F415036

General Info

Members Datasets Scaffolds Average Seq Length
342 183 684 157

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10400549|Ga0070691_104005492
Length 155
Sequence MDLADILGRDQIVPELKASNRWEAIDELIGNLVATGKIQPGDRDAVTAAVKKRETSMSTGIIPHASTDLIFEVVGALGRSRTGVNFDALDNQPVKLVMLFLVPQGQFQKHLHTLANIAKLLHKTEFRQSLEEAPDADTMYRIIKDQSGGAPGTAR

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 41.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10400549 3300005341 Bacteria 773
2 rootH2_10086513 3300003320 Bacteria 10086
3 Ga0065712_10526566 3300005290 Unclassified 632
4 Ga0070683_100671210 3300005329 Unclassified 992
5 Ga0070690_100119955 3300005330 Bacteria 1764
6 Ga0070677_10142709 3300005333 Bacteria 1106
7 Ga0068869_100380950 3300005334 Bacteria 1156
8 Ga0070666_10189588 3300005335 Bacteria 1444
9 Ga0070680_100705970 3300005336 Bacteria 868
10 Ga0070689_100077795 3300005340 Bacteria 2600
11 Ga0070689_100138119 3300005340 Bacteria 1958
12 Ga0070689_100255792 3300005340 Unclassified 1446
13 Ga0070689_100331484 3300005340 Bacteria 1273
14 Ga0070689_100827373 3300005340 Unclassified 816
15 Ga0070689_101353607 3300005340 Bacteria 642
16 Ga0070687_101168636 3300005343 Unclassified 566
17 Ga0070692_10503940 3300005345 Unclassified 785
18 Ga0070692_10940488 3300005345 Unclassified 600
19 Ga0070669_100903974 3300005353 Unclassified 754
20 Ga0070669_101656144 3300005353 Unclassified 557
21 Ga0070675_100598346 3300005354 Bacteria 1000
22 Ga0070673_100058322 3300005364 Bacteria 3052
23 Ga0070688_100032995 3300005365 Bacteria 3127
24 Ga0070688_100435444 3300005365 Unclassified 977
25 Ga0070688_100465464 3300005365 Bacteria 948
26 Ga0070667_101313302 3300005367 Bacteria 678
27 Ga0070713_100167074 3300005436 Bacteria 1968
28 Ga0070713_100287183 3300005436 Unclassified 1511
29 Ga0070711_100283427 3300005439 Unclassified 1312
30 Ga0070711_101464311 3300005439 Unclassified 595
31 Ga0070705_100155992 3300005440 Bacteria 1520
32 Ga0070694_101416542 3300005444 Unclassified 587
33 Ga0070708_100028672 3300005445 Bacteria 4794
34 Ga0070662_101158159 3300005457 Bacteria 664
35 Ga0070681_10074507 3300005458 Unclassified 3356
36 Ga0070685_10019871 3300005466 Bacteria 3629
37 Ga0070685_10065144 3300005466 Bacteria 2144
38 Ga0070685_10749104 3300005466 Unclassified 716
39 Ga0070707_100373675 3300005468 Bacteria 1385
40 Ga0070698_100328289 3300005471 Bacteria 1461
41 Ga0070679_100358983 3300005530 Unclassified 1404
42 Ga0070679_100634010 3300005530 Bacteria 1012
43 Ga0070684_101167758 3300005535 Bacteria 724
44 Ga0070684_101999268 3300005535 Bacteria 547
45 Ga0070686_100001546 3300005544 Bacteria 12935
46 Ga0070686_100234893 3300005544 Bacteria 1332
47 Ga0070686_100648847 3300005544 Unclassified 837
48 Ga0070686_100967611 3300005544 Bacteria 696
49 Ga0070686_101523046 3300005544 Unclassified 564
