bacteria 1408
181 Ga0307409_100430361 3300031995 Bacteria 1268
182 Ga0307409_100473818 3300031995 Bacteria 1213
183 Ga0307409_100678308 3300031995 Bacteria 1027
184 Ga0307416_100009686 3300032002 Bacteria 6325
185 Ga0307416_100116684 3300032002 Bacteria 2367
186 Ga0307414_10072906 3300032004 Bacteria 2482
187 Ga0307414_10656005 3300032004 Bacteria 946
188 Ga0307411_10024874 3300032005 Bacteria 3577
189 Ga0307415_100023098 3300032126 Bacteria 3853
190 Ga0307415_100115255 3300032126 Unclassified 2002
191 Ga0373943_0218824 3300035170 Unclassified 1060
192 Ga0373931_0216763 3300035691 Unclassified 1151
193 Ga0373937_0100742 3300036401 Unclassified 2681
194 Ga0373937_0529413 3300036401 Bacteria 1120
195 Ga0395899_0021905 3300037312 Bacteria 4847
196 Ga0395900_0145577 3300037418 Bacteria 2423
197 Ga0395900_0750770 3300037418 Bacteria 906
198 Ga0395900_1041885 3300037418 Unclassified 737
199 Ga0395898_0012878 3300037466 Bacteria 8628
200 Ga0395898_0085740 3300037466 Bacteria 3036
201 Ga0395898_0242793 3300037466 Unclassified 1718
202 Ga0395898_0266229 3300037466 Bacteria 1635
203 Ga0395898_0391203 3300037466 Bacteria 1325
204 Ga0395898_1064541 3300037466 Bacteria 743
205 Ga0395905_0009133 3300037471 Bacteria 9714
206 Ga0395905_0037386 3300037471 Bacteria 4558
207 Ga0395905_0073598 3300037471 Unclassified 3203
208 Ga0395905_0281000 3300037471 Bacteria 1551
209 Ga0395905_0505798 3300037471 Unclassified 1108
210 Ga0395901_0017539 3300038443 Bacteria 7308
211 Ga0395901_0215617 3300038443 Unclassified 2008
212 Ga0395901_0758945 3300038443 Unclassified 962
213 Ga0439439_0001123 3300041406 Bacteria 5131
214 Ga0439461_0025863 3300041410 Bacteria 1194
215 Ga0450920_050022 3300042122 Bacteria 838
216 Ga0450923_040674 3300042125 Unclassified 976
217 Ga0439446_0002922 3300042156 Bacteria 4171
218 Ga0439434_0009207 3300042435 Bacteria 2903
219 Ga0466961_0267705 3300044693 Bacteria 1047
220 Ga0466961_0306104 3300044693 Bacteria 970
221 Ga0466963_0019067 3300044694 Bacteria 4295
222 Ga0466963_0226059 3300044694 Bacteria 1311
223 Ga0466963_0246849 3300044694 Bacteria 1252
224 Ga0466963_0441733 3300044694 Bacteria 918
225 Ga0466957_0057259 3300044842 Bacteria 2385
226 Ga0466958_0000597 3300045836 Bacteria 15415
227 Ga0466958_0145395 3300045836 Bacteria 1494
228 Ga0466967_0015196 3300045976 Bacteria 6028
229 Ga0466967_0019691 3300045976 Bacteria 5433
230 Ga0466967_0028163 3300045976 Bacteria 4686
231 Ga0466967_0034721 3300045976 Bacteria 4284
232 Ga0466967_0060777 3300045976 Bacteria 3350
233 Ga0466967_0109655 3300045976 Bacteria 2534
234 Ga0466967_0140724 3300045976 Bacteria 2247
235 Ga0466967_0176552 3300045976 Unclassified 2012
236 Ga0466967_0276011 3300045976 Bacteria 1612
237 Ga0466967_0349555 3300045976 Bacteria 1431
238 Ga0466967_1480264 3300045976 Unclassified 676
239 Ga0495603_0254230 3300046455 Unclassified 1012
