F415080

General Info

Members Datasets Scaffolds Average Seq Length
342 160 684 145

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100237896|Ga0070695_1002378962
Length 157
Sequence MGATMTIGGGWCTKIRTMSIRIVPDEDQPSASIEIALEKPLPEYDLEEVEQPTPRHVDAILVSQGFRDLVDDTRGILMELLAQHHPHHPGFDLSNDAPLVLAQLTGAICPGNDEVYRPGLWIVLQDPHAKPKTALPTATRERIAAIASELAKRLQLE

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 27.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100237896 3300005545 Bacteria 1320
2 Ga0065715_10440324 3300005293 Unclassified 837
3 Ga0065707_10102102 3300005295 Bacteria 2819
4 Ga0070680_100074272 3300005336 Bacteria 2798
5 Ga0070703_10007668 3300005406 Bacteria 3033
6 Ga0070709_10067089 3300005434 Unclassified 2303
7 Ga0070709_10107910 3300005434 Unclassified 1867
8 Ga0070709_10123063 3300005434 Bacteria 1761
9 Ga0070709_10343735 3300005434 Bacteria 1101
10 Ga0070709_10569242 3300005434 Bacteria 869
11 Ga0070714_100088442 3300005435 Unclassified 2710
12 Ga0070714_101375590 3300005435 Bacteria 689
13 Ga0070713_100012120 3300005436 Bacteria 6312
14 Ga0070713_100131574 3300005436 Bacteria 2207
15 Ga0070713_100899839 3300005436 Unclassified 851
16 Ga0070710_10211805 3300005437 Bacteria 1229
17 Ga0070710_10244996 3300005437 Bacteria 1150
18 Ga0070711_100037618 3300005439 Bacteria 3248
19 Ga0070711_100083658 3300005439 Bacteria 2281
20 Ga0070711_100144206 3300005439 Bacteria 1789
21 Ga0070711_100159202 3300005439 Bacteria 1710
22 Ga0070711_101001478 3300005439 Bacteria 717
23 Ga0070711_101147169 3300005439 Unclassified 671
24 Ga0070705_100015268 3300005440 Bacteria 3965
25 Ga0070705_100150268 3300005440 Unclassified 1544
26 Ga0070694_100033636 3300005444 Bacteria 3375
27 Ga0070708_100000413 3300005445 Bacteria 32082
28 Ga0070708_100015042 3300005445 Bacteria 6383
29 Ga0070708_100093328 3300005445 Bacteria 2743
30 Ga0070708_100255520 3300005445 Unclassified 1646
31 Ga0070708_100663804 3300005445 Unclassified 982
32 Ga0070708_100870218 3300005445 Bacteria 846
33 Ga0070708_101328758 3300005445 Unclassified 671
34 Ga0070706_100250827 3300005467 Bacteria 1652
35 Ga0070706_100395237 3300005467 Unclassified 1287
36 Ga0070706_100433375 3300005467 Bacteria 1223
37 Ga0070706_101402308 3300005467 Unclassified 639
38 Ga0070707_100003215 3300005468 Bacteria 15456
39 Ga0070707_100024176 3300005468 Bacteria 5751
40 Ga0070707_100086265 3300005468 Bacteria 3036
41 Ga0070707_100396434 3300005468 Bacteria 1340
42 Ga0070707_100619400 3300005468 Bacteria 1045
43 Ga0070707_100927949 3300005468 Unclassified 835
44 Ga0070698_100004705 3300005471 Bacteria 14995
45 Ga0070698_100173279 3300005471 Bacteria 2098
46 Ga0070698_100521947 3300005471 Unclassified 1126
47 Ga0070699_100013635 3300005518 Bacteria 6996
48 Ga0070699_100053083 3300005518 Bacteria 3508
49 Ga0070699_100082975 3300005518 Bacteria 2795
50 Ga0070699_100174740 3300005518 Unclassified 1904
51 Ga0070699_100383047 3300005518 Bacteria 1270
52 Ga0070699_100453257 3300005518 Unclassified 1163
53 Ga0070699_100634672 3300005518 Unclassified 975
54 Ga0070699_100803741 3300005518 Unclassified 861
55 Ga0070679_100046809 3300005530 Bacteria 4312
56 Ga0070697_100052118 3300005536 Bacteria 3325
57 Ga0070697_100074957 3300005536 Bacteria 2780
58 Ga0070697_100101910 3300005536 Unclassified 2385