50 Ga0070695_100184307 3300005545 Bacteria 1481
51 Ga0070696_100828788 3300005546 Bacteria 763
52 Ga0070704_100010223 3300005549 Bacteria 5708
53 Ga0070704_100568483 3300005549 Bacteria 993
54 Ga0070704_101941689 3300005549 Unclassified 546
55 Ga0068855_100157062 3300005563 Bacteria 2584
56 Ga0068855_100825742 3300005563 Unclassified 984
57 Ga0068857_100065015 3300005577 Bacteria 3243
58 Ga0068857_100363519 3300005577 Unclassified 1342
59 Ga0068857_100758879 3300005577 Unclassified 924
60 Ga0068856_100194095 3300005614 Unclassified 2044
61 Ga0068856_100230497 3300005614 Bacteria 1867
62 Ga0068856_102415216 3300005614 Unclassified 533
63 Ga0070702_100066679 3300005615 Bacteria 2112
64 Ga0068859_100191387 3300005617 Unclassified 2130
65 Ga0068859_100245143 3300005617 Unclassified 1881
66 Ga0068859_100451320 3300005617 Unclassified 1382
67 Ga0068859_100512024 3300005617 Bacteria 1295
68 Ga0068859_100647945 3300005617 Unclassified 1148
69 Ga0068859_100923336 3300005617 Unclassified 957
70 Ga0068864_100264746 3300005618 Bacteria 1600
71 Ga0068864_100431710 3300005618 Unclassified 1257
72 Ga0068864_101011062 3300005618 Bacteria 825
73 Ga0068861_101616545 3300005719 Unclassified 639
74 Ga0068863_100083885 3300005841 Bacteria 3020
75 Ga0068863_100143754 3300005841 Bacteria 2281
76 Ga0068863_100322402 3300005841 Bacteria 1501
77 Ga0068863_100504753 3300005841 Unclassified 1191
78 Ga0068863_100552286 3300005841 Bacteria 1137
79 Ga0068858_100175472 3300005842 Bacteria 2022
80 Ga0068858_100698763 3300005842 Unclassified 987
81 Ga0068858_100810989 3300005842 Bacteria 913
82 Ga0068860_100761664 3300005843 Bacteria 980
83 Ga0068860_102212287 3300005843 Unclassified 571
84 Ga0068862_100293879 3300005844 Bacteria 1493
85 Ga0081455_10202470 3300005937 Unclassified 1486
86 Ga0070716_100503193 3300006173 Unclassified 894
87 Ga0097621_100478415 3300006237 Unclassified 1125
88 Ga0097621_100764406 3300006237 Unclassified 893
89 Ga0068871_101677832 3300006358 Unclassified 602
90 Ga0068871_101714856 3300006358 Unclassified 596
91 Ga0075428_100003743 3300006844 Bacteria 16685
92 Ga0075428_100024129 3300006844 Bacteria 6728
93 Ga0075430_100439724 3300006846 Bacteria 1076
94 Ga0075431_100290928 3300006847 Bacteria 1653
95 Ga0075433_10611024 3300006852 Bacteria 957
96 Ga0075434_101375936 3300006871 Unclassified 716
97 Ga0075436_100150199 3300006914 Bacteria 1639
98 Ga0097620_100191384 3300006931 Unclassified 2130
99 Ga0097620_100245163 3300006931 Unclassified 1881
100 Ga0097620_100451347 3300006931 Unclassified 1382
101 Ga0097620_100511986 3300006931 Bacteria 1295
102 Ga0097620_100647903 3300006931 Unclassified 1148
103 Ga0097620_100923344 3300006931 Unclassified 957
104 Ga0105240_10000765 3300009093 Bacteria 58427
105 Ga0105240_10266841 3300009093 Unclassified 1973
