F415193

General Info

Members Datasets Scaffolds Average Seq Length
342 196 684 206

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10836155|Ga0207640_108361551
Length 246
Sequence MAASPRAKPLLRGVLHQVAFFVAVGLGIPLVVTADAGKARLSAAVFASCVALCFGASALYHRPTWKPRARSWFARLDHAGIYLLIAGTYTPFGLLVLSRGWAIPVLAIVWTGAAVAILTKLFWPGVPKRISAGIGLALGWVCVAAISQLLKLPVAGLVLLLAGGAAYSAGAVVYARRKPDPYPRVFGYHELFHLLTLVAAGCQYGAIAFCCGLLMKLPVVNVDPWKKVTSPLAEANIWLMPVKFVP

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.14
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10836155 3300025981 Bacteria 800
2 Ga0070658_10113036 3300005327 Bacteria 2251
3 Ga0070683_100103374 3300005329 Bacteria 2684
4 Ga0070680_100001544 3300005336 Bacteria 16796
5 Ga0070660_100004576 3300005339 Bacteria 9562
6 Ga0070667_100305438 3300005367 Bacteria 1433
7 Ga0070714_100070010 3300005435 Bacteria 3031
8 Ga0070714_100085708 3300005435 Unclassified 2752
9 Ga0070714_100101302 3300005435 Bacteria 2537
10 Ga0070713_100488414 3300005436 Bacteria 1161
11 Ga0070711_101025013 3300005439 Bacteria 709
12 Ga0070705_100134931 3300005440 Bacteria 1615
13 Ga0070694_100077740 3300005444 Bacteria 2300
14 Ga0070678_100170964 3300005456 Unclassified 1770
15 Ga0070681_10025702 3300005458 Bacteria 5921
16 Ga0070681_10088159 3300005458 Bacteria 3055
17 Ga0070681_10093249 3300005458 Bacteria 2960
18 Ga0070681_10109690 3300005458 Bacteria 2699
19 Ga0070706_100249574 3300005467 Unclassified 1657
20 Ga0070707_100020589 3300005468 Bacteria 6224
21 Ga0070698_100048165 3300005471 Bacteria 4355
22 Ga0070699_100060427 3300005518 Unclassified 3284
23 Ga0070679_100037203 3300005530 Bacteria 4833
24 Ga0070679_100044502 3300005530 Bacteria 4422
25 Ga0070679_100232818 3300005530 Bacteria 1801
26 Ga0070684_100832935 3300005535 Bacteria 863
27 Ga0070697_100588248 3300005536 Bacteria 977
28 Ga0070695_100060929 3300005545 Bacteria 2446
29 Ga0070696_100155116 3300005546 Bacteria 1683
30 Ga0068855_100056858 3300005563 Bacteria 4587
31 Ga0068855_100111303 3300005563 Bacteria 3143
32 Ga0070664_100473730 3300005564 Bacteria 1152
33 Ga0068857_100023824 3300005577 Bacteria 5389
34 Ga0068857_100454606 3300005577 Unclassified 1198
35 Ga0068852_100072859 3300005616 Bacteria 3020
36 Ga0081455_10008677 3300005937 Bacteria 10529
37 Ga0081455_10010002 3300005937 Bacteria 9695
38 Ga0081455_10040709 3300005937 Bacteria 4095
39 Ga0081455_10077016 3300005937 Bacteria 2745
40 Ga0081455_10124285 3300005937 Bacteria 2028
41 Ga0081455_10361717 3300005937 Bacteria 1020
42 Ga0081538_10000089 3300005981 Bacteria 88801
43 Ga0081538_10007715 3300005981 Bacteria 9271
44 Ga0081538_10036685 3300005981 Bacteria 3194
45 Ga0070717_10044292 3300006028 Bacteria 3633
46 Ga0075432_10065727 3300006058 Bacteria 1297
47 Ga0070716_100013274 3300006173 Bacteria 4195
48 Ga0068871_100414838 3300006358 Unclassified 1201
49 Ga0068871_100980960 3300006358 Unclassified 786
50 Ga0075428_100173129 3300006844 Unclassified 2339
51 Ga0075436_100101859 3300006914 Bacteria 2000
52 Ga0075435_100025048 3300007076 Bacteria 4640
53 Ga0105240_10290123 3300009093 Bacteria 1876
54 Ga0105240_10458202 3300009093 Bacteria 1425
55 Ga0111539_10014735 3300009094 Bacteria 9753
56 Ga0111539_10147920 3300009094 Bacteria 2750
57 Ga0111539_10384083 3300009094 Bacteria 1635