59 Ga0070697_100176286 3300005536 Unclassified 1811
60 Ga0070697_100274551 3300005536 Unclassified 1445
61 Ga0070697_100369714 3300005536 Bacteria 1240
62 Ga0070695_100045221 3300005545 Unclassified 2805
63 Ga0070696_100005223 3300005546 Bacteria 8679
64 Ga0070693_100000024 3300005547 Bacteria 58381
65 Ga0070693_100000919 3300005547 Bacteria 13089
66 Ga0070665_100003967 3300005548 Bacteria 15602
67 Ga0070704_100013188 3300005549 Bacteria 5123
68 Ga0070704_100357558 3300005549 Unclassified 1235
69 Ga0068859_100547009 3300005617 Unclassified 1252
70 Ga0068866_10162838 3300005718 Bacteria 1302
71 Ga0068866_10540036 3300005718 Bacteria 778
72 Ga0068863_100008853 3300005841 Bacteria 9828
73 Ga0068858_100024697 3300005842 Bacteria 5597
74 Ga0068860_100022190 3300005843 Bacteria 6146
75 Ga0081455_10206560 3300005937 Unclassified 1467
76 Ga0070717_10374830 3300006028 Bacteria 1275
77 Ga0070717_10852288 3300006028 Bacteria 829
78 Ga0070717_11562132 3300006028 Unclassified 598
79 Ga0070715_10330286 3300006163 Unclassified 826
80 Ga0070715_10446954 3300006163 Bacteria 729
81 Ga0070715_10467974 3300006163 Unclassified 715
82 Ga0070715_10840537 3300006163 Unclassified 560
83 Ga0070716_100002246 3300006173 Bacteria 8893
84 Ga0070716_100002388 3300006173 Bacteria 8638
85 Ga0070716_100049546 3300006173 Bacteria 2380
86 Ga0070716_100077876 3300006173 Unclassified 1969
87 Ga0070716_100163709 3300006173 Bacteria 1444
88 Ga0070716_100297090 3300006173 Unclassified 1122
89 Ga0070716_100429018 3300006173 Unclassified 958
90 Ga0070716_101012282 3300006173 Unclassified 658
91 Ga0070712_100030427 3300006175 Bacteria 3627
92 Ga0070712_100092322 3300006175 Bacteria 2220
93 Ga0070712_100182903 3300006175 Bacteria 1634
94 Ga0070712_100261621 3300006175 Unclassified 1386
95 Ga0070712_100548211 3300006175 Unclassified 974
96 Ga0097621_100399882 3300006237 Bacteria 1230
97 Ga0097621_100971808 3300006237 Bacteria 793
98 Ga0068871_100006700 3300006358 Bacteria 8174
99 Ga0075434_100083718 3300006871 Bacteria 3188
100 Ga0075434_100221483 3300006871 Bacteria 1912
101 Ga0068865_100179277 3300006881 Bacteria 1630
102 Ga0068865_101133351 3300006881 Unclassified 690
103 Ga0068865_101323830 3300006881 Unclassified 641
104 Ga0075436_100000244 3300006914 Bacteria 33947
105 Ga0075436_100001504 3300006914 Bacteria 15905
106 Ga0075436_100015509 3300006914 Bacteria 5215
107 Ga0075436_101004743 3300006914 Unclassified 626
108 Ga0097620_100547054 3300006931 Unclassified 1252
109 Ga0075435_100010916 3300007076 Bacteria 6657
110 Ga0075435_100246218 3300007076 Bacteria 1521
111 Ga0075435_100258949 3300007076 Unclassified 1482
112 Ga0075435_100421721 3300007076 Bacteria 1149
113 Ga0075435_100945255 3300007076 Bacteria 752
114 Ga0099794_10003064 3300007265 Bacteria 6311
115 Ga0099794_10003572 3300007265 Bacteria 5958
116 Ga0099794_10004134 3300007265 Bacteria 5653
117 Ga0099794_10006188 3300007265 Bacteria 4834
118 Ga0099794_10007865 3300007265 Bacteria 4404
119 Ga0099794_10008216 3300007265 Bacteria 4326
120 Ga0099794_10009598 3300007265 Bacteria 4078
121 Ga0099794_10010763 3300007265 Bacteria 3892
122 Ga0099794_10017951 3300007265 Bacteria 3163
123 Ga0099794_10035851 3300007265 Bacteria 2342
124 Ga0099794_10062388 3300007265 Bacteria 1812
125 Ga0099794_10073976 3300007265 Bacteria 1673
126 Ga0099794_10086049 3300007265 Bacteria 1556