106 Ga0105240_10302290 3300009093 Unclassified 1830
107 Ga0105240_10362854 3300009093 Bacteria 1640
108 Ga0105240_11049995 3300009093 Unclassified 869
109 Ga0111539_10015345 3300009094 Bacteria 9538
110 Ga0105245_10370205 3300009098 Bacteria 1424
111 Ga0114129_10765569 3300009147 Unclassified 1235
112 Ga0105241_11015709 3300009174 Unclassified 777
113 Ga0105242_10011364 3300009176 Bacteria 6844
114 Ga0105242_11060795 3300009176 Unclassified 822
115 Ga0105248_10367007 3300009177 Bacteria 1621
116 Ga0105248_11354942 3300009177 Unclassified 805
117 Ga0105237_10448232 3300009545 Bacteria 1296
118 Ga0105238_10004939 3300009551 Bacteria 13195
119 Ga0105238_10159544 3300009551 Bacteria 2231
120 Ga0105249_10410931 3300009553 Unclassified 1385
121 Ga0105246_11480005 3300011119 Unclassified 637
122 Ga0157373_10598287 3300013100 Unclassified 803
123 Ga0157370_10071277 3300013104 Bacteria 3278
124 Ga0157370_10179718 3300013104 Bacteria 1966
125 Ga0157369_12003285 3300013105 Unclassified 587
126 Ga0157374_10462470 3300013296 Bacteria 1271
127 Ga0157374_10608359 3300013296 Bacteria 1103
128 Ga0157374_10731387 3300013296 Bacteria 1004
129 Ga0157378_10259300 3300013297 Bacteria 1667
130 Ga0157378_10792604 3300013297 Bacteria 973
131 Ga0163162_10597787 3300013306 Unclassified 1230
132 Ga0163162_10754049 3300013306 Bacteria 1092
133 Ga0157372_11574993 3300013307 Unclassified 756
134 Ga0157375_10000070 3300013308 Bacteria 108417
135 Ga0157375_10081667 3300013308 Bacteria 3273
136 Ga0157375_11618080 3300013308 Bacteria 766
137 Ga0157375_12273896 3300013308 Unclassified 646
138 Ga0163163_10000018 3300014325 Bacteria 199503
139 Ga0163163_10611856 3300014325 Unclassified 1153
140 Ga0163163_11058421 3300014325 Bacteria 874
141 Ga0157380_11247410 3300014326 Unclassified 789
142 Ga0157376_10540286 3300014969 Bacteria 1152
143 Ga0157376_10658479 3300014969 Unclassified 1048
144 Ga0157376_10834260 3300014969 Unclassified 936
145 Ga0207680_10219323 3300025903 Bacteria 1303
146 Ga0207680_10787131 3300025903 Bacteria 682
147 Ga0207684_10898068 3300025910 Unclassified 745
148 Ga0207684_11094444 3300025910 Bacteria 663
149 Ga0207707_10140581 3300025912 Unclassified 2111
150 Ga0207695_10023180 3300025913 Bacteria 7023
151 Ga0207695_10109250 3300025913 Bacteria 2748
152 Ga0207695_10207357 3300025913 Bacteria 1872
153 Ga0207671_10553602 3300025914 Unclassified 917
154 Ga0207663_10724498 3300025916 Unclassified 789
155 Ga0207662_10299406 3300025918 Unclassified 1069
156 Ga0207662_10529978 3300025918 Unclassified 814
157 Ga0207657_10206884 3300025919 Bacteria 1576
158 Ga0207652_10111333 3300025921 Unclassified 2428
159 Ga0207652_10642335 3300025921 Bacteria 949
160 Ga0207694_10001584 3300025924 Bacteria 19271
161 Ga0207694_10229979 3300025924 Unclassified 1514
162 Ga0207694_10232034 3300025924 Unclassified 1507