58 Ga0105245_10053050 3300009098 Bacteria 3639
59 Ga0114129_10038474 3300009147 Bacteria 6747
60 Ga0114129_10281144 3300009147 Unclassified 2223
61 Ga0105243_10745248 3300009148 Bacteria 960
62 Ga0105241_10310492 3300009174 Bacteria 1356
63 Ga0105241_10374554 3300009174 Unclassified 1242
64 Ga0105242_10287642 3300009176 Bacteria 1495
65 Ga0105239_10332093 3300010375 Unclassified 1715
66 Ga0105246_10054351 3300011119 Bacteria 2759
67 Ga0157370_10007916 3300013104 Bacteria 11510
68 Ga0157372_10520368 3300013307 Bacteria 1387
69 Ga0206356_11789756 3300020070 Bacteria 1831
70 Ga0206354_10842837 3300020081 Bacteria 2057
71 Ga0206354_11405613 3300020081 Bacteria 3442
72 Ga0206353_10039564 3300020082 Bacteria 6387
73 Ga0206353_10522570 3300020082 Bacteria 9063
74 Ga0207653_10051474 3300025885 Unclassified 1372
75 Ga0207692_10265291 3300025898 Bacteria 1034
76 Ga0207699_10048125 3300025906 Bacteria 2503
77 Ga0207684_10091967 3300025910 Bacteria 2586
78 Ga0207684_10321161 3300025910 Unclassified 1334
79 Ga0207707_10054870 3300025912 Bacteria 3468
80 Ga0207707_10061175 3300025912 Bacteria 3276
81 Ga0207707_10223663 3300025912 Bacteria 1638
82 Ga0207707_10307382 3300025912 Bacteria 1370
83 Ga0207660_10028773 3300025917 Bacteria 3805
84 Ga0207657_10004183 3300025919 Bacteria 15293
85 Ga0207657_10284642 3300025919 Bacteria 1312
86 Ga0207649_10061777 3300025920 Bacteria 2359
87 Ga0207652_10032253 3300025921 Bacteria 4401
88 Ga0207652_10104754 3300025921 Bacteria 2502
89 Ga0207652_10240083 3300025921 Bacteria 1633
90 Ga0207646_10000418 3300025922 Bacteria 56835
91 Ga0207687_10076345 3300025927 Bacteria 2407
92 Ga0207700_10034082 3300025928 Bacteria 3651
93 Ga0207664_10064436 3300025929 Bacteria 2931
94 Ga0207664_10269527 3300025929 Bacteria 1491
95 Ga0207690_10316183 3300025932 Bacteria 1226
96 Ga0207706_10045690 3300025933 Bacteria 3879
97 Ga0207686_10286204 3300025934 Bacteria 1219
98 Ga0207709_10231022 3300025935 Bacteria 1340
99 Ga0207704_10107798 3300025938 Unclassified 1875
100 Ga0207665_10008687 3300025939 Bacteria 6684
101 Ga0207691_10069022 3300025940 Bacteria 3193
102 Ga0207661_10163038 3300025944 Bacteria 1935
103 Ga0207667_10008268 3300025949 Bacteria 12383
104 Ga0207667_10152750 3300025949 Bacteria 2376
105 Ga0207658_10051851 3300025986 Bacteria 3025
106 Ga0207639_10204963 3300026041 Bacteria 1694
107 Ga0207708_10021996 3300026075 Bacteria 4813
108 Ga0207648_10070405 3300026089 Bacteria 3049
109 Ga0207674_10053078 3300026116 Bacteria 4132
110 Ga0207675_100033155 3300026118 Bacteria 4812
111 Ga0207683_10048778 3300026121 Bacteria 3706
112 Ga0207698_10349928 3300026142 Bacteria 1395
113 Ga0207428_10115031 3300027907 Bacteria 2067
114 Ga0207428_10216291 3300027907 Bacteria 1438
115 Ga0265319_1032457 3300028563 Bacteria 1810
116 Ga0265319_1122745 3300028563 Bacteria 809
117 Ga0265334_10017364 3300028573 Bacteria 2974
118 Ga0265318_10070888 3300028577 Bacteria 1291
119 Ga0265318_10113831 3300028577 Bacteria 995
120 Ga0265322_10046629 3300028654 Bacteria 1232
121 Ga0265338_10019125 3300028800 Bacteria 7289
122 Ga0265338_10109220 3300028800 Bacteria 2232
123 Ga0265338_10136964 3300028800 Bacteria 1923
124 Ga0265338_10452074 3300028800 Bacteria 909
125 Ga0265338_10464198 3300028800 Bacteria 895
126 Ga0265324_10027151 3300029957 Bacteria 2023