127 Ga0099794_10165620 3300007265 Bacteria 1125
128 Ga0099794_10183691 3300007265 Bacteria 1068
129 Ga0099794_10202837 3300007265 Unclassified 1016
130 Ga0099794_10354658 3300007265 Bacteria 763
131 Ga0099794_10454195 3300007265 Unclassified 672
132 Ga0099795_10130628 3300007788 Bacteria 1013
133 Ga0099795_10209640 3300007788 Unclassified 825
134 Ga0099795_10346514 3300007788 Unclassified 663
135 Ga0105247_10112798 3300009101 Unclassified 1752
136 Ga0105247_10792205 3300009101 Unclassified 722
137 Ga0105241_11590625 3300009174 Unclassified 632
138 Ga0105242_10505173 3300009176 Unclassified 1151
139 Ga0105248_10189998 3300009177 Bacteria 2314
140 Ga0105248_11465009 3300009177 Unclassified 773
141 Ga0105248_11647250 3300009177 Unclassified 727
142 Ga0105237_10009400 3300009545 Bacteria 10470
143 Ga0105237_10505407 3300009545 Unclassified 1215
144 Ga0105249_10142121 3300009553 Bacteria 2303
145 Ga0099796_10013731 3300010159 Unclassified 2321
146 Ga0099796_10057541 3300010159 Archaea 1368
147 Ga0099796_10182760 3300010159 Unclassified 842
148 Ga0099796_10224099 3300010159 Bacteria 771
149 Ga0105239_10921744 3300010375 Unclassified 1003
150 Ga0157374_10059038 3300013296 Bacteria 3585
151 Ga0157378_10000364 3300013297 Bacteria 44780
152 Ga0157378_10004763 3300013297 Bacteria 11892
153 Ga0157378_10095030 3300013297 Bacteria 2714
154 Ga0163162_10036394 3300013306 Bacteria 4906
155 Ga0163162_10504559 3300013306 Unclassified 1340
156 Ga0157372_12301734 3300013307 Unclassified 619
157 Ga0157375_10606870 3300013308 Unclassified 1253
158 Ga0157375_11459539 3300013308 Unclassified 807
159 Ga0163163_10353342 3300014325 Bacteria 1526
160 Ga0157379_10311998 3300014968 Bacteria 1435
161 Ga0157379_10406486 3300014968 Bacteria 1252
162 Ga0157376_10000005 3300014969 Bacteria 443695
163 Ga0157376_10004289 3300014969 Bacteria 9904
164 Ga0213876_10042066 3300021384 Unclassified 2414
165 Ga0207653_10036257 3300025885 Bacteria 1606
166 Ga0207692_10058005 3300025898 Bacteria 1993
167 Ga0207642_10056988 3300025899 Bacteria 1795
168 Ga0207710_10379610 3300025900 Unclassified 723
169 Ga0207685_10366333 3300025905 Bacteria 730
170 Ga0207699_10002888 3300025906 Bacteria 8150
171 Ga0207699_10095896 3300025906 Bacteria 1872
172 Ga0207699_10105523 3300025906 Bacteria 1797
173 Ga0207699_10330851 3300025906 Bacteria 1071
174 Ga0207699_10755399 3300025906 Unclassified 713
175 Ga0207699_10945413 3300025906 Bacteria 636
176 Ga0207684_10007711 3300025910 Bacteria 9643
177 Ga0207684_10625143 3300025910 Unclassified 919
178 Ga0207684_10758909 3300025910 Unclassified 822
179 Ga0207684_11133307 3300025910 Unclassified 650
180 Ga0207671_10038749 3300025914 Bacteria 3532
181 Ga0207693_10025562 3300025915 Bacteria 4681
182 Ga0207693_10034742 3300025915 Bacteria 3976
183 Ga0207693_10099859 3300025915 Bacteria 2276
184 Ga0207693_10107415 3300025915 Bacteria 2189
185 Ga0207693_10417661 3300025915 Bacteria 1049
186 Ga0207663_10032371 3300025916 Bacteria 3103
187 Ga0207663_10065233 3300025916 Bacteria 2327
188 Ga0207663_10129081 3300025916 Bacteria 1744
189 Ga0207663_10382248 3300025916 Unclassified 1073
190 Ga0207660_10056007 3300025917 Bacteria 2820
191 Ga0207652_10263897 3300025921 Bacteria 1553
192 Ga0207646_10001868 3300025922 Bacteria 25391
193 Ga0207646_10369760 3300025922 Bacteria 1295