163 Ga0207700_10433937 3300025928 Unclassified 1155
164 Ga0207664_10042290 3300025929 Bacteria 3556
165 Ga0207706_10804010 3300025933 Bacteria 799
166 Ga0207670_10002888 3300025936 Bacteria 9068
167 Ga0207670_10008132 3300025936 Bacteria 5902
168 Ga0207670_10350695 3300025936 Unclassified 1169
169 Ga0207670_10798705 3300025936 Bacteria 786
170 Ga0207665_10445512 3300025939 Unclassified 993
171 Ga0207665_10657833 3300025939 Unclassified 822
172 Ga0207711_11345263 3300025941 Unclassified 657
173 Ga0207679_10861401 3300025945 Bacteria 828
174 Ga0207667_10317449 3300025949 Unclassified 1591
175 Ga0207712_10158646 3300025961 Unclassified 1755
176 Ga0207658_10964807 3300025986 Bacteria 777
177 Ga0207708_10211312 3300026075 Bacteria 1551
178 Ga0207702_10306677 3300026078 Bacteria 1508
179 Ga0207641_10321144 3300026088 Bacteria 1468
180 Ga0207676_10238566 3300026095 Bacteria 1630
181 Ga0207676_11144189 3300026095 Unclassified 770
182 Ga0207674_10014058 3300026116 Bacteria 8843
183 Ga0207674_10488397 3300026116 Unclassified 1190
184 Ga0207674_10536725 3300026116 Unclassified 1130
185 Ga0207674_10806901 3300026116 Unclassified 906
186 Ga0207675_101810672 3300026118 Unclassified 630
187 Ga0268265_11358686 3300028380 Unclassified 712
188 Ga0268264_12117343 3300028381 Unclassified 571
189 Ga0265337_1011661 3300028556 Bacteria 3019
190 Ga0265318_10059386 3300028577 Bacteria 1426
191 Ga0265318_10283600 3300028577 Unclassified 604
192 Ga0265336_10027891 3300028666 Bacteria 1766
193 Ga0265338_10003657 3300028800 Bacteria 21412
194 Ga0265338_10014499 3300028800 Bacteria 8770
195 Ga0265338_10055056 3300028800 Bacteria 3542
196 Ga0265338_10060975 3300028800 Unclassified 3309
197 Ga0265338_10100043 3300028800 Bacteria 2366
198 Ga0265338_10142255 3300028800 Bacteria 1877
199 Ga0265338_10301414 3300028800 Unclassified 1165
200 Ga0265338_10696504 3300028800 Bacteria 701
201 Ga0265338_10959904 3300028800 Unclassified 580
202 Ga0265320_10003641 3300031240 Bacteria 10294
203 Ga0265320_10465776 3300031240 Unclassified 558
204 Ga0265340_10000269 3300031247 Bacteria 26964
205 Ga0265339_10035947 3300031249 Bacteria 2774
206 Ga0265327_10006584 3300031251 Bacteria 9235
207 Ga0265316_10405786 3300031344 Bacteria 981
208 Ga0265316_10694364 3300031344 Unclassified 718
209 Ga0265342_10105026 3300031712 Bacteria 1605
210 Ga0265342_10124540 3300031712 Bacteria 1448
211 Ga0316576_10549546 3300031727 Bacteria 846
212 Ga0316578_10172701 3300031728 Bacteria 1303
213 Ga0307405_10974661 3300031731 Unclassified 722
214 Ga0307410_10288508 3300031852 Unclassified 1291
215 Ga0307406_10147127 3300031901 Bacteria 1676
216 Ga0307409_101560828 3300031995 Unclassified 688
217 Ga0316580_10137959 3300032139 Bacteria 748
218 Ga0373948_0007140 3300034817 Bacteria 1869
219 Ga0373944_0029282 3300035089 Unclassified 1645
