F415053

General Info

Members Datasets Scaffolds Average Seq Length
342 184 684 262

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100053226|Ga0070714_1000532263
Length 272
Sequence VGGDAVVLSHTSHSKPDRLGKLEAQRAHECRLTPDRALETLDEAEEFLRDRGLLTRTADCALPSLFEACHEEPYARDRPGFGQWPRTKFPWFGQLGARGYLILAVHRGKSLLVTDAVAELLDPICRAELARMEEADEGWARLLRHLADAGPSELEDLQTELSLTPKELKSLRSPLERCGAIVARSIVYEEPHRHTSLLARWDQAHAEPSATTDTRKALGDLVCAGVRAAVVAPEQEPARWFSWRWYWDDDLIDELVAAGRLVRVDGHLAVGG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
79 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.89
Rhizosphere 92.11
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100053226 3300005435 Bacteria 3454
2 Ga0070683_100057661 3300005329 Bacteria 3608
3 Ga0070683_100200370 3300005329 Unclassified 1896
4 Ga0070690_100268980 3300005330 Bacteria 1212
5 Ga0070680_100031846 3300005336 Bacteria 4240
6 Ga0070661_100279546 3300005344 Bacteria 1294
7 Ga0070709_10010480 3300005434 Bacteria 5137
8 Ga0070709_10079227 3300005434 Bacteria 2139
9 Ga0070714_100018140 3300005435 Bacteria 5710
10 Ga0070714_100021720 3300005435 Bacteria 5253
11 Ga0070714_100032272 3300005435 Bacteria 4370
12 Ga0070714_100102308 3300005435 Bacteria 2525
13 Ga0070714_100184034 3300005435 Bacteria 1902
14 Ga0070713_100003834 3300005436 Bacteria 9961
15 Ga0070713_100016209 3300005436 Bacteria 5601
16 Ga0070713_100023060 3300005436 Unclassified 4821
17 Ga0070713_100185955 3300005436 Bacteria 1870
18 Ga0070710_10018809 3300005437 Bacteria 3560
19 Ga0070710_10027874 3300005437 Bacteria 3016
20 Ga0070711_100000506 3300005439 Bacteria 20277
21 Ga0070705_100078482 3300005440 Unclassified 2019
22 Ga0070705_100142564 3300005440 Bacteria 1579
23 Ga0070708_100003374 3300005445 Bacteria 12514
24 Ga0070681_10095212 3300005458 Bacteria 2926
25 Ga0070706_100008106 3300005467 Bacteria 9794
26 Ga0070706_100026809 3300005467 Bacteria 5301
27 Ga0070706_100031015 3300005467 Bacteria 4929
28 Ga0070706_100036174 3300005467 Bacteria 4559
29 Ga0070706_100037045 3300005467 Bacteria 4506
30 Ga0070707_100143390 3300005468 Bacteria 2325
31 Ga0070698_100000534 3300005471 Bacteria 40564
32 Ga0070698_100008898 3300005471 Bacteria 10791
33 Ga0070698_100034546 3300005471 Bacteria 5233
34 Ga0070698_100042073 3300005471 Bacteria 4687
35 Ga0070679_100034995 3300005530 Bacteria 4981
36 Ga0070679_100201074 3300005530 Bacteria 1958
37 Ga0070679_100208619 3300005530 Bacteria 1918
38 Ga0070684_100136718 3300005535 Unclassified 2214
39 Ga0070695_100000106 3300005545 Bacteria 36745
40 Ga0070695_100155262 3300005545 Bacteria 1601
41 Ga0070695_100569946 3300005545 Unclassified 885
42 Ga0070696_100060910 3300005546 Bacteria 2640
43 Ga0068855_100016388 3300005563 Bacteria 8909
44 Ga0070664_100065396 3300005564 Bacteria 3102
45 Ga0068856_100145666 3300005614 Bacteria 2376
46 Ga0070702_100030738 3300005615 Bacteria 2931
47 Ga0068864_100873126 3300005618 Unclassified 887
48 Ga0068863_100375591 3300005841 Bacteria 1388
49 Ga0068858_100117891 3300005842 Unclassified 2481
50 Ga0081540_1000261 3300005983 Bacteria 55660
51 Ga0070717_10003775 3300006028 Bacteria 10883
52 Ga0070717_10006696 3300006028 Bacteria 8499
53 Ga0070717_10006807 3300006028 Bacteria 8438
54 Ga0070717_10092892 3300006028 Bacteria 2550
55 Ga0070717_10261485 3300006028 Bacteria 1531