194 Ga0207646_10803884 3300025922 Unclassified 837
195 Ga0207646_11426566 3300025922 Unclassified 601
196 Ga0207700_10018416 3300025928 Bacteria 4691
197 Ga0207700_10328159 3300025928 Unclassified 1328
198 Ga0207700_10767847 3300025928 Unclassified 862
199 Ga0207664_10373530 3300025929 Unclassified 1265
200 Ga0207686_10075750 3300025934 Bacteria 2179
201 Ga0207704_10290469 3300025938 Unclassified 1247
202 Ga0207704_11060263 3300025938 Unclassified 687
203 Ga0207665_10000067 3300025939 Bacteria 67657
204 Ga0207665_10008313 3300025939 Bacteria 6851
205 Ga0207665_10014520 3300025939 Bacteria 5186
206 Ga0207665_10067810 3300025939 Bacteria 2430
207 Ga0207665_10104925 3300025939 Unclassified 1979
208 Ga0207665_10225809 3300025939 Bacteria 1374
209 Ga0207711_10069196 3300025941 Bacteria 3059
210 Ga0207703_10016884 3300026035 Bacteria 5694
211 Ga0207641_10004029 3300026088 Bacteria 12817
212 Ga0207648_10381438 3300026089 Bacteria 1275
213 Ga0207648_11142476 3300026089 Unclassified 731
214 Ga0209179_1027745 3300027512 Unclassified 1144
215 Ga0209588_1003032 3300027671 Bacteria 4630
216 Ga0209588_1004302 3300027671 Bacteria 4009
217 Ga0209588_1007790 3300027671 Bacteria 3163
218 Ga0209588_1008731 3300027671 Bacteria 3012
219 Ga0209588_1010666 3300027671 Bacteria 2765
220 Ga0209588_1018007 3300027671 Bacteria 2196
221 Ga0209588_1018113 3300027671 Bacteria 2191
222 Ga0209588_1033188 3300027671 Unclassified 1655
223 Ga0209588_1041101 3300027671 Bacteria 1493
224 Ga0209588_1047286 3300027671 Bacteria 1391
225 Ga0209588_1115444 3300027671 Bacteria 861
226 Ga0209588_1141013 3300027671 Bacteria 766
227 Ga0209588_1167651 3300027671 Bacteria 692
228 Ga0265354_1004714 3300028016 Unclassified 1414
229 Ga0268266_10000661 3300028379 Bacteria 46641
230 Ga0268264_10012836 3300028381 Bacteria 6895
231 Ga0265338_10073951 3300028800 Bacteria 2902
232 Ga0265770_1000640 3300030878 Bacteria 4849
233 Ga0316212_1014016 3300033547 Unclassified 1137
234 Ga0373934_0000697 3300035086 Bacteria 11984
235 Ga0373923_0540619 3300035111 Unclassified 570
236 Ga0373923_0594231 3300035111 Unclassified 545
237 Ga0373953_0000396 3300035117 Bacteria 11847
238 Ga0373954_0000274 3300035118 Bacteria 18782
239 Ga0373956_0068961 3300035119 Bacteria 1611
240 Ga0373956_0202913 3300035119 Bacteria 940
241 Ga0373957_0001633 3300035120 Bacteria 6145
242 Ga0373943_0343532 3300035170 Bacteria 854
243 Ga0373943_0566571 3300035170 Bacteria 667
244 Ga0373946_0004286 3300035171 Bacteria 5098
245 Ga0373955_0006472 3300035172 Bacteria 5335
246 Ga0373924_0160318 3300035410 Bacteria 986
247 Ga0373935_0280787 3300035692 Bacteria 1172
248 Ga0373927_0000401 3300035695 Bacteria 33550
249 Ga0373927_0177852 3300035695 Unclassified 1395
250 Ga0373933_0000491 3300035724 Bacteria 24661
251 Ga0373947_0009266 3300035725 Bacteria 5656
252 Ga0373947_0810717 3300035725 Unclassified 639
253 Ga0373937_0000216 3300036401 Bacteria 55804
254 Ga0373937_0277776 3300036401 Bacteria 1581
255 Ga0373937_1466027 3300036401 Unclassified 630
256 Ga0373925_0001085 3300037068 Bacteria 24453
257 Ga0373925_0273467 3300037068 Bacteria 1359
258 Ga0436365_1003976 3300039437 Bacteria 3280
259 Ga0453683_0584086 3300044673 Unclassified 728
260 Ga0495603_0005273 3300046455 Bacteria 7711
261 Ga0495603_0042948 3300046455 Bacteria 2701