220 Ga0373945_0054482 3300035116 Bacteria 1479
221 Ga0373945_0456885 3300035116 Bacteria 565
222 Ga0373956_0278621 3300035119 Unclassified 796
223 Ga0316574_0006761 3300035398 Bacteria 6229
224 Ga0373924_0435792 3300035410 Bacteria 587
225 Ga0373924_0497410 3300035410 Bacteria 548
226 Ga0373931_0064047 3300035691 Unclassified 1989
227 Ga0373935_0004242 3300035692 Bacteria 8408
228 Ga0373935_0574555 3300035692 Unclassified 823
229 Ga0373927_0023610 3300035695 Unclassified 4026
230 Ga0373947_0119668 3300035725 Bacteria 1672
231 Ga0373947_0214171 3300035725 Unclassified 1264
232 Ga0373947_0630461 3300035725 Unclassified 731
233 Ga0373937_0012553 3300036401 Bacteria 7454
234 Ga0373925_0004248 3300037068 Bacteria 10853
235 Ga0373925_0369237 3300037068 Unclassified 1167
236 Ga0373925_1095765 3300037068 Unclassified 655
237 Ga0395905_0910307 3300037471 Unclassified 782
238 Ga0451577_0000910 3300042876 Bacteria 43577
239 Ga0451577_0185597 3300042876 Bacteria 1875
240 Ga0451577_0396372 3300042876 Unclassified 1253
241 Ga0451577_0412976 3300042876 Bacteria 1225
242 Ga0451577_0823877 3300042876 Unclassified 838
243 Ga0453684_0000783 3300044712 Bacteria 109236
244 Ga0453684_0009012 3300044712 Bacteria 17618
245 Ga0453684_0461549 3300044712 Bacteria 1412
246 Ga0466957_0556969 3300044842 Bacteria 799
247 Ga0451576_0012684 3300045051 Bacteria 9462
248 Ga0451576_0012874 3300045051 Bacteria 9378
249 Ga0451576_0078076 3300045051 Bacteria 3446
250 Ga0451576_0096670 3300045051 Bacteria 3072
251 Ga0451576_0255462 3300045051 Bacteria 1832
252 Ga0451576_0266274 3300045051 Unclassified 1791
253 Ga0451576_0281967 3300045051 Bacteria 1737
254 Ga0451576_0355674 3300045051 Unclassified 1533
255 Ga0451576_0395546 3300045051 Unclassified 1449
256 Ga0451576_0495670 3300045051 Bacteria 1283
257 Ga0451576_0657731 3300045051 Unclassified 1101
258 Ga0451576_0827831 3300045051 Bacteria 972
259 Ga0451576_1328565 3300045051 Unclassified 749
260 Ga0451576_1508012 3300045051 Bacteria 698
261 Ga0451576_2008152 3300045051 Unclassified 596
262 Ga0451576_2246519 3300045051 Unclassified 560
263 Ga0495592_0059404 3300046454 Bacteria 2816
264 Ga0495592_0516791 3300046454 Bacteria 739
265 Ga0495629_0105385 3300046459 Bacteria 1967
266 Ga0495641_0006168 3300046461 Bacteria 7842
267 Ga0495651_0379827 3300046462 Bacteria 927
268 Ga0495651_0458581 3300046462 Unclassified 822
269 Ga0495653_0446616 3300046463 Bacteria 814
270 Ga0495653_0611533 3300046463 Unclassified 669
271 Ga0495582_0201815 3300046473 Bacteria 1136
272 Ga0495582_0885886 3300046473 Unclassified 516
273 Ga0495664_0182711 3300046477 Bacteria 1271
274 Ga0495664_0641710 3300046477 Bacteria 630
275 Ga0495608_0367241 3300046511 Unclassified 884
276 Ga0495608_0457796 3300046511 Bacteria 776
277 Ga0495618_0043312 3300046514 Bacteria 2840
278 Ga0495628_0572726 3300046516 Bacteria 809