56 Ga0070715_10020836 3300006163 Bacteria 2533
57 Ga0070715_10021920 3300006163 Bacteria 2484
58 Ga0070716_100002439 3300006173 Bacteria 8569
59 Ga0070716_100008436 3300006173 Bacteria 5111
60 Ga0070712_100001624 3300006175 Bacteria 13758
61 Ga0068871_100184788 3300006358 Bacteria 1793
62 Ga0068871_100226143 3300006358 Bacteria 1623
63 Ga0075433_10236938 3300006852 Unclassified 1620
64 Ga0075433_10323503 3300006852 Archaea 1364
65 Ga0075434_100097211 3300006871 Bacteria 2949
66 Ga0075434_100110509 3300006871 Archaea 2760
67 Ga0075434_100164225 3300006871 Unclassified 2240
68 Ga0075436_100204062 3300006914 Bacteria 1400
69 Ga0075435_100042828 3300007076 Bacteria 3623
70 Ga0075435_100147890 3300007076 Archaea 1974
71 Ga0105240_10004117 3300009093 Bacteria 22320
72 Ga0111539_10246904 3300009094 Bacteria 2078
73 Ga0111539_10555916 3300009094 Unclassified 1336
74 Ga0105245_10099716 3300009098 Bacteria 2686
75 Ga0105245_10287370 3300009098 Unclassified 1610
76 Ga0105241_10308915 3300009174 Bacteria 1360
77 Ga0105242_10113931 3300009176 Bacteria 2310
78 Ga0105237_10058078 3300009545 Bacteria 3872
79 Ga0105238_10177185 3300009551 Unclassified 2109
80 Ga0105238_10233198 3300009551 Bacteria 1817
81 Ga0157370_10037263 3300013104 Bacteria 4714
82 Ga0157369_10237385 3300013105 Bacteria 1905
83 Ga0157374_10004478 3300013296 Bacteria 11728
84 Ga0157374_10038352 3300013296 Bacteria 4404
85 Ga0163162_10029665 3300013306 Bacteria 5415
86 Ga0157372_10109342 3300013307 Bacteria 3165
87 Ga0157372_10177877 3300013307 Bacteria 2463
88 Ga0157379_10004880 3300014968 Bacteria 11521
89 Ga0157376_10037560 3300014969 Bacteria 3933
90 Ga0206354_10791076 3300020081 Bacteria 1057
91 Ga0207692_10009484 3300025898 Bacteria 4069
92 Ga0207692_10042746 3300025898 Bacteria 2251
93 Ga0207710_10050693 3300025900 Bacteria 1863
94 Ga0207685_10001990 3300025905 Bacteria 4537
95 Ga0207685_10017413 3300025905 Bacteria 2322
96 Ga0207699_10002716 3300025906 Bacteria 8364
97 Ga0207699_10012177 3300025906 Bacteria 4369
98 Ga0207699_10105323 3300025906 Bacteria 1798
99 Ga0207684_10001102 3300025910 Bacteria 30207
100 Ga0207684_10037498 3300025910 Bacteria 4113
101 Ga0207684_10041762 3300025910 Bacteria 3888
102 Ga0207684_10621593 3300025910 Unclassified 922
103 Ga0207707_10150038 3300025912 Bacteria 2038
104 Ga0207695_10022599 3300025913 Bacteria 7134
105 Ga0207671_10269686 3300025914 Bacteria 1341
106 Ga0207693_10000897 3300025915 Bacteria 26699
107 Ga0207693_10001532 3300025915 Bacteria 20428
108 Ga0207693_10044960 3300025915 Bacteria 3470
109 Ga0207663_10002555 3300025916 Bacteria 8742
110 Ga0207663_10039391 3300025916 Bacteria 2863
111 Ga0207652_10112851 3300025921 Bacteria 2412
112 Ga0207652_10132671 3300025921 Bacteria 2222
113 Ga0207646_10053885 3300025922 Bacteria 3598
114 Ga0207646_10103969 3300025922 Bacteria 2547
115 Ga0207659_10230374 3300025926 Bacteria 1494
116 Ga0207687_10598401 3300025927 Bacteria 929
117 Ga0207700_10016976 3300025928 Bacteria 4849
118 Ga0207664_10001972 3300025929 Bacteria 13513
119 Ga0207664_10003347 3300025929 Bacteria 10656
120 Ga0207664_10003935 3300025929 Bacteria 9989
121 Ga0207664_10006925 3300025929 Bacteria 7842
122 Ga0207664_10022035 3300025929 Bacteria 4749
123 Ga0207665_10000653 3300025939 Bacteria 23307