262 Ga0495603_0803905 3300046455 Unclassified 536
263 Ga0495629_0033287 3300046459 Bacteria 3646
264 Ga0495641_0099123 3300046461 Bacteria 1300
265 Ga0495641_0367567 3300046461 Unclassified 651
266 Ga0495651_0012090 3300046462 Bacteria 6643
267 Ga0495651_0078785 3300046462 Bacteria 2492
268 Ga0495651_0334264 3300046462 Unclassified 1006
269 Ga0495580_0001282 3300046472 Bacteria 22138
270 Ga0495580_0086343 3300046472 Bacteria 2185
271 Ga0495580_0117259 3300046472 Bacteria 1849
272 Ga0495580_0153826 3300046472 Unclassified 1593
273 Ga0495582_0000308 3300046473 Bacteria 27029
274 Ga0495582_0059774 3300046473 Bacteria 2102
275 Ga0495639_0030551 3300046475 Bacteria 2394
276 Ga0495662_0092522 3300046476 Bacteria 1475
277 Ga0495664_0036098 3300046477 Bacteria 2913
278 Ga0495594_0024374 3300046499 Bacteria 3249
279 Ga0495608_0157425 3300046511 Bacteria 1445
280 Ga0495618_0117442 3300046514 Bacteria 1703
281 Ga0495618_0730088 3300046514 Bacteria 581
282 Ga0495628_0471867 3300046516 Bacteria 909
283 Ga0495630_0047035 3300046517 Bacteria 3226
284 Ga0495666_0213656 3300046526 Bacteria 884
285 Ga0495665_0136770 3300046531 Bacteria 1281
286 Ga0495640_0039299 3300046533 Bacteria 3321
287 Ga0495587_0038165 3300046536 Bacteria 2881
288 Ga0495587_0040347 3300046536 Bacteria 2791
289 Ga0495645_0008725 3300046543 Bacteria 7076
290 Ga0495634_0023541 3300046642 Bacteria 4327
291 Ga0495657_0610635 3300046675 Unclassified 631
292 Ga0495599_0374744 3300046678 Bacteria 850
293 Ga0495623_0119656 3300046679 Bacteria 1586
294 Ga0495646_0439921 3300046680 Bacteria 674
295 Ga0495647_0003545 3300046681 Bacteria 5001
296 Ga0495658_0021311 3300046683 Bacteria 3416
297 Ga0495658_0092089 3300046683 Bacteria 1796
298 Ga0495613_0193539 3300046689 Bacteria 1436
299 Ga0495613_0693628 3300046689 Bacteria 671
300 Ga0495624_0053429 3300046690 Bacteria 2551
301 Ga0495600_0221634 3300046809 Unclassified 1210
302 Ga0495581_0020889 3300047315 Bacteria 3799
303 Ga0495581_0490177 3300047315 Bacteria 715
304 Ga0495604_0006834 3300047317 Bacteria 9042
305 Ga0495674_0044627 3300047319 Bacteria 3940
306 Ga0495676_0044198 3300047321 Bacteria 3638
307 Ga0495680_0327497 3300047322 Bacteria 1071
308 Ga0495680_0659263 3300047322 Unclassified 695
309 Ga0495684_0009492 3300047471 Bacteria 7505
310 Ga0495684_0020133 3300047471 Bacteria 5138
311 Ga0495684_0218287 3300047471 Bacteria 1399
312 Ga0495593_0025109 3300047673 Bacteria 3298
313 Ga0495602_0006907 3300048088 Bacteria 11928
314 Ga0496100_0093051 3300048903 Bacteria 2062
315 Ga0496100_0382685 3300048903 Bacteria 1069
316 Ga0496101_0013953 3300048904 Bacteria 5395
317 Ga0496101_0341716 3300048904 Bacteria 1176
318 Ga0496102_0006021 3300048905 Bacteria 10330
319 Ga0496104_1360470 3300048907 Unclassified 613
320 Ga0496105_0328208 3300048908 Bacteria 1225
321 Ga0496106_0100758 3300048909 Bacteria 2240
322 Ga0496107_0169333 3300048910 Bacteria 1621
323 Ga0496112_0072728 3300048915 Bacteria 3399
324 Ga0496114_0131611 3300048917 Bacteria 2160
325 Ga0496115_0003558 3300048918 Bacteria 11211
326 Ga0496115_0003877 3300048918 Bacteria 10789
327 Ga0496115_0078568 3300048918 Bacteria 2684
328 Ga0496115_0635374 3300048918 Bacteria 845
329 Ga0496126_0429584 3300048929 Bacteria 1066
330 nmdc:mga0n895_6259_c1 3300050512 Bacteria 10085
331 nmdc:mga0n895_80107_c1 3300050512 Bacteria 3253