279 Ga0495628_0746020 3300046516 Unclassified 688
280 Ga0495630_0000396 3300046517 Bacteria 34306
281 Ga0495630_0021356 3300046517 Bacteria 4781
282 Ga0495630_0215524 3300046517 Bacteria 1465
283 Ga0495630_0424603 3300046517 Unclassified 1019
284 Ga0495630_0481175 3300046517 Unclassified 952
285 Ga0495630_0967476 3300046517 Bacteria 647
286 Ga0495630_1139731 3300046517 Unclassified 591
287 Ga0495666_0010131 3300046526 Bacteria 4703
288 Ga0495666_0032723 3300046526 Bacteria 2544
289 Ga0495652_0006167 3300046529 Bacteria 11192
290 Ga0495652_0066406 3300046529 Bacteria 3028
291 Ga0495652_0659126 3300046529 Unclassified 708
292 Ga0495652_0818405 3300046529 Bacteria 619
293 Ga0495640_0099930 3300046533 Bacteria 1905
294 Ga0495640_0563054 3300046533 Unclassified 690
295 Ga0495586_0000259 3300046535 Bacteria 34693
296 Ga0495586_0000299 3300046535 Bacteria 31466
297 Ga0495586_0218568 3300046535 Unclassified 1083
298 Ga0495586_0277562 3300046535 Bacteria 958
299 Ga0495587_0374364 3300046536 Bacteria 792
300 Ga0495645_0084333 3300046543 Unclassified 2275
301 Ga0495645_0148777 3300046543 Bacteria 1629
302 Ga0495645_0205085 3300046543 Unclassified 1335
303 Ga0495667_0120398 3300046559 Bacteria 1695
304 Ga0495634_0547907 3300046642 Bacteria 675
305 Ga0495599_0023310 3300046678 Bacteria 3869
306 Ga0495658_0002181 3300046683 Bacteria 9901
307 Ga0495658_0012393 3300046683 Bacteria 4316
308 Ga0495658_0639563 3300046683 Unclassified 681
309 Ga0495669_0231622 3300046684 Unclassified 886
310 Ga0495613_0018331 3300046689 Bacteria 5220
311 Ga0495613_0679398 3300046689 Bacteria 679
312 Ga0495624_0241255 3300046690 Bacteria 1094
313 Ga0495600_0313411 3300046809 Unclassified 988
314 Ga0495581_0069685 3300047315 Bacteria 2034
315 Ga0495581_0073678 3300047315 Bacteria 1976
316 Ga0495674_0001383 3300047319 Bacteria 23681
317 Ga0495674_0017967 3300047319 Bacteria 6583
318 Ga0495674_0054989 3300047319 Bacteria 3492
319 Ga0495676_0122751 3300047321 Bacteria 1887
320 Ga0495680_0616715 3300047322 Bacteria 724
321 Ga0495684_0081055 3300047471 Bacteria 2463
322 Ga0495684_0089530 3300047471 Bacteria 2332
323 Ga0495684_0123253 3300047471 Bacteria 1951
324 Ga0495684_0228954 3300047471 Bacteria 1360
325 Ga0495684_0239571 3300047471 Bacteria 1324
326 Ga0496106_0608100 3300048909 Unclassified 875
327 Ga0496107_1157053 3300048910 Unclassified 557
328 Ga0496112_0729795 3300048915 Unclassified 918
329 Ga0496115_0177288 3300048918 Bacteria 1762
330 Ga0501257_035168 3300049686 Unclassified 1218
331 nmdc:mga05p37_950364_c1 3300050507 Bacteria 920
332 nmdc:mga0qj67_253277_c1 3300050509 Bacteria 1428
333 nmdc:mga06r32_1397745_c1 3300050510 Bacteria 642
334 nmdc:mga08y16_35765_c1 3300050511 Bacteria 5216
335 nmdc:mga08y16_376794_c1 3300050511 Bacteria 1455
336 nmdc:mga0n895_1227099_c1 3300050512 Unclassified 723