124 Ga0207665_10003805 3300025939 Bacteria 10082
125 Ga0207661_10049857 3300025944 Bacteria 3334
126 Ga0207703_10317727 3300026035 Bacteria 1425
127 Ga0207641_10338675 3300026088 Bacteria 1431
128 Ga0207698_10523910 3300026142 Bacteria 1157
129 Ga0207428_10044541 3300027907 Bacteria 3580
130 Ga0265338_10007820 3300028800 Bacteria 13144
131 Ga0265338_10085303 3300028800 Bacteria 2633
132 Ga0265313_10023177 3300031595 Bacteria 3349
133 Ga0373926_0004360 3300035083 Bacteria 4642
134 Ga0373934_0011919 3300035086 Bacteria 3276
135 Ga0373944_0002520 3300035089 Bacteria 4653
136 Ga0373923_0003427 3300035111 Bacteria 5079
137 Ga0373923_0016454 3300035111 Unclassified 2810
138 Ga0373936_0003660 3300035113 Bacteria 5768
139 Ga0373936_0019262 3300035113 Bacteria 2644
140 Ga0373945_0005995 3300035116 Bacteria 3906
141 Ga0373953_0059929 3300035117 Unclassified 1554
142 Ga0373954_0008267 3300035118 Bacteria 4564
143 Ga0373956_0005402 3300035119 Bacteria 5117
144 Ga0373957_0004976 3300035120 Bacteria 4093
145 Ga0373957_0051223 3300035120 Bacteria 1579
146 Ga0373943_0025578 3300035170 Bacteria 2759
147 Ga0373943_0326091 3300035170 Bacteria 876
148 Ga0373946_0072210 3300035171 Bacteria 1493
149 Ga0373946_0088520 3300035171 Bacteria 1368
150 Ga0373955_0001867 3300035172 Bacteria 9065
151 Ga0373955_0060212 3300035172 Bacteria 2093
152 Ga0373935_0062532 3300035692 Bacteria 2385
153 Ga0373927_0013734 3300035695 Bacteria 5377
154 Ga0373927_0131746 3300035695 Bacteria 1634
155 Ga0373947_0014312 3300035725 Bacteria 4550
156 Ga0373947_0182043 3300035725 Bacteria 1368
157 Ga0373925_0020133 3300037068 Bacteria 4855
158 Ga0395900_0691724 3300037418 Bacteria 954
159 Ga0395900_1080248 3300037418 Unclassified 720
160 Ga0395898_0005363 3300037466 Bacteria 13852
161 Ga0395898_0048954 3300037466 Bacteria 4143
162 Ga0395905_0048812 3300037471 Bacteria 3966
163 Ga0395905_0141047 3300037471 Bacteria 2267
164 Ga0395901_0009993 3300038443 Bacteria 9617
165 Ga0395901_0315335 3300038443 Bacteria 1619
166 Ga0395901_0850054 3300038443 Unclassified 898
167 Ga0466966_0092279 3300044684 Bacteria 1879
168 Ga0466961_0027973 3300044693 Bacteria 3625
169 Ga0466963_0000010 3300044694 Bacteria 68690
170 Ga0466963_0000940 3300044694 Bacteria 14893
171 Ga0466963_0012009 3300044694 Bacteria 5290
172 Ga0466963_0020036 3300044694 Bacteria 4203
173 Ga0466963_0054993 3300044694 Bacteria 2646
174 Ga0466963_0068233 3300044694 Bacteria 2388
175 Ga0466964_0003951 3300044706 Bacteria 5450
176 Ga0466964_0004603 3300044706 Bacteria 5099
177 Ga0466964_0007179 3300044706 Bacteria 4167
178 Ga0466964_0030094 3300044706 Bacteria 2147
179 Ga0466971_0005798 3300044719 Bacteria 5374
180 Ga0466971_0032039 3300044719 Bacteria 2355
181 Ga0466971_0082442 3300044719 Bacteria 1468
182 Ga0466957_0020394 3300044842 Bacteria 3900
183 Ga0466957_0041037 3300044842 Bacteria 2798
184 Ga0466960_0015804 3300044901 Bacteria 3262
185 Ga0466960_0119742 3300044901 Bacteria 1377
186 Ga0466959_0012642 3300045049 Bacteria 6104
187 Ga0466958_0002690 3300045836 Bacteria 9012
188 Ga0466958_0016101 3300045836 Bacteria 4301
189 Ga0466958_0113779 3300045836 Bacteria 1690
190 Ga0466967_0000461 3300045976 Bacteria 19560
191 Ga0466967_0004573 3300045976 Bacteria 9372
192 Ga0466967_0011308 3300045976 Bacteria 6750