127 Ga0265325_10127243 3300031241 Bacteria 1223
128 Ga0265327_10014303 3300031251 Bacteria 5199
129 Ga0265327_10056010 3300031251 Bacteria 2033
130 Ga0265316_10002383 3300031344 Bacteria 19561
131 Ga0307408_100235736 3300031548 Bacteria 1501
132 Ga0265313_10009085 3300031595 Bacteria 6502
133 Ga0265314_10001693 3300031711 Bacteria 23980
134 Ga0265314_10081337 3300031711 Bacteria 2135
135 Ga0265342_10059760 3300031712 Bacteria 2250
136 Ga0307405_10097827 3300031731 Bacteria 1960
137 Ga0307410_10005553 3300031852 Bacteria 6690
138 Ga0307406_10010446 3300031901 Bacteria 5236
139 Ga0307407_10001508 3300031903 Bacteria 8516
140 Ga0307416_100012932 3300032002 Bacteria 5649
141 Ga0307411_10058333 3300032005 Bacteria 2554
142 Ga0307415_100012666 3300032126 Bacteria 4886
143 Ga0373948_0003832 3300034817 Unclassified 2341
144 Ga0373928_0001262 3300035084 Unclassified 4983
145 Ga0373951_0008583 3300035091 Bacteria 2304
146 Ga0373932_0018867 3300035112 Bacteria 1790
147 Ga0373936_0086336 3300035113 Bacteria 1311
148 Ga0373945_0028542 3300035116 Bacteria 1955
149 Ga0373943_0064631 3300035170 Bacteria 1837
150 Ga0373943_0069860 3300035170 Unclassified 1776
151 Ga0373943_0082996 3300035170 Bacteria 1646
152 Ga0373946_0077935 3300035171 Bacteria 1445
153 Ga0373935_0033757 3300035692 Bacteria 3187
154 Ga0373935_0505599 3300035692 Unclassified 878
155 Ga0373927_0027747 3300035695 Bacteria 3697
156 Ga0373947_0004243 3300035725 Bacteria 8406
157 Ga0373947_0091038 3300035725 Bacteria 1902
158 Ga0373947_0246742 3300035725 Bacteria 1180
159 Ga0373925_0017711 3300037068 Bacteria 5168
160 Ga0373925_0114831 3300037068 Bacteria 2084
161 Ga0395900_0030029 3300037418 Bacteria 5579
162 Ga0395900_0278626 3300037418 Bacteria 1665
163 Ga0395900_0313336 3300037418 Bacteria 1552
164 Ga0395898_0005391 3300037466 Bacteria 13824
165 Ga0395898_0038386 3300037466 Bacteria 4747
166 Ga0395898_0041318 3300037466 Bacteria 4556
167 Ga0395898_0274389 3300037466 Bacteria 1608
168 Ga0395898_0874693 3300037466 Bacteria 837
169 Ga0395898_0877338 3300037466 Unclassified 836
170 Ga0395905_0401053 3300037471 Bacteria 1266
171 Ga0395905_0731713 3300037471 Bacteria 892
172 Ga0395901_0048750 3300038443 Bacteria 4399
173 Ga0395901_0054745 3300038443 Bacteria 4147
174 Ga0395901_0057070 3300038443 Bacteria 4061
175 Ga0395901_0145913 3300038443 Bacteria 2487
176 Ga0395901_0241333 3300038443 Bacteria 1885
177 Ga0395901_0665202 3300038443 Bacteria 1043
178 Ga0466963_0018830 3300044694 Bacteria 4323
179 Ga0466963_0040484 3300044694 Bacteria 3054
180 Ga0466963_0131804 3300044694 Bacteria 1727
181 Ga0466964_0013840 3300044706 Bacteria 3062
182 Ga0466971_0046938 3300044719 Bacteria 1941
183 Ga0466957_0100209 3300044842 Bacteria 1825
184 Ga0466958_0349060 3300045836 Bacteria 952
185 Ga0466967_0001829 3300045976 Bacteria 12801
186 Ga0466967_0010678 3300045976 Bacteria 6905
187 Ga0466967_0066628 3300045976 Bacteria 3209
188 Ga0466967_0248575 3300045976 Bacteria 1698
189 Ga0495592_0102051 3300046454 Bacteria 2043
190 Ga0495592_0150254 3300046454 Bacteria 1611
191 Ga0495580_0078612 3300046472 Bacteria 2301
192 Ga0495582_0210072 3300046473 Bacteria 1112
193 Ga0495605_0020513 3300046474 Bacteria 3511
194 Ga0495628_0141607 3300046516 Bacteria 1835
195 Ga0495663_0056583 3300046525 Bacteria 1225