332 nmdc:mga0rr50_1091812_c1 3300050513 Bacteria 679
333 nmdc:mga0rr50_30425_c1 3300050513 Bacteria 3822
334 nmdc:mga0rr50_639600_c1 3300050513 Unclassified 907
335 nmdc:mga0rr50_98453_c1 3300050513 Bacteria 2292
336 nmdc:mga08x19_12280_c1 3300050514 Bacteria 5157
337 nmdc:mga08x19_222598_c1 3300050514 Bacteria 1297
338 nmdc:mga08x19_2257_c1 3300050514 Bacteria 11736
339 nmdc:mga08x19_425598_c1 3300050514 Bacteria 933
340 nmdc:mga08x19_856486_c1 3300050514 Unclassified 645
341 Ga0495601_0499280 3300053077 Bacteria 785
342 Ga0495619_0746011 3300053085 Unclassified 664
343 Ga0070695_100237896
344 Ga0065715_10440324
345 Ga0065707_10102102
346 Ga0070680_100074272
347 Ga0070703_10007668
348 Ga0070709_10067089
349 Ga0070709_10107910
350 Ga0070709_10123063
351 Ga0070709_10343735
352 Ga0070709_10569242
353 Ga0070714_100088442
354 Ga0070714_101375590
355 Ga0070713_100012120
356 Ga0070713_100131574
357 Ga0070713_100899839
358 Ga0070710_10211805
359 Ga0070710_10244996
360 Ga0070711_100037618
361 Ga0070711_100083658
362 Ga0070711_100144206
363 Ga0070711_100159202
364 Ga0070711_101001478
365 Ga0070711_101147169
366 Ga0070705_100015268
367 Ga0070705_100150268
368 Ga0070694_100033636
369 Ga0070708_100000413
370 Ga0070708_100015042
371 Ga0070708_100093328
372 Ga0070708_100255520
373 Ga0070708_100663804
374 Ga0070708_100870218
375 Ga0070708_101328758
376 Ga0070706_100250827
377 Ga0070706_100395237
378 Ga0070706_100433375
379 Ga0070706_101402308
380 Ga0070707_100003215
381 Ga0070707_100024176
382 Ga0070707_100086265
383 Ga0070707_100396434
384 Ga0070707_100619400
385 Ga0070707_100927949
386 Ga0070698_100004705
387 Ga0070698_100173279
388 Ga0070698_100521947
389 Ga0070699_100013635
390 Ga0070699_100053083
391 Ga0070699_100082975
392 Ga0070699_100174740
393 Ga0070699_100383047
394 Ga0070699_100453257
395 Ga0070699_100634672
396 Ga0070699_100803741
397 Ga0070679_100046809
398 Ga0070697_100052118
399 Ga0070697_100074957
400 Ga0070697_100101910
401 Ga0070697_100176286
402 Ga0070697_100274551
403 Ga0070697_100369714
404 Ga0070695_100045221
405 Ga0070696_100005223
406 Ga0070693_100000024
407 Ga0070693_100000919
408 Ga0070665_100003967
409 Ga0070704_100013188
410 Ga0070704_100357558
411 Ga0068859_100547009
412 Ga0068866_10162838
413 Ga0068866_10540036
414 Ga0068863_100008853
415 Ga0068858_100024697
416 Ga0068860_100022190
417 Ga0081455_10206560
418 Ga0070717_10374830
419 Ga0070717_10852288
420 Ga0070717_11562132
421 Ga0070715_10330286
422 Ga0070715_10446954
423 Ga0070715_10467974
424 Ga0070715_10840537
425 Ga0070716_100002246
426 Ga0070716_100002388
427 Ga0070716_100049546
428 Ga0070716_100077876
429 Ga0070716_100163709
430 Ga0070716_100297090
431 Ga0070716_100429018
432 Ga0070716_101012282
433 Ga0070712_100030427
434 Ga0070712_100092322
435 Ga0070712_100182903
436 Ga0070712_100261621
437 Ga0070712_100548211
438 Ga0097621_100399882
439 Ga0097621_100971808
440 Ga0068871_100006700
441 Ga0075434_100083718
442 Ga0075434_100221483
443 Ga0068865_100179277
444 Ga0068865_101133351
445 Ga0068865_101323830
446 Ga0075436_100000244
447 Ga0075436_100001504
448 Ga0075436_100015509
449 Ga0075436_101004743
450 Ga0097620_100547054
451 Ga0075435_100010916
452 Ga0075435_100246218
453 Ga0075435_100258949
454 Ga0075435_100421721
455 Ga0075435_100945255
456 Ga0099794_10003064