193 Ga0466967_0015554 3300045976 Bacteria 5967
194 Ga0466967_0030354 3300045976 Bacteria 4535
195 Ga0466967_0034996 3300045976 Bacteria 4270
196 Ga0466967_0073095 3300045976 Bacteria 3075
197 Ga0466967_0273709 3300045976 Bacteria 1618
198 Ga0466967_0285909 3300045976 Bacteria 1583
199 Ga0466967_0351011 3300045976 Unclassified 1428
200 Ga0466967_0439184 3300045976 Unclassified 1274
201 Ga0495592_0048756 3300046454 Bacteria 3149
202 Ga0495603_0015012 3300046455 Bacteria 4682
203 Ga0495603_0289896 3300046455 Unclassified 940
204 Ga0495629_0015262 3300046459 Bacteria 5518
205 Ga0495641_0009298 3300046461 Bacteria 5851
206 Ga0495641_0127103 3300046461 Bacteria 1137
207 Ga0495651_0066692 3300046462 Bacteria 2746
208 Ga0495651_0321953 3300046462 Bacteria 1030
209 Ga0495653_0011407 3300046463 Bacteria 7262
210 Ga0495653_0149045 3300046463 Bacteria 1636
211 Ga0495653_0218241 3300046463 Unclassified 1283
212 Ga0495580_0171501 3300046472 Bacteria 1500
213 Ga0495582_0012122 3300046473 Bacteria 4749
214 Ga0495605_0005345 3300046474 Bacteria 7485
215 Ga0495639_0002520 3300046475 Bacteria 7996
216 Ga0495639_0057834 3300046475 Bacteria 1772
217 Ga0495662_0017996 3300046476 Bacteria 3419
218 Ga0495662_0033570 3300046476 Bacteria 2479
219 Ga0495662_0219270 3300046476 Bacteria 937
220 Ga0495664_0019490 3300046477 Bacteria 3900
221 Ga0495664_0037534 3300046477 Bacteria 2859
222 Ga0495664_0146997 3300046477 Bacteria 1429
223 Ga0495664_0185404 3300046477 Bacteria 1261
224 Ga0495664_0317583 3300046477 Bacteria 939
225 Ga0495584_0004338 3300046491 Bacteria 7636
226 Ga0495607_0061798 3300046501 Bacteria 2127
227 Ga0495608_0080515 3300046511 Bacteria 2117
228 Ga0495618_0030579 3300046514 Bacteria 3363
229 Ga0495618_0150332 3300046514 Bacteria 1487
230 Ga0495628_0077493 3300046516 Bacteria 2585
231 Ga0495630_0108037 3300046517 Bacteria 2107
232 Ga0495630_0470309 3300046517 Bacteria 963
233 Ga0495644_0002792 3300046523 Bacteria 6921
234 Ga0495666_0051470 3300046526 Bacteria 1978
235 Ga0495666_0144672 3300046526 Bacteria 1107
236 Ga0495652_0019202 3300046529 Bacteria 6087
237 Ga0495652_0032920 3300046529 Bacteria 4530
238 Ga0495652_0087485 3300046529 Bacteria 2556
239 Ga0495665_0004000 3300046531 Bacteria 7949
240 Ga0495665_0006170 3300046531 Bacteria 6472
241 Ga0495640_0026909 3300046533 Bacteria 4151
242 Ga0495640_0147406 3300046533 Bacteria 1513
243 Ga0495586_0002262 3300046535 Bacteria 10473
244 Ga0495586_0049339 3300046535 Bacteria 2275
245 Ga0495586_0211481 3300046535 Bacteria 1100
246 Ga0495587_0001292 3300046536 Bacteria 16624
247 Ga0495587_0003212 3300046536 Bacteria 10923
248 Ga0495645_0006140 3300046543 Bacteria 8313
249 Ga0495645_0083002 3300046543 Unclassified 2297
250 Ga0495645_0209427 3300046543 Bacteria 1317
251 Ga0495667_0148126 3300046559 Unclassified 1511
252 Ga0495656_0001640 3300046615 Bacteria 7320
253 Ga0495656_0129745 3300046615 Bacteria 1199
254 Ga0495668_0056321 3300046616 Bacteria 2170
255 Ga0495634_0005053 3300046642 Bacteria 10186
256 Ga0495634_0021182 3300046642 Bacteria 4599
257 Ga0495635_0011724 3300046663 Bacteria 6146
258 Ga0495635_0018518 3300046663 Bacteria 4858
259 Ga0495659_0058780 3300046664 Bacteria 1416
260 Ga0495599_0128274 3300046678 Bacteria 1576
261 Ga0495623_0027493 3300046679 Bacteria 3659
262 Ga0495623_0037958 3300046679 Bacteria 3080