196 Ga0495652_0522131 3300046529 Bacteria 820
197 Ga0495645_0073628 3300046543 Bacteria 2461
198 Ga0495599_0100101 3300046678 Bacteria 1807
199 Ga0495647_0047925 3300046681 Bacteria 1651
200 Ga0495658_0013273 3300046683 Bacteria 4192
201 Ga0495624_0078042 3300046690 Bacteria 2054
202 Ga0495624_0392708 3300046690 Bacteria 833
203 Ga0495589_0147842 3300046794 Bacteria 1123
204 Ga0495581_0003514 3300047315 Bacteria 8995
205 Ga0495581_0266679 3300047315 Bacteria 1001
206 Ga0495674_0155153 3300047319 Bacteria 1918
207 Ga0495676_0049150 3300047321 Bacteria 3394
208 Ga0495676_0103401 3300047321 Bacteria 2103
209 Ga0495680_0216562 3300047322 Bacteria 1369
210 Ga0495602_0054233 3300048088 Bacteria 3541
211 Ga0496101_0008830 3300048904 Bacteria 6594
212 Ga0496101_0254743 3300048904 Bacteria 1368
213 Ga0496101_0812681 3300048904 Bacteria 737
214 Ga0496102_0084691 3300048905 Bacteria 2926
215 Ga0496103_0284280 3300048906 Bacteria 1064
216 Ga0496103_0321313 3300048906 Unclassified 995
217 Ga0496104_0360498 3300048907 Bacteria 1366
218 Ga0496104_0484938 3300048907 Bacteria 1147
219 Ga0496105_0047729 3300048908 Bacteria 3534
220 Ga0496108_0005340 3300048911 Bacteria 10384
221 Ga0496109_0144771 3300048912 Bacteria 2223
222 Ga0496110_0709362 3300048913 Unclassified 908
223 Ga0496110_0788292 3300048913 Unclassified 854
224 Ga0496111_0101903 3300048914 Bacteria 2110
225 Ga0496112_0003066 3300048915 Bacteria 13688
226 Ga0496112_0022299 3300048915 Bacteria 6033
227 Ga0496113_0059909 3300048916 Bacteria 2868
228 Ga0496113_0264302 3300048916 Bacteria 1375
229 Ga0496114_0009116 3300048917 Bacteria 7866
230 Ga0496114_0090200 3300048917 Unclassified 2602
231 Ga0496115_0275927 3300048918 Bacteria 1380
232 Ga0501031_0000049 3300049568 Bacteria 65338
233 Ga0501031_0084092 3300049568 Bacteria 2074
234 Ga0501032_0041898 3300049569 Bacteria 3107
235 Ga0501033_0000383 3300049570 Bacteria 42550
236 Ga0501033_0167737 3300049570 Bacteria 1578
237 Ga0501034_0238016 3300049571 Bacteria 1767
238 Ga0501036_0002092 3300049572 Bacteria 15565
239 Ga0501036_0007938 3300049572 Bacteria 8685
240 Ga0501036_0090654 3300049572 Bacteria 2582
241 Ga0501036_0879023 3300049572 Bacteria 736
242 Ga0501037_0000177 3300049573 Bacteria 59495
243 Ga0501038_0001527 3300049574 Bacteria 21345
244 Ga0501039_0000349 3300049575 Bacteria 33069
245 Ga0501039_0016904 3300049575 Bacteria 5592
246 Ga0501039_0566509 3300049575 Bacteria 891
247 Ga0501039_0863400 3300049575 Bacteria 705
248 Ga0501040_0001031 3300049576 Bacteria 17685
249 Ga0501041_0000001 3300049577 Bacteria 96328
250 Ga0501041_0021610 3300049577 Bacteria 3855
251 Ga0501041_0120093 3300049577 Bacteria 1633
252 Ga0501041_0161510 3300049577 Bacteria 1401
253 Ga0501041_0245527 3300049577 Bacteria 1125
254 Ga0501041_0258240 3300049577 Bacteria 1095
255 Ga0501042_0000002 3300049578 Bacteria 79574
256 Ga0501042_0184646 3300049578 Bacteria 1504
257 Ga0501042_0246008 3300049578 Bacteria 1290
258 Ga0501042_0478271 3300049578 Bacteria 904
259 Ga0501043_0001753 3300049579 Bacteria 18698
260 Ga0501043_0054434 3300049579 Bacteria 3142
261 Ga0501043_0119006 3300049579 Bacteria 2071
262 Ga0501046_0000175 3300049580 Bacteria 65364
263 Ga0501046_0061623 3300049580 Bacteria 2932
264 Ga0501046_0089750 3300049580 Bacteria 2365