457 Ga0099794_10003572
458 Ga0099794_10004134
459 Ga0099794_10006188
460 Ga0099794_10007865
461 Ga0099794_10008216
462 Ga0099794_10009598
463 Ga0099794_10010763
464 Ga0099794_10017951
465 Ga0099794_10035851
466 Ga0099794_10062388
467 Ga0099794_10073976
468 Ga0099794_10086049
469 Ga0099794_10165620
470 Ga0099794_10183691
471 Ga0099794_10202837
472 Ga0099794_10354658
473 Ga0099794_10454195
474 Ga0099795_10130628
475 Ga0099795_10209640
476 Ga0099795_10346514
477 Ga0105247_10112798
478 Ga0105247_10792205
479 Ga0105241_11590625
480 Ga0105242_10505173
481 Ga0105248_10189998
482 Ga0105248_11465009
483 Ga0105248_11647250
484 Ga0105237_10009400
485 Ga0105237_10505407
486 Ga0105249_10142121
487 Ga0099796_10013731
488 Ga0099796_10057541
489 Ga0099796_10182760
490 Ga0099796_10224099
491 Ga0105239_10921744
492 Ga0157374_10059038
493 Ga0157378_10000364
494 Ga0157378_10004763
495 Ga0157378_10095030
496 Ga0163162_10036394
497 Ga0163162_10504559
498 Ga0157372_12301734
499 Ga0157375_10606870
500 Ga0157375_11459539
501 Ga0163163_10353342
502 Ga0157379_10311998
503 Ga0157379_10406486
504 Ga0157376_10000005
505 Ga0157376_10004289
506 Ga0213876_10042066
507 Ga0207653_10036257
508 Ga0207692_10058005
509 Ga0207642_10056988
510 Ga0207710_10379610
511 Ga0207685_10366333
512 Ga0207699_10002888
513 Ga0207699_10095896
514 Ga0207699_10105523
515 Ga0207699_10330851
516 Ga0207699_10755399
517 Ga0207699_10945413
518 Ga0207684_10007711
519 Ga0207684_10625143
520 Ga0207684_10758909
521 Ga0207684_11133307
522 Ga0207671_10038749
523 Ga0207693_10025562
524 Ga0207693_10034742
525 Ga0207693_10099859
526 Ga0207693_10107415
527 Ga0207693_10417661
528 Ga0207663_10032371
529 Ga0207663_10065233
530 Ga0207663_10129081
531 Ga0207663_10382248
532 Ga0207660_10056007
533 Ga0207652_10263897
534 Ga0207646_10001868
535 Ga0207646_10369760
536 Ga0207646_10803884
537 Ga0207646_11426566
538 Ga0207700_10018416
539 Ga0207700_10328159
540 Ga0207700_10767847
541 Ga0207664_10373530
542 Ga0207686_10075750
543 Ga0207704_10290469
544 Ga0207704_11060263
545 Ga0207665_10000067
546 Ga0207665_10008313
547 Ga0207665_10014520
548 Ga0207665_10067810
549 Ga0207665_10104925
550 Ga0207665_10225809
551 Ga0207711_10069196
552 Ga0207703_10016884
553 Ga0207641_10004029
554 Ga0207648_10381438
555 Ga0207648_11142476
556 Ga0209179_1027745
557 Ga0209588_1003032
558 Ga0209588_1004302
559 Ga0209588_1007790
560 Ga0209588_1008731
561 Ga0209588_1010666
562 Ga0209588_1018007
563 Ga0209588_1018113
564 Ga0209588_1033188
565 Ga0209588_1041101
566 Ga0209588_1047286
567 Ga0209588_1115444
568 Ga0209588_1141013
569 Ga0209588_1167651
570 Ga0265354_1004714
571 Ga0268266_10000661
572 Ga0268264_10012836
573 Ga0265338_10073951
574 Ga0265770_1000640
575 Ga0316212_1014016
576 Ga0373934_0000697
577 Ga0373923_0540619
578 Ga0373923_0594231
579 Ga0373953_0000396
580 Ga0373954_0000274
581 Ga0373956_0068961
582 Ga0373956_0202913
583 Ga0373957_0001633
584 Ga0373943_0343532
585 Ga0373943_0566571
586 Ga0373946_0004286
587 Ga0373955_0006472
588 Ga0373924_0160318
589 Ga0373935_0280787
590 Ga0373927_0000401
591 Ga0373927_0177852
592 Ga0373933_0000491
593 Ga0373947_0009266
594 Ga0373947_0810717
595 Ga0373937_0000216
596 Ga0373937_0277776
597 Ga0373937_1466027
598 Ga0373925_0001085
599 Ga0373925_0273467
600 Ga0436365_1003976
601 Ga0453683_0584086