240 Ga0495651_0665973 3300046462 Bacteria 651
241 Ga0495608_0163834 3300046511 Bacteria 1413
242 Ga0495656_0121895 3300046615 Bacteria 1232
243 Ga0495634_0220138 3300046642 Bacteria 1172
244 Ga0495671_0191884 3300046692 Unclassified 992
245 Ga0495604_0186249 3300047317 Bacteria 1449
246 Ga0495680_0471524 3300047322 Bacteria 856
247 Ga0495675_0263082 3300047444 Bacteria 1033
248 Ga0495602_0299454 3300048088 Bacteria 1177
249 Ga0496100_0283209 3300048903 Bacteria 1236
250 Ga0496100_0350715 3300048903 Bacteria 1114
251 Ga0496100_0562318 3300048903 Bacteria 883
252 Ga0496101_0002131 3300048904 Bacteria 12072
253 Ga0496101_0003259 3300048904 Bacteria 10086
254 Ga0496101_0023058 3300048904 Bacteria 4295
255 Ga0496102_0007811 3300048905 Bacteria 9145
256 Ga0496102_0008095 3300048905 Bacteria 8992
257 Ga0496102_0115265 3300048905 Bacteria 2507
258 Ga0496103_0026731 3300048906 Bacteria 3492
259 Ga0496103_0041942 3300048906 Bacteria 2814
260 Ga0496103_0080679 3300048906 Bacteria 2046
261 Ga0496104_0002095 3300048907 Bacteria 17320
262 Ga0496104_0004838 3300048907 Bacteria 11737
263 Ga0496104_0069337 3300048907 Bacteria 3351
264 Ga0496105_0000506 3300048908 Bacteria 25663
265 Ga0496105_0010555 3300048908 Bacteria 7266
266 Ga0496105_0014364 3300048908 Bacteria 6301
267 Ga0496106_0087023 3300048909 Bacteria 2407
268 Ga0496106_0117925 3300048909 Bacteria 2072
269 Ga0496107_0022757 3300048910 Bacteria 4430
270 Ga0496107_0125724 3300048910 Bacteria 1891
271 Ga0496108_0006329 3300048911 Bacteria 9597
272 Ga0496108_0057458 3300048911 Bacteria 3269
273 Ga0496108_0972302 3300048911 Bacteria 726
274 Ga0496109_0002926 3300048912 Bacteria 14274
275 Ga0496109_0094232 3300048912 Bacteria 2771
276 Ga0496110_0003086 3300048913 Bacteria 12631
277 Ga0496110_0031157 3300048913 Bacteria 4600
278 Ga0496110_0087522 3300048913 Bacteria 2782
279 Ga0496111_0001558 3300048914 Bacteria 13223
280 Ga0496111_0003945 3300048914 Bacteria 9310
281 Ga0496111_0034423 3300048914 Bacteria 3617
282 Ga0496112_0069208 3300048915 Bacteria 3487
283 Ga0496113_0080796 3300048916 Unclassified 2491
284 Ga0496113_0681144 3300048916 Bacteria 821
285 Ga0496113_0892996 3300048916 Bacteria 703
286 Ga0496114_0005204 3300048917 Bacteria 10157
287 Ga0496114_0008486 3300048917 Bacteria 8141
288 Ga0496114_0068260 3300048917 Bacteria 2984
289 Ga0496114_0107532 3300048917 Bacteria 2387
290 Ga0496115_0069198 3300048918 Bacteria 2859
291 Ga0496115_0188238 3300048918 Bacteria 1705
292 Ga0501032_0089187 3300049569 Bacteria 2047
293 Ga0501033_0030637 3300049570 Bacteria 4042
294 Ga0501036_0003627 3300049572 Bacteria 12347
295 Ga0501037_0087823 3300049573 Bacteria 2250
296 Ga0501038_0041119 3300049574 Bacteria 4032
297 Ga0501039_0010975 3300049575 Bacteria 6905
298 Ga0501039_0505553 3300049575 Bacteria 949
299 Ga0501040_0014329 3300049576 Bacteria 5223