265 Ga0501046_0217499 3300049580 Bacteria 1416
266 Ga0501046_0329959 3300049580 Bacteria 1110
267 Ga0501047_0266814 3300049581 Bacteria 1558
268 Ga0501048_0001825 3300049582 Bacteria 16161
269 Ga0501048_0022484 3300049582 Bacteria 4612
270 Ga0501048_0339727 3300049582 Bacteria 1070
271 Ga0501048_0506629 3300049582 Bacteria 865
272 Ga0501068_0000857 3300049584 Bacteria 15824
273 Ga0501069_0047962 3300049585 Bacteria 2372
274 Ga0501069_0074514 3300049585 Bacteria 1904
275 Ga0501070_0006724 3300049586 Bacteria 9792
276 Ga0501070_0670681 3300049586 Bacteria 822
277 Ga0501070_0722818 3300049586 Bacteria 786
278 Ga0501070_0886116 3300049586 Bacteria 697
279 Ga0501071_0001932 3300049587 Bacteria 12344
280 Ga0501071_0005191 3300049587 Bacteria 8341
281 Ga0501071_0316044 3300049587 Bacteria 1185
282 Ga0501071_0431912 3300049587 Unclassified 1007
283 Ga0501072_0000074 3300049588 Bacteria 72534
284 Ga0501072_0003869 3300049588 Bacteria 11317
285 Ga0501072_0133204 3300049588 Bacteria 1982
286 Ga0501072_0292776 3300049588 Bacteria 1294
287 Ga0501073_0000105 3300049589 Bacteria 53900
288 Ga0501073_0222238 3300049589 Bacteria 1305
289 Ga0501074_0001607 3300049590 Bacteria 15336
290 Ga0501074_0225124 3300049590 Bacteria 1335
291 Ga0501074_0361796 3300049590 Bacteria 1029
292 Ga0501075_0000056 3300049591 Bacteria 48279
293 Ga0501075_0002262 3300049591 Bacteria 12762
294 Ga0501075_0131708 3300049591 Bacteria 1905
295 Ga0501076_0000039 3300049592 Bacteria 63618
296 Ga0501076_0003125 3300049592 Bacteria 11538
297 Ga0501076_0005828 3300049592 Bacteria 8886
298 Ga0501076_0063124 3300049592 Bacteria 2951
299 Ga0501076_0112244 3300049592 Bacteria 2204
300 Ga0501077_0000049 3300049593 Bacteria 61814
301 Ga0501077_0003274 3300049593 Bacteria 9754
302 Ga0501077_0071582 3300049593 Bacteria 2197
303 Ga0501077_0215859 3300049593 Bacteria 1219
304 Ga0501079_0000012 3300049741 Bacteria 69559
305 Ga0501079_0018325 3300049741 Bacteria 5351
306 Ga0501079_0505068 3300049741 Bacteria 950
307 Ga0501080_0134440 3300049742 Bacteria 2289
308 Ga0501080_0200377 3300049742 Bacteria 1833
309 Ga0501080_0672877 3300049742 Bacteria 914
310 Ga0501081_0000004 3300049743 Bacteria 94770
311 Ga0501081_0157750 3300049743 Bacteria 1633
312 Ga0501081_0237161 3300049743 Bacteria 1329
313 Ga0501081_0594237 3300049743 Bacteria 828
314 Ga0501083_0000091 3300049744 Bacteria 60492
315 Ga0501035_0000244 3300049822 Bacteria 65327
316 Ga0501035_0552974 3300049822 Bacteria 942
317 Ga0501044_0003289 3300049823 Bacteria 18204
318 Ga0501045_0000016 3300049824 Bacteria 72118
319 Ga0501045_0044123 3300049824 Bacteria 3247
320 Ga0501045_0167775 3300049824 Bacteria 1635
321 Ga0501045_0346533 3300049824 Bacteria 1105
322 Ga0501045_0396203 3300049824 Bacteria 1027
323 nmdc:mga05p37_4402_c1 3300050507 Bacteria 16459
324 nmdc:mga08y16_29656_c1 3300050511 Bacteria 5761
325 nmdc:mga0n895_126994_c1 3300050512 Bacteria 2574
326 nmdc:mga08x19_186332_c1 3300050514 Bacteria 1418
327 nmdc:mga0a205_220131_c1 3300050515 Bacteria 1784
328 Ga0495601_0055176 3300053077 Bacteria 2515
329 Ga0495612_0021070 3300053078 Bacteria 2615
330 Ga0495655_0029353 3300053083 Bacteria 1321
331 Ga0495655_0086489 3300053083 Bacteria 906
332 Ga0501084_0003606 3300054114 Bacteria 12568
333 Ga0501084_0027197 3300054114 Bacteria 4780