602 Ga0495603_0005273
603 Ga0495603_0042948
604 Ga0495603_0803905
605 Ga0495629_0033287
606 Ga0495641_0099123
607 Ga0495641_0367567
608 Ga0495651_0012090
609 Ga0495651_0078785
610 Ga0495651_0334264
611 Ga0495580_0001282
612 Ga0495580_0086343
613 Ga0495580_0117259
614 Ga0495580_0153826
615 Ga0495582_0000308
616 Ga0495582_0059774
617 Ga0495639_0030551
618 Ga0495662_0092522
619 Ga0495664_0036098
620 Ga0495594_0024374
621 Ga0495608_0157425
622 Ga0495618_0117442
623 Ga0495618_0730088
624 Ga0495628_0471867
625 Ga0495630_0047035
626 Ga0495666_0213656
627 Ga0495665_0136770
628 Ga0495640_0039299
629 Ga0495587_0038165
630 Ga0495587_0040347
631 Ga0495645_0008725
632 Ga0495634_0023541
633 Ga0495657_0610635
634 Ga0495599_0374744
635 Ga0495623_0119656
636 Ga0495646_0439921
637 Ga0495647_0003545
638 Ga0495658_0021311
639 Ga0495658_0092089
640 Ga0495613_0193539
641 Ga0495613_0693628
642 Ga0495624_0053429
643 Ga0495600_0221634
644 Ga0495581_0020889
645 Ga0495581_0490177
646 Ga0495604_0006834
647 Ga0495674_0044627
648 Ga0495676_0044198
649 Ga0495680_0327497
650 Ga0495680_0659263
651 Ga0495684_0009492
652 Ga0495684_0020133
653 Ga0495684_0218287
654 Ga0495593_0025109
655 Ga0495602_0006907
656 Ga0496100_0093051
657 Ga0496100_0382685
658 Ga0496101_0013953
659 Ga0496101_0341716
660 Ga0496102_0006021
661 Ga0496104_1360470
662 Ga0496105_0328208
663 Ga0496106_0100758
664 Ga0496107_0169333
665 Ga0496112_0072728
666 Ga0496114_0131611
667 Ga0496115_0003558
668 Ga0496115_0003877
669 Ga0496115_0078568
670 Ga0496115_0635374
671 Ga0496126_0429584
672 nmdc:mga0n895_6259_c1
673 nmdc:mga0n895_80107_c1
674 nmdc:mga0rr50_1091812_c1
675 nmdc:mga0rr50_30425_c1
676 nmdc:mga0rr50_639600_c1
677 nmdc:mga0rr50_98453_c1
678 nmdc:mga08x19_12280_c1
679 nmdc:mga08x19_222598_c1
680 nmdc:mga08x19_2257_c1
681 nmdc:mga08x19_425598_c1
682 nmdc:mga08x19_856486_c1
683 Ga0495601_0499280
684 Ga0495619_0746011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.6695 85 112
6znb-assembly1.cif.gz_AA phage sam lyase in apo state 0.6315 11 141
4tnv-assembly1.cif.gz_B c. elegans glutamate-gated chloride channel (glucl) in complex with fab in a non-conducting conformation 0.6313 85 113
4tnw-assembly1.cif.gz_A c. elegans glutamate-gated chloride channel (glucl) in complex with fab and popc in a lipid-modulated conformation 0.6223 85 113
8f6y-assembly1.cif.gz_C cryo-em structure of torpedo nicotinic acetylcholine receptor in complex with etomidate, desensitized-like state 0.6149 85 113
ID Description Score Start End Superfamily
af_Q8MP20_108_262_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.7039 84 112 3.30.980.10
3sm3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6695 85 112 3.40.50.150
2bkyY00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.6435 85 112 3.30.110.20
af_P71805_5_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.634 85 113 3.40.50.150
af_G5ECT0_65_274_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.6251 85 113 2.70.170.10
ID Description Score Start End GO Terms
AF-A0A2V9DHH9-F1-model_v4 Uncharacterized protein 0.9608 2 143
AF-A0A2V9DHH9-F1-model_v4 Uncharacterized protein 0.9311 2 143
AF-A0A2V8Z4Z4-F1-model_v4 Uncharacterized protein 0.9199 1 143
AF-A0A2V8Z4Z4-F1-model_v4 Uncharacterized protein 0.9077 1 143
AF-A0A537V3L9-F1-model_v4 Uncharacterized protein 0.6399 83 120

Map