263 Ga0495646_0091916 3300046680 Unclassified 1750
264 Ga0495646_0118162 3300046680 Bacteria 1503
265 Ga0495646_0133615 3300046680 Bacteria 1394
266 Ga0495647_0034866 3300046681 Archaea 1887
267 Ga0495647_0198079 3300046681 Bacteria 880
268 Ga0495658_0006271 3300046683 Bacteria 5845
269 Ga0495613_0061876 3300046689 Bacteria 2740
270 Ga0495613_0067824 3300046689 Unclassified 2603
271 Ga0495624_0006087 3300046690 Bacteria 8599
272 Ga0495624_0124467 3300046690 Bacteria 1582
273 Ga0495589_0015007 3300046794 Bacteria 3986
274 Ga0495581_0009840 3300047315 Bacteria 5532
275 Ga0495604_0017236 3300047317 Bacteria 5779
276 Ga0495674_0008191 3300047319 Bacteria 9973
277 Ga0495674_0330309 3300047319 Bacteria 1241
278 Ga0495674_0357520 3300047319 Bacteria 1184
279 Ga0495676_0031102 3300047321 Bacteria 4519
280 Ga0495676_0198646 3300047321 Bacteria 1394
281 Ga0495680_0054658 3300047322 Bacteria 3099
282 Ga0495680_0161210 3300047322 Bacteria 1628
283 Ga0495675_0100804 3300047444 Bacteria 1807
284 Ga0495677_0056180 3300047445 Bacteria 1454
285 Ga0495679_017032 3300047446 Bacteria 2612
286 Ga0495684_0011010 3300047471 Bacteria 6993
287 Ga0495684_0096011 3300047471 Bacteria 2243
288 Ga0495684_0171998 3300047471 Bacteria 1610
289 Ga0495593_0044698 3300047673 Bacteria 2367
290 Ga0495602_0021009 3300048088 Bacteria 6435
291 Ga0495602_0166190 3300048088 Bacteria 1717
292 Ga0495614_0013547 3300048089 Bacteria 3574
293 Ga0495614_0056669 3300048089 Bacteria 1682
294 Ga0496100_0008322 3300048903 Bacteria 5783
295 Ga0496100_0336447 3300048903 Bacteria 1137
296 Ga0496101_0021289 3300048904 Bacteria 4454
297 Ga0496101_0048100 3300048904 Bacteria 3064
298 Ga0496101_0335897 3300048904 Unclassified 1186
299 Ga0496102_0009502 3300048905 Bacteria 8361
300 Ga0496103_0012452 3300048906 Bacteria 5045
301 Ga0496103_0056076 3300048906 Bacteria 2445
302 Ga0496104_0039568 3300048907 Bacteria 4414
303 Ga0496104_0120343 3300048907 Bacteria 2520
304 Ga0496104_0343630 3300048907 Bacteria 1405
305 Ga0496105_0022619 3300048908 Bacteria 5092
306 Ga0496105_0045328 3300048908 Bacteria 3628
307 Ga0496106_0050758 3300048909 Bacteria 3126
308 Ga0496106_0636462 3300048909 Bacteria 853
309 Ga0496107_0016043 3300048910 Bacteria 5256
310 Ga0496108_0007314 3300048911 Bacteria 8951
311 Ga0496108_0099780 3300048911 Bacteria 2475
312 Ga0496109_0168599 3300048912 Bacteria 2053
313 Ga0496111_0021716 3300048914 Bacteria 4484
314 Ga0496111_0022279 3300048914 Bacteria 4433
315 Ga0496111_0027276 3300048914 Bacteria 4039
316 Ga0496112_0103107 3300048915 Bacteria 2822
317 Ga0496112_0121907 3300048915 Bacteria 2578
318 Ga0496113_0021017 3300048916 Bacteria 4599
319 Ga0496114_0045085 3300048917 Bacteria 3661
320 Ga0496115_0174579 3300048918 Bacteria 1777
321 Ga0501067_0056167 3300049583 Bacteria 2182
322 nmdc:mga08y16_246677_c1 3300050511 Bacteria 1845
323 nmdc:mga08y16_354078_c1 3300050511 Unclassified 1508
324 nmdc:mga0n895_248574_c1 3300050512 Unclassified 1805
325 nmdc:mga0n895_87225_c1 3300050512 Bacteria 3118
326 nmdc:mga0rr50_120227_c1 3300050513 Bacteria 2090
327 nmdc:mga0rr50_174104_c1 3300050513 Archaea 1755
328 nmdc:mga0rr50_44532_c1 3300050513 Bacteria 3255
329 nmdc:mga08x19_187698_c1 3300050514 Bacteria 1413
330 nmdc:mga0a205_245888_c1 3300050515 Unclassified 1669