334 Ga0501084_0054847 3300054114 Bacteria 3334
335 Ga0501082_0000135 3300060353 Bacteria 60581
336 Ga0501082_0008594 3300060353 Bacteria 8810
337 Ga0501082_0587024 3300060353 Bacteria 975
338 Ga0530510_0001069 3300061734 Bacteria 18198
339 Ga0530510_0001117 3300061734 Bacteria 17838
340 Ga0530510_0036750 3300061734 Bacteria 3529
341 Ga0530510_0265095 3300061734 Bacteria 1282
342 Ga0530510_0350733 3300061734 Bacteria 1108
343 Ga0207640_10836155
344 Ga0070658_10113036
345 Ga0070683_100103374
346 Ga0070680_100001544
347 Ga0070660_100004576
348 Ga0070667_100305438
349 Ga0070714_100070010
350 Ga0070714_100085708
351 Ga0070714_100101302
352 Ga0070713_100488414
353 Ga0070711_101025013
354 Ga0070705_100134931
355 Ga0070694_100077740
356 Ga0070678_100170964
357 Ga0070681_10025702
358 Ga0070681_10088159
359 Ga0070681_10093249
360 Ga0070681_10109690
361 Ga0070706_100249574
362 Ga0070707_100020589
363 Ga0070698_100048165
364 Ga0070699_100060427
365 Ga0070679_100037203
366 Ga0070679_100044502
367 Ga0070679_100232818
368 Ga0070684_100832935
369 Ga0070697_100588248
370 Ga0070695_100060929
371 Ga0070696_100155116
372 Ga0068855_100056858
373 Ga0068855_100111303
374 Ga0070664_100473730
375 Ga0068857_100023824
376 Ga0068857_100454606
377 Ga0068852_100072859
378 Ga0081455_10008677
379 Ga0081455_10010002
380 Ga0081455_10040709
381 Ga0081455_10077016
382 Ga0081455_10124285
383 Ga0081455_10361717
384 Ga0081538_10000089
385 Ga0081538_10007715
386 Ga0081538_10036685
387 Ga0070717_10044292
388 Ga0075432_10065727
389 Ga0070716_100013274
390 Ga0068871_100414838
391 Ga0068871_100980960
392 Ga0075428_100173129
393 Ga0075436_100101859
394 Ga0075435_100025048
395 Ga0105240_10290123
396 Ga0105240_10458202
397 Ga0111539_10014735
398 Ga0111539_10147920
399 Ga0111539_10384083
400 Ga0105245_10053050
401 Ga0114129_10038474
402 Ga0114129_10281144
403 Ga0105243_10745248
404 Ga0105241_10310492
405 Ga0105241_10374554
406 Ga0105242_10287642
407 Ga0105239_10332093
408 Ga0105246_10054351
409 Ga0157370_10007916
410 Ga0157372_10520368
411 Ga0206356_11789756
412 Ga0206354_10842837
413 Ga0206354_11405613
414 Ga0206353_10039564
415 Ga0206353_10522570
416 Ga0207653_10051474
417 Ga0207692_10265291
418 Ga0207699_10048125
419 Ga0207684_10091967
420 Ga0207684_10321161
421 Ga0207707_10054870
422 Ga0207707_10061175
423 Ga0207707_10223663
424 Ga0207707_10307382
425 Ga0207660_10028773
426 Ga0207657_10004183
427 Ga0207657_10284642
428 Ga0207649_10061777
429 Ga0207652_10032253
430 Ga0207652_10104754
431 Ga0207652_10240083
432 Ga0207646_10000418
433 Ga0207687_10076345
434 Ga0207700_10034082
435 Ga0207664_10064436
436 Ga0207664_10269527
437 Ga0207690_10316183
438 Ga0207706_10045690
439 Ga0207686_10286204
440 Ga0207709_10231022
441 Ga0207704_10107798
442 Ga0207665_10008687
443 Ga0207691_10069022
444 Ga0207661_10163038
445 Ga0207667_10008268
446 Ga0207667_10152750
447 Ga0207658_10051851
448 Ga0207639_10204963
449 Ga0207708_10021996
450 Ga0207648_10070405
451 Ga0207674_10053078
452 Ga0207675_100033155
453 Ga0207683_10048778
454 Ga0207698_10349928
455 Ga0207428_10115031
456 Ga0207428_10216291
457 Ga0265319_1032457
458 Ga0265319_1122745
459 Ga0265334_10017364
460 Ga0265318_10070888
461 Ga0265318_10113831
462 Ga0265322_10046629
463 Ga0265338_10019125