300 Ga0501041_0007056 3300049577 Bacteria 6590
301 Ga0501041_0090156 3300049577 Bacteria 1893
302 Ga0501042_0014414 3300049578 Bacteria 5395
303 Ga0501043_0023664 3300049579 Bacteria 4817
304 Ga0501046_0028587 3300049580 Bacteria 4539
305 Ga0501046_0217570 3300049580 Bacteria 1416
306 Ga0501048_0100409 3300049582 Bacteria 2041
307 Ga0501067_0013638 3300049583 Bacteria 4499
308 Ga0501067_0054300 3300049583 Unclassified 2220
309 Ga0501068_0128226 3300049584 Bacteria 1585
310 Ga0501070_0205443 3300049586 Bacteria 1617
311 Ga0501071_0045958 3300049587 Bacteria 3135
312 Ga0501072_0010819 3300049588 Bacteria 6952
313 Ga0501072_0030389 3300049588 Bacteria 4224
314 Ga0501073_0064735 3300049589 Bacteria 2550
315 Ga0501074_0125177 3300049590 Bacteria 1838
316 Ga0501075_0068312 3300049591 Bacteria 2684
317 Ga0501075_0233549 3300049591 Bacteria 1402
318 Ga0501076_0002001 3300049592 Bacteria 13941
319 Ga0501077_0011979 3300049593 Bacteria 5426
320 Ga0501079_0033062 3300049741 Bacteria 3977
321 Ga0501079_0332443 3300049741 Bacteria 1190
322 Ga0501081_0015180 3300049743 Bacteria 5081
323 Ga0501083_0005563 3300049744 Bacteria 8934
324 Ga0501083_0115661 3300049744 Bacteria 1761
325 Ga0501035_0044445 3300049822 Bacteria 4000
326 Ga0501044_0099480 3300049823 Bacteria 2927
327 Ga0501045_0039214 3300049824 Bacteria 3447
328 Ga0501045_0643957 3300049824 Bacteria 783
329 nmdc:mga05p37_102875_c1 3300050507 Bacteria 3517
330 nmdc:mga0n895_605977_c1 3300050512 Bacteria 1097
331 nmdc:mga0rr50_355146_c1 3300050513 Bacteria 1233
332 nmdc:mga0a205_133026_c1 3300050515 Unclassified 2387
333 nmdc:mga0a205_147793_c1 3300050515 Bacteria 2250
334 nmdc:mga0a205_224367_c1 3300050515 Bacteria 1764
335 Ga0501084_0009274 3300054114 Bacteria 8140
336 Ga0501084_0170828 3300054114 Bacteria 1835
337 Ga0501084_0208901 3300054114 Bacteria 1647
338 Ga0501082_0082776 3300060353 Bacteria 2769
339 Ga0501082_0134002 3300060353 Bacteria 2149
340 Ga0501082_0419315 3300060353 Bacteria 1169
341 Ga0501082_0705904 3300060353 Unclassified 883
342 Ga0530510_0013115 3300061734 Bacteria 5829
343 Ga0265318_10026515
344 rootH1_10094344
345 Ga0070658_10539665
346 Ga0070683_100009393
347 Ga0070683_100022110
348 Ga0070683_100065026
349 Ga0070683_100614078
350 Ga0070690_100543187
351 Ga0070680_100552426
352 Ga0070682_100025874
353 Ga0070682_100478920
354 Ga0070660_100025081
355 Ga0070660_100027280
356 Ga0070660_100028534
357 Ga0070660_100033835
358 Ga0070687_100087489
359 Ga0070661_100328290
360 Ga0070661_100659179
361 Ga0070671_100800891
362 Ga0070671_101189140
363 Ga0070674_100158103
364 Ga0070673_100242401
365 Ga0070659_100101241
366 Ga0070709_10232453
367 Ga0070713_100713865
368 Ga0070711_100218254
369 Ga0070708_100620753
370 Ga0070663_100246298
371 Ga0070678_100043953
372 Ga0070681_10038675
373 Ga0070681_10039463
374 Ga0070681_10145210
375 Ga0070681_10185934