337 nmdc:mga0n895_1265206_c1 3300050512 Unclassified 710
338 nmdc:mga08x19_136096_c1 3300050514 Bacteria 1656
339 nmdc:mga0a205_955902_c1 3300050515 Unclassified 703
340 Ga0495601_0219623 3300053077 Unclassified 1241
341 Ga0495601_0629651 3300053077 Unclassified 687
342 Ga0590071_070996 3300059421 Unclassified 858
343 Ga0070691_10400549
344 rootH2_10086513
345 Ga0065712_10526566
346 Ga0070683_100671210
347 Ga0070690_100119955
348 Ga0070677_10142709
349 Ga0068869_100380950
350 Ga0070666_10189588
351 Ga0070680_100705970
352 Ga0070689_100077795
353 Ga0070689_100138119
354 Ga0070689_100255792
355 Ga0070689_100331484
356 Ga0070689_100827373
357 Ga0070689_101353607
358 Ga0070687_101168636
359 Ga0070692_10503940
360 Ga0070692_10940488
361 Ga0070669_100903974
362 Ga0070669_101656144
363 Ga0070675_100598346
364 Ga0070673_100058322
365 Ga0070688_100032995
366 Ga0070688_100435444
367 Ga0070688_100465464
368 Ga0070667_101313302
369 Ga0070713_100167074
370 Ga0070713_100287183
371 Ga0070711_100283427
372 Ga0070711_101464311
373 Ga0070705_100155992
374 Ga0070694_101416542
375 Ga0070708_100028672
376 Ga0070662_101158159
377 Ga0070681_10074507
378 Ga0070685_10019871
379 Ga0070685_10065144
380 Ga0070685_10749104
381 Ga0070707_100373675
382 Ga0070698_100328289
383 Ga0070679_100358983
384 Ga0070679_100634010
385 Ga0070684_101167758
386 Ga0070684_101999268
387 Ga0070686_100001546
388 Ga0070686_100234893
389 Ga0070686_100648847
390 Ga0070686_100967611
391 Ga0070686_101523046
392 Ga0070695_100184307
393 Ga0070696_100828788
394 Ga0070704_100010223
395 Ga0070704_100568483
396 Ga0070704_101941689
397 Ga0068855_100157062
398 Ga0068855_100825742
399 Ga0068857_100065015
400 Ga0068857_100363519
401 Ga0068857_100758879
402 Ga0068856_100194095
403 Ga0068856_100230497
404 Ga0068856_102415216
405 Ga0070702_100066679
406 Ga0068859_100191387
407 Ga0068859_100245143
408 Ga0068859_100451320
409 Ga0068859_100512024
410 Ga0068859_100647945
411 Ga0068859_100923336
412 Ga0068864_100264746
413 Ga0068864_100431710
414 Ga0068864_101011062
415 Ga0068861_101616545
416 Ga0068863_100083885
417 Ga0068863_100143754
418 Ga0068863_100322402
419 Ga0068863_100504753
420 Ga0068863_100552286
421 Ga0068858_100175472
422 Ga0068858_100698763
423 Ga0068858_100810989
424 Ga0068860_100761664
425 Ga0068860_102212287
426 Ga0068862_100293879
427 Ga0081455_10202470
428 Ga0070716_100503193
429 Ga0097621_100478415
430 Ga0097621_100764406
431 Ga0068871_101677832
432 Ga0068871_101714856
433 Ga0075428_100003743
434 Ga0075428_100024129
435 Ga0075430_100439724
436 Ga0075431_100290928
437 Ga0075433_10611024
438 Ga0075434_101375936
439 Ga0075436_100150199
440 Ga0097620_100191384
441 Ga0097620_100245163
442 Ga0097620_100451347
443 Ga0097620_100511986
444 Ga0097620_100647903
445 Ga0097620_100923344
446 Ga0105240_10000765
447 Ga0105240_10266841