464 Ga0265338_10109220
465 Ga0265338_10136964
466 Ga0265338_10452074
467 Ga0265338_10464198
468 Ga0265324_10027151
469 Ga0265325_10127243
470 Ga0265327_10014303
471 Ga0265327_10056010
472 Ga0265316_10002383
473 Ga0307408_100235736
474 Ga0265313_10009085
475 Ga0265314_10001693
476 Ga0265314_10081337
477 Ga0265342_10059760
478 Ga0307405_10097827
479 Ga0307410_10005553
480 Ga0307406_10010446
481 Ga0307407_10001508
482 Ga0307416_100012932
483 Ga0307411_10058333
484 Ga0307415_100012666
485 Ga0373948_0003832
486 Ga0373928_0001262
487 Ga0373951_0008583
488 Ga0373932_0018867
489 Ga0373936_0086336
490 Ga0373945_0028542
491 Ga0373943_0064631
492 Ga0373943_0069860
493 Ga0373943_0082996
494 Ga0373946_0077935
495 Ga0373935_0033757
496 Ga0373935_0505599
497 Ga0373927_0027747
498 Ga0373947_0004243
499 Ga0373947_0091038
500 Ga0373947_0246742
501 Ga0373925_0017711
502 Ga0373925_0114831
503 Ga0395900_0030029
504 Ga0395900_0278626
505 Ga0395900_0313336
506 Ga0395898_0005391
507 Ga0395898_0038386
508 Ga0395898_0041318
509 Ga0395898_0274389
510 Ga0395898_0874693
511 Ga0395898_0877338
512 Ga0395905_0401053
513 Ga0395905_0731713
514 Ga0395901_0048750
515 Ga0395901_0054745
516 Ga0395901_0057070
517 Ga0395901_0145913
518 Ga0395901_0241333
519 Ga0395901_0665202
520 Ga0466963_0018830
521 Ga0466963_0040484
522 Ga0466963_0131804
523 Ga0466964_0013840
524 Ga0466971_0046938
525 Ga0466957_0100209
526 Ga0466958_0349060
527 Ga0466967_0001829
528 Ga0466967_0010678
529 Ga0466967_0066628
530 Ga0466967_0248575
531 Ga0495592_0102051
532 Ga0495592_0150254
533 Ga0495580_0078612
534 Ga0495582_0210072
535 Ga0495605_0020513
536 Ga0495628_0141607
537 Ga0495663_0056583
538 Ga0495652_0522131
539 Ga0495645_0073628
540 Ga0495599_0100101
541 Ga0495647_0047925
542 Ga0495658_0013273
543 Ga0495624_0078042
544 Ga0495624_0392708
545 Ga0495589_0147842
546 Ga0495581_0003514
547 Ga0495581_0266679
548 Ga0495674_0155153
549 Ga0495676_0049150
550 Ga0495676_0103401
551 Ga0495680_0216562
552 Ga0495602_0054233
553 Ga0496101_0008830
554 Ga0496101_0254743
555 Ga0496101_0812681
556 Ga0496102_0084691
557 Ga0496103_0284280
558 Ga0496103_0321313
559 Ga0496104_0360498
560 Ga0496104_0484938
561 Ga0496105_0047729
562 Ga0496108_0005340
563 Ga0496109_0144771
564 Ga0496110_0709362
565 Ga0496110_0788292
566 Ga0496111_0101903
567 Ga0496112_0003066
568 Ga0496112_0022299
569 Ga0496113_0059909
570 Ga0496113_0264302
571 Ga0496114_0009116
572 Ga0496114_0090200
573 Ga0496115_0275927
574 Ga0501031_0000049
575 Ga0501031_0084092
576 Ga0501032_0041898
577 Ga0501033_0000383
578 Ga0501033_0167737
579 Ga0501034_0238016
580 Ga0501036_0002092
581 Ga0501036_0007938
582 Ga0501036_0090654
583 Ga0501036_0879023
584 Ga0501037_0000177
585 Ga0501038_0001527
586 Ga0501039_0000349
587 Ga0501039_0016904
588 Ga0501039_0566509
589 Ga0501039_0863400
590 Ga0501040_0001031
591 Ga0501041_0000001
592 Ga0501041_0021610
593 Ga0501041_0120093
594 Ga0501041_0161510
595 Ga0501041_0245527
596 Ga0501041_0258240
597 Ga0501042_0000002
598 Ga0501042_0184646
599 Ga0501042_0246008
600 Ga0501042_0478271
601 Ga0501043_0001753
602 Ga0501043_0054434
603 Ga0501043_0119006
604 Ga0501046_0000175
605 Ga0501046_0061623
606 Ga0501046_0089750
607 Ga0501046_0217499
608 Ga0501046_0329959
609 Ga0501047_0266814
610 Ga0501048_0001825
611 Ga0501048_0022484