376 Ga0070681_10211244
377 Ga0070706_100049438
378 Ga0070698_100224121
379 Ga0070699_100061609
380 Ga0070679_100110078
381 Ga0070679_100117137
382 Ga0070679_100242416
383 Ga0070679_100283613
384 Ga0070679_100325623
385 Ga0070679_100636763
386 Ga0070684_100070977
387 Ga0070684_100087304
388 Ga0070684_100937703
389 Ga0070693_100056457
390 Ga0068855_100059990
391 Ga0068855_100163212
392 Ga0070664_100382415
393 Ga0068857_100385511
394 Ga0068856_100012546
395 Ga0068856_100050875
396 Ga0068852_100047751
397 Ga0068864_100414561
398 Ga0068870_10104193
399 Ga0081455_10022035
400 Ga0070715_10129140
401 Ga0070716_100363373
402 Ga0070712_100088862
403 Ga0097621_100179064
404 Ga0075428_100263434
405 Ga0075433_10162375
406 Ga0075433_10494023
407 Ga0075435_100403618
408 Ga0075435_100431085
409 Ga0075435_100742736
410 Ga0105240_10011956
411 Ga0105240_10060257
412 Ga0105245_10061740
413 Ga0105245_10226178
414 Ga0105245_10543305
415 Ga0114129_10161727
416 Ga0114129_10255478
417 Ga0114129_10293086
418 Ga0105241_10032616
419 Ga0105242_10110526
420 Ga0105238_10326987
421 Ga0105249_10351801
422 Ga0105239_10305299
423 Ga0105246_10099580
424 Ga0157373_10110175
425 Ga0157371_10107134
426 Ga0157371_10181637
427 Ga0157370_10109220
428 Ga0157369_10994810
429 Ga0157369_11257750
430 Ga0157374_10526709
431 Ga0163162_10397324
432 Ga0163162_10657287
433 Ga0157372_10095290
434 Ga0157372_10433151
435 Ga0157372_10435496
436 Ga0157375_10522384
437 Ga0157377_10033480
438 Ga0157377_10602406
439 Ga0157376_10614077
440 Ga0157376_10875950
441 Ga0182006_1062212
442 Ga0197907_10886183
443 Ga0206354_10728977
444 Ga0206354_11166200
445 Ga0206353_10709567
446 Ga0207699_10238030
447 Ga0207699_10724722
448 Ga0207643_10085797
449 Ga0207705_10055635
450 Ga0207705_10154234
451 Ga0207684_10691015
452 Ga0207654_10012848
453 Ga0207654_10359271
454 Ga0207707_10020158
455 Ga0207707_10125605
456 Ga0207707_10155576
457 Ga0207707_10194839
458 Ga0207695_10031863
459 Ga0207695_10040842
460 Ga0207693_10037988
461 Ga0207693_10041627
462 Ga0207663_10396857
463 Ga0207663_10533480
464 Ga0207660_10025141
465 Ga0207660_10061578
466 Ga0207660_10431722
467 Ga0207657_10016744
468 Ga0207657_10030371
469 Ga0207657_10033430
470 Ga0207657_10044921
471 Ga0207649_10020446
472 Ga0207649_10111754
473 Ga0207652_10009237
474 Ga0207652_10026768
475 Ga0207652_10174559
476 Ga0207652_10182112
477 Ga0207652_10291650
478 Ga0207652_10296695
479 Ga0207687_10792763
480 Ga0207700_10134108
481 Ga0207700_10202707
482 Ga0207700_10646557
483 Ga0207664_10027204
484 Ga0207664_10049399
485 Ga0207664_10049577
486 Ga0207644_10343966
487 Ga0207690_10391035
488 Ga0207686_10042227
489 Ga0207669_10128716
490 Ga0207665_10612985
491 Ga0207661_10002588
492 Ga0207661_10003871
493 Ga0207661_10045402
494 Ga0207661_10581976
495 Ga0207679_10322273
496 Ga0207658_10008339
497 Ga0207677_10047825
498 Ga0207678_10281165