331 nmdc:mga0a205_37080_c1 3300050515 Bacteria 4688
332 Ga0495601_0020633 3300053077 Bacteria 4025
333 Ga0495601_0052180 3300053077 Bacteria 2581
334 Ga0495612_0006186 3300053078 Bacteria 4927
335 Ga0495612_0006290 3300053078 Bacteria 4893
336 Ga0495612_0007547 3300053078 Bacteria 4445
337 Ga0495612_0093239 3300053078 Bacteria 1277
338 Ga0495595_0002184 3300053084 Bacteria 7603
339 Ga0495619_0029449 3300053085 Bacteria 3547
340 Ga0466962_0021107 3300061719 Bacteria 3128
341 Ga0466962_0029832 3300061719 Bacteria 2611
342 Ga0466962_0056091 3300061719 Bacteria 1882
343 Ga0070714_100053226
344 Ga0070683_100057661
345 Ga0070683_100200370
346 Ga0070690_100268980
347 Ga0070680_100031846
348 Ga0070661_100279546
349 Ga0070709_10010480
350 Ga0070709_10079227
351 Ga0070714_100018140
352 Ga0070714_100021720
353 Ga0070714_100032272
354 Ga0070714_100102308
355 Ga0070714_100184034
356 Ga0070713_100003834
357 Ga0070713_100016209
358 Ga0070713_100023060
359 Ga0070713_100185955
360 Ga0070710_10018809
361 Ga0070710_10027874
362 Ga0070711_100000506
363 Ga0070705_100078482
364 Ga0070705_100142564
365 Ga0070708_100003374
366 Ga0070681_10095212
367 Ga0070706_100008106
368 Ga0070706_100026809
369 Ga0070706_100031015
370 Ga0070706_100036174
371 Ga0070706_100037045
372 Ga0070707_100143390
373 Ga0070698_100000534
374 Ga0070698_100008898
375 Ga0070698_100034546
376 Ga0070698_100042073
377 Ga0070679_100034995
378 Ga0070679_100201074
379 Ga0070679_100208619
380 Ga0070684_100136718
381 Ga0070695_100000106
382 Ga0070695_100155262
383 Ga0070695_100569946
384 Ga0070696_100060910
385 Ga0068855_100016388
386 Ga0070664_100065396
387 Ga0068856_100145666
388 Ga0070702_100030738
389 Ga0068864_100873126
390 Ga0068863_100375591
391 Ga0068858_100117891
392 Ga0081540_1000261
393 Ga0070717_10003775
394 Ga0070717_10006696
395 Ga0070717_10006807
396 Ga0070717_10092892
397 Ga0070717_10261485
398 Ga0070715_10020836
399 Ga0070715_10021920
400 Ga0070716_100002439
401 Ga0070716_100008436
402 Ga0070712_100001624
403 Ga0068871_100184788
404 Ga0068871_100226143
405 Ga0075433_10236938
406 Ga0075433_10323503
407 Ga0075434_100097211
408 Ga0075434_100110509
409 Ga0075434_100164225
410 Ga0075436_100204062
411 Ga0075435_100042828
412 Ga0075435_100147890
413 Ga0105240_10004117
414 Ga0111539_10246904
415 Ga0111539_10555916
416 Ga0105245_10099716
417 Ga0105245_10287370
418 Ga0105241_10308915
419 Ga0105242_10113931
420 Ga0105237_10058078
421 Ga0105238_10177185
422 Ga0105238_10233198
423 Ga0157370_10037263
424 Ga0157369_10237385
425 Ga0157374_10004478
426 Ga0157374_10038352
427 Ga0163162_10029665
428 Ga0157372_10109342
429 Ga0157372_10177877
430 Ga0157379_10004880
431 Ga0157376_10037560
432 Ga0206354_10791076
433 Ga0207692_10009484
434 Ga0207692_10042746
435 Ga0207710_10050693
436 Ga0207685_10001990
437 Ga0207685_10017413
438 Ga0207699_10002716
439 Ga0207699_10012177
440 Ga0207699_10105323
441 Ga0207684_10001102
442 Ga0207684_10037498
443 Ga0207684_10041762
444 Ga0207684_10621593
445 Ga0207707_10150038
446 Ga0207695_10022599
447 Ga0207671_10269686
448 Ga0207693_10000897
449 Ga0207693_10001532
450 Ga0207693_10044960
451 Ga0207663_10002555
452 Ga0207663_10039391
453 Ga0207652_10112851
454 Ga0207652_10132671
455 Ga0207646_10053885
456 Ga0207646_10103969
457 Ga0207659_10230374