612 Ga0501048_0339727
613 Ga0501048_0506629
614 Ga0501068_0000857
615 Ga0501069_0047962
616 Ga0501069_0074514
617 Ga0501070_0006724
618 Ga0501070_0670681
619 Ga0501070_0722818
620 Ga0501070_0886116
621 Ga0501071_0001932
622 Ga0501071_0005191
623 Ga0501071_0316044
624 Ga0501071_0431912
625 Ga0501072_0000074
626 Ga0501072_0003869
627 Ga0501072_0133204
628 Ga0501072_0292776
629 Ga0501073_0000105
630 Ga0501073_0222238
631 Ga0501074_0001607
632 Ga0501074_0225124
633 Ga0501074_0361796
634 Ga0501075_0000056
635 Ga0501075_0002262
636 Ga0501075_0131708
637 Ga0501076_0000039
638 Ga0501076_0003125
639 Ga0501076_0005828
640 Ga0501076_0063124
641 Ga0501076_0112244
642 Ga0501077_0000049
643 Ga0501077_0003274
644 Ga0501077_0071582
645 Ga0501077_0215859
646 Ga0501079_0000012
647 Ga0501079_0018325
648 Ga0501079_0505068
649 Ga0501080_0134440
650 Ga0501080_0200377
651 Ga0501080_0672877
652 Ga0501081_0000004
653 Ga0501081_0157750
654 Ga0501081_0237161
655 Ga0501081_0594237
656 Ga0501083_0000091
657 Ga0501035_0000244
658 Ga0501035_0552974
659 Ga0501044_0003289
660 Ga0501045_0000016
661 Ga0501045_0044123
662 Ga0501045_0167775
663 Ga0501045_0346533
664 Ga0501045_0396203
665 nmdc:mga05p37_4402_c1
666 nmdc:mga08y16_29656_c1
667 nmdc:mga0n895_126994_c1
668 nmdc:mga08x19_186332_c1
669 nmdc:mga0a205_220131_c1
670 Ga0495601_0055176
671 Ga0495612_0021070
672 Ga0495655_0029353
673 Ga0495655_0086489
674 Ga0501084_0003606
675 Ga0501084_0027197
676 Ga0501084_0054847
677 Ga0501082_0000135
678 Ga0501082_0008594
679 Ga0501082_0587024
680 Ga0530510_0001069
681 Ga0530510_0001117
682 Ga0530510_0036750
683 Ga0530510_0265095
684 Ga0530510_0350733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03006

HlyIII

Haemolysin-III related

5

204

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lxg-assembly1.cif.gz_A revised crystal structure of the human adiponectin receptor 1 in an open conformation 0.7982 12 207
5lxg-assembly1.cif.gz_A revised crystal structure of the human adiponectin receptor 1 in an open conformation 0.7311 12 207
8t05-assembly1.cif.gz_B structure of ciona myomaker bound to fab1a1 0.7013 11 207
8t05-assembly1.cif.gz_B structure of ciona myomaker bound to fab1a1 0.6687 11 207
7c4s-assembly2.cif.gz_B sphingosine-1-phosphate receptor 3 with a natural ligand. 0.6189 3 209
ID Description Score Start End Superfamily
af_P9WFN7_30_234_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9755 8 204 1.20.1070.10
af_P9WFN7_30_234_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9336 8 204 1.20.1070.10
af_P67153_11_209_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9118 12 203 1.20.1070.10
af_Q2FW82_22_220_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9099 12 203 1.20.1070.10
af_Q9CQY7_24_220_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9027 12 204 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7K1IQN9-F1-model_v4 Hemolysin III family protein 0.9866 15 208 GO:0005886
GO:0046872
GO:0140911
AF-A0A3N0GLH4-F1-model_v4 Hemolysin III family protein 0.9852 8 208 GO:0016020
GO:0046872
AF-A0A3N1HNG4-F1-model_v4 Channel protein (Hemolysin III family) 0.9831 7 206 GO:0016020
GO:0046872
AF-A0A538FNU5-F1-model_v4 Hemolysin III family protein 0.9823 27 215 GO:0016020
GO:0046872
AF-A0A1V5J8K2-F1-model_v4 deleted 0.9818 45 207

Map