499 Ga0207702_10035677
500 Ga0207702_10143494
501 Ga0207702_11082892
502 Ga0207683_10007827
503 Ga0207683_10667178
504 Ga0207698_10209580
505 Ga0265319_1005681
506 Ga0265322_10026683
507 Ga0265338_10008527
508 Ga0265338_10161169
509 Ga0265325_10094519
510 Ga0265325_10128002
511 Ga0265339_10056474
512 Ga0265316_10035332
513 Ga0307408_100038815
514 Ga0265313_10082935
515 Ga0265313_10083915
516 Ga0265342_10011318
517 Ga0307405_10441183
518 Ga0307413_10258755
519 Ga0307406_10016699
520 Ga0307406_10022635
521 Ga0307407_10135126
522 Ga0307409_100342335
523 Ga0307409_100430361
524 Ga0307409_100473818
525 Ga0307409_100678308
526 Ga0307416_100009686
527 Ga0307416_100116684
528 Ga0307414_10072906
529 Ga0307414_10656005
530 Ga0307411_10024874
531 Ga0307415_100023098
532 Ga0307415_100115255
533 Ga0373943_0218824
534 Ga0373931_0216763
535 Ga0373937_0100742
536 Ga0373937_0529413
537 Ga0395899_0021905
538 Ga0395900_0145577
539 Ga0395900_0750770
540 Ga0395900_1041885
541 Ga0395898_0012878
542 Ga0395898_0085740
543 Ga0395898_0242793
544 Ga0395898_0266229
545 Ga0395898_0391203
546 Ga0395898_1064541
547 Ga0395905_0009133
548 Ga0395905_0037386
549 Ga0395905_0073598
550 Ga0395905_0281000
551 Ga0395905_0505798
552 Ga0395901_0017539
553 Ga0395901_0215617
554 Ga0395901_0758945
555 Ga0439439_0001123
556 Ga0439461_0025863
557 Ga0450920_050022
558 Ga0450923_040674
559 Ga0439446_0002922
560 Ga0439434_0009207
561 Ga0466961_0267705
562 Ga0466961_0306104
563 Ga0466963_0019067
564 Ga0466963_0226059
565 Ga0466963_0246849
566 Ga0466963_0441733
567 Ga0466957_0057259
568 Ga0466958_0000597
569 Ga0466958_0145395
570 Ga0466967_0015196
571 Ga0466967_0019691
572 Ga0466967_0028163
573 Ga0466967_0034721
574 Ga0466967_0060777
575 Ga0466967_0109655
576 Ga0466967_0140724
577 Ga0466967_0176552
578 Ga0466967_0276011
579 Ga0466967_0349555
580 Ga0466967_1480264
581 Ga0495603_0254230
582 Ga0495651_0665973
583 Ga0495608_0163834
584 Ga0495656_0121895
585 Ga0495634_0220138
586 Ga0495671_0191884
587 Ga0495604_0186249
588 Ga0495680_0471524
589 Ga0495675_0263082
590 Ga0495602_0299454
591 Ga0496100_0283209
592 Ga0496100_0350715
593 Ga0496100_0562318
594 Ga0496101_0002131
595 Ga0496101_0003259
596 Ga0496101_0023058
597 Ga0496102_0007811
598 Ga0496102_0008095
599 Ga0496102_0115265
600 Ga0496103_0026731
601 Ga0496103_0041942
602 Ga0496103_0080679
603 Ga0496104_0002095
604 Ga0496104_0004838
605 Ga0496104_0069337
606 Ga0496105_0000506
607 Ga0496105_0010555
608 Ga0496105_0014364
609 Ga0496106_0087023
610 Ga0496106_0117925
611 Ga0496107_0022757
612 Ga0496107_0125724
613 Ga0496108_0006329
614 Ga0496108_0057458
615 Ga0496108_0972302
616 Ga0496109_0002926
617 Ga0496109_0094232
618 Ga0496110_0003086
619 Ga0496110_0031157
620 Ga0496110_0087522
621 Ga0496111_0001558
622 Ga0496111_0003945
623 Ga0496111_0034423
624 Ga0496112_0069208
625 Ga0496113_0080796