458 Ga0207687_10598401
459 Ga0207700_10016976
460 Ga0207664_10001972
461 Ga0207664_10003347
462 Ga0207664_10003935
463 Ga0207664_10006925
464 Ga0207664_10022035
465 Ga0207665_10000653
466 Ga0207665_10003805
467 Ga0207661_10049857
468 Ga0207703_10317727
469 Ga0207641_10338675
470 Ga0207698_10523910
471 Ga0207428_10044541
472 Ga0265338_10007820
473 Ga0265338_10085303
474 Ga0265313_10023177
475 Ga0373926_0004360
476 Ga0373934_0011919
477 Ga0373944_0002520
478 Ga0373923_0003427
479 Ga0373923_0016454
480 Ga0373936_0003660
481 Ga0373936_0019262
482 Ga0373945_0005995
483 Ga0373953_0059929
484 Ga0373954_0008267
485 Ga0373956_0005402
486 Ga0373957_0004976
487 Ga0373957_0051223
488 Ga0373943_0025578
489 Ga0373943_0326091
490 Ga0373946_0072210
491 Ga0373946_0088520
492 Ga0373955_0001867
493 Ga0373955_0060212
494 Ga0373935_0062532
495 Ga0373927_0013734
496 Ga0373927_0131746
497 Ga0373947_0014312
498 Ga0373947_0182043
499 Ga0373925_0020133
500 Ga0395900_0691724
501 Ga0395900_1080248
502 Ga0395898_0005363
503 Ga0395898_0048954
504 Ga0395905_0048812
505 Ga0395905_0141047
506 Ga0395901_0009993
507 Ga0395901_0315335
508 Ga0395901_0850054
509 Ga0466966_0092279
510 Ga0466961_0027973
511 Ga0466963_0000010
512 Ga0466963_0000940
513 Ga0466963_0012009
514 Ga0466963_0020036
515 Ga0466963_0054993
516 Ga0466963_0068233
517 Ga0466964_0003951
518 Ga0466964_0004603
519 Ga0466964_0007179
520 Ga0466964_0030094
521 Ga0466971_0005798
522 Ga0466971_0032039
523 Ga0466971_0082442
524 Ga0466957_0020394
525 Ga0466957_0041037
526 Ga0466960_0015804
527 Ga0466960_0119742
528 Ga0466959_0012642
529 Ga0466958_0002690
530 Ga0466958_0016101
531 Ga0466958_0113779
532 Ga0466967_0000461
533 Ga0466967_0004573
534 Ga0466967_0011308
535 Ga0466967_0015554
536 Ga0466967_0030354
537 Ga0466967_0034996
538 Ga0466967_0073095
539 Ga0466967_0273709
540 Ga0466967_0285909
541 Ga0466967_0351011
542 Ga0466967_0439184
543 Ga0495592_0048756
544 Ga0495603_0015012
545 Ga0495603_0289896
546 Ga0495629_0015262
547 Ga0495641_0009298
548 Ga0495641_0127103
549 Ga0495651_0066692
550 Ga0495651_0321953
551 Ga0495653_0011407
552 Ga0495653_0149045
553 Ga0495653_0218241
554 Ga0495580_0171501
555 Ga0495582_0012122
556 Ga0495605_0005345
557 Ga0495639_0002520
558 Ga0495639_0057834
559 Ga0495662_0017996
560 Ga0495662_0033570
561 Ga0495662_0219270
562 Ga0495664_0019490
563 Ga0495664_0037534
564 Ga0495664_0146997
565 Ga0495664_0185404
566 Ga0495664_0317583
567 Ga0495584_0004338
568 Ga0495607_0061798
569 Ga0495608_0080515
570 Ga0495618_0030579
571 Ga0495618_0150332
572 Ga0495628_0077493
573 Ga0495630_0108037
574 Ga0495630_0470309
575 Ga0495644_0002792
576 Ga0495666_0051470
577 Ga0495666_0144672
578 Ga0495652_0019202
579 Ga0495652_0032920
580 Ga0495652_0087485
581 Ga0495665_0004000
582 Ga0495665_0006170
583 Ga0495640_0026909
584 Ga0495640_0147406
585 Ga0495586_0002262
586 Ga0495586_0049339
587 Ga0495586_0211481
588 Ga0495587_0001292
589 Ga0495587_0003212
590 Ga0495645_0006140
591 Ga0495645_0083002
592 Ga0495645_0209427
593 Ga0495667_0148126
594 Ga0495656_0001640
595 Ga0495656_0129745
596 Ga0495668_0056321
597 Ga0495634_0005053
598 Ga0495634_0021182
599 Ga0495635_0011724
600 Ga0495635_0018518
601 Ga0495659_0058780
602 Ga0495599_0128274
603 Ga0495623_0027493
604 Ga0495623_0037958
605 Ga0495646_0091916
606 Ga0495646_0118162
607 Ga0495646_0133615
608 Ga0495647_0034866
609 Ga0495647_0198079
610 Ga0495658_0006271
611 Ga0495613_0061876
612 Ga0495613_0067824
613 Ga0495624_0006087
614 Ga0495624_0124467
615 Ga0495589_0015007
616 Ga0495581_0009840
617 Ga0495604_0017236
618 Ga0495674_0008191
619 Ga0495674_0330309
620 Ga0495674_0357520
621 Ga0495676_0031102
622 Ga0495676_0198646
623 Ga0495680_0054658
624 Ga0495680_0161210
625 Ga0495675_0100804
626 Ga0495677_0056180
627 Ga0495679_017032
628 Ga0495684_0011010
629 Ga0495684_0096011
630 Ga0495684_0171998
631 Ga0495593_0044698
632 Ga0495602_0021009
633 Ga0495602_0166190
634 Ga0495614_0013547
635 Ga0495614_0056669
636 Ga0496100_0008322
637 Ga0496100_0336447
638 Ga0496101_0021289
639 Ga0496101_0048100
640 Ga0496101_0335897
641 Ga0496102_0009502
642 Ga0496103_0012452
643 Ga0496103_0056076
644 Ga0496104_0039568
645 Ga0496104_0120343
646 Ga0496104_0343630
647 Ga0496105_0022619
648 Ga0496105_0045328
649 Ga0496106_0050758
650 Ga0496106_0636462
651 Ga0496107_0016043
652 Ga0496108_0007314
653 Ga0496108_0099780
654 Ga0496109_0168599
655 Ga0496111_0021716
656 Ga0496111_0022279
657 Ga0496111_0027276
658 Ga0496112_0103107
659 Ga0496112_0121907
660 Ga0496113_0021017
661 Ga0496114_0045085
662 Ga0496115_0174579
663 Ga0501067_0056167
664 nmdc:mga08y16_246677_c1
665 nmdc:mga08y16_354078_c1
666 nmdc:mga0n895_248574_c1
667 nmdc:mga0n895_87225_c1
668 nmdc:mga0rr50_120227_c1
669 nmdc:mga0rr50_174104_c1
670 nmdc:mga0rr50_44532_c1
671 nmdc:mga08x19_187698_c1
672 nmdc:mga0a205_245888_c1
673 nmdc:mga0a205_37080_c1
674 Ga0495601_0020633
675 Ga0495601_0052180
676 Ga0495612_0006186
677 Ga0495612_0006290
678 Ga0495612_0007547
679 Ga0495612_0093239
680 Ga0495595_0002184
681 Ga0495619_0029449
682 Ga0466962_0021107
683 Ga0466962_0029832
684 Ga0466962_0056091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mlg-assembly1.cif.gz_A stf76 from the sulfolobus islandicus plasmid-virus pssvx 0.8573 124 191
6xjf-assembly3.cif.gz_C x-ray crystal structure of pyrococcus furiosus general transcription factor tfe-alpha (semet labeled protein) 0.8277 116 190
5f7q-assembly1.cif.gz_J rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8227 128 194
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8189 134 191
6xjf-assembly4.cif.gz_D x-ray crystal structure of pyrococcus furiosus general transcription factor tfe-alpha (semet labeled protein) 0.8016 117 190
ID Description Score Start End Superfamily
af_Q8K284_174_250_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8854 126 190 1.10.10.10
af_Q54FU1_288_364_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.881 126 193 1.10.10.10
af_O94663_173_242_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8797 126 197 1.10.10.10
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8622 118 190 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8573 124 191 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A538M6J3-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9355 9 261
AF-A0A838HHH7-F1-model_v4 Uncharacterized protein 0.9352 89 261
AF-A0A3A5MKL2-F1-model_v4 ArsR family transcriptional regulator 0.9262 125 190
AF-A0A535BQ15-F1-model_v4 GAF domain-containing protein 0.9231 9 261 GO:0016020
AF-A0A536QP07-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.921 9 261

Map