626 Ga0496113_0681144
627 Ga0496113_0892996
628 Ga0496114_0005204
629 Ga0496114_0008486
630 Ga0496114_0068260
631 Ga0496114_0107532
632 Ga0496115_0069198
633 Ga0496115_0188238
634 Ga0501032_0089187
635 Ga0501033_0030637
636 Ga0501036_0003627
637 Ga0501037_0087823
638 Ga0501038_0041119
639 Ga0501039_0010975
640 Ga0501039_0505553
641 Ga0501040_0014329
642 Ga0501041_0007056
643 Ga0501041_0090156
644 Ga0501042_0014414
645 Ga0501043_0023664
646 Ga0501046_0028587
647 Ga0501046_0217570
648 Ga0501048_0100409
649 Ga0501067_0013638
650 Ga0501067_0054300
651 Ga0501068_0128226
652 Ga0501070_0205443
653 Ga0501071_0045958
654 Ga0501072_0010819
655 Ga0501072_0030389
656 Ga0501073_0064735
657 Ga0501074_0125177
658 Ga0501075_0068312
659 Ga0501075_0233549
660 Ga0501076_0002001
661 Ga0501077_0011979
662 Ga0501079_0033062
663 Ga0501079_0332443
664 Ga0501081_0015180
665 Ga0501083_0005563
666 Ga0501083_0115661
667 Ga0501035_0044445
668 Ga0501044_0099480
669 Ga0501045_0039214
670 Ga0501045_0643957
671 nmdc:mga05p37_102875_c1
672 nmdc:mga0n895_605977_c1
673 nmdc:mga0rr50_355146_c1
674 nmdc:mga0a205_133026_c1
675 nmdc:mga0a205_147793_c1
676 nmdc:mga0a205_224367_c1
677 Ga0501084_0009274
678 Ga0501084_0170828
679 Ga0501084_0208901
680 Ga0501082_0082776
681 Ga0501082_0134002
682 Ga0501082_0419315
683 Ga0501082_0705904
684 Ga0530510_0013115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

27

212

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nru-assembly5.cif.gz_E crystal structure of the alpha-ribazole phosphatase from shigella flexneri 0.8774 11 168
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8592 11 172
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8532 11 185
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8518 11 185
3e9d-assembly2.cif.gz_B structure of full-length tigar from danio rerio 0.8411 11 163
ID Description Score Start End Superfamily
af_O06240_1_204_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8538 11 185 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8532 11 185 3.40.50.1240
af_Q12040_9_224_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8529 8 187 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8518 11 185 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8497 11 185 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7Y5X3L7-F1-model_v4 Histidine phosphatase family protein 0.9952 10 203 GO:0005737
GO:0006096
GO:0016791
GO:0016853
AF-A0A537WWT3-F1-model_v4 Histidine phosphatase family protein 0.9896 10 168 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A7Y5X3L7-F1-model_v4 Histidine phosphatase family protein 0.985 10 203 GO:0005737
GO:0006096
GO:0016791
GO:0016853
AF-A0A538GXI6-F1-model_v4 Histidine phosphatase family protein 0.9813 4 201 GO:0005737
GO:0016791
AF-A0A538FNY5-F1-model_v4 Histidine phosphatase family protein 0.979 72 202

Map