448 Ga0105240_10302290
449 Ga0105240_10362854
450 Ga0105240_11049995
451 Ga0111539_10015345
452 Ga0105245_10370205
453 Ga0114129_10765569
454 Ga0105241_11015709
455 Ga0105242_10011364
456 Ga0105242_11060795
457 Ga0105248_10367007
458 Ga0105248_11354942
459 Ga0105237_10448232
460 Ga0105238_10004939
461 Ga0105238_10159544
462 Ga0105249_10410931
463 Ga0105246_11480005
464 Ga0157373_10598287
465 Ga0157370_10071277
466 Ga0157370_10179718
467 Ga0157369_12003285
468 Ga0157374_10462470
469 Ga0157374_10608359
470 Ga0157374_10731387
471 Ga0157378_10259300
472 Ga0157378_10792604
473 Ga0163162_10597787
474 Ga0163162_10754049
475 Ga0157372_11574993
476 Ga0157375_10000070
477 Ga0157375_10081667
478 Ga0157375_11618080
479 Ga0157375_12273896
480 Ga0163163_10000018
481 Ga0163163_10611856
482 Ga0163163_11058421
483 Ga0157380_11247410
484 Ga0157376_10540286
485 Ga0157376_10658479
486 Ga0157376_10834260
487 Ga0207680_10219323
488 Ga0207680_10787131
489 Ga0207684_10898068
490 Ga0207684_11094444
491 Ga0207707_10140581
492 Ga0207695_10023180
493 Ga0207695_10109250
494 Ga0207695_10207357
495 Ga0207671_10553602
496 Ga0207663_10724498
497 Ga0207662_10299406
498 Ga0207662_10529978
499 Ga0207657_10206884
500 Ga0207652_10111333
501 Ga0207652_10642335
502 Ga0207694_10001584
503 Ga0207694_10229979
504 Ga0207694_10232034
505 Ga0207700_10433937
506 Ga0207664_10042290
507 Ga0207706_10804010
508 Ga0207670_10002888
509 Ga0207670_10008132
510 Ga0207670_10350695
511 Ga0207670_10798705
512 Ga0207665_10445512
513 Ga0207665_10657833
514 Ga0207711_11345263
515 Ga0207679_10861401
516 Ga0207667_10317449
517 Ga0207712_10158646
518 Ga0207658_10964807
519 Ga0207708_10211312
520 Ga0207702_10306677
521 Ga0207641_10321144
522 Ga0207676_10238566
523 Ga0207676_11144189
524 Ga0207674_10014058
525 Ga0207674_10488397
526 Ga0207674_10536725
527 Ga0207674_10806901
528 Ga0207675_101810672
529 Ga0268265_11358686
530 Ga0268264_12117343
531 Ga0265337_1011661
532 Ga0265318_10059386
533 Ga0265318_10283600
534 Ga0265336_10027891
535 Ga0265338_10003657
536 Ga0265338_10014499
537 Ga0265338_10055056
538 Ga0265338_10060975
539 Ga0265338_10100043
540 Ga0265338_10142255
541 Ga0265338_10301414
542 Ga0265338_10696504
543 Ga0265338_10959904
544 Ga0265320_10003641
545 Ga0265320_10465776
546 Ga0265340_10000269
547 Ga0265339_10035947
548 Ga0265327_10006584
549 Ga0265316_10405786
550 Ga0265316_10694364
551 Ga0265342_10105026
552 Ga0265342_10124540
553 Ga0316576_10549546
554 Ga0316578_10172701
555 Ga0307405_10974661
556 Ga0307410_10288508
557 Ga0307406_10147127
558 Ga0307409_101560828
559 Ga0316580_10137959
560 Ga0373948_0007140
561 Ga0373944_0029282
562 Ga0373945_0054482
563 Ga0373945_0456885
564 Ga0373956_0278621
565 Ga0316574_0006761
566 Ga0373924_0435792
567 Ga0373924_0497410
568 Ga0373931_0064047
569 Ga0373935_0004242
570 Ga0373935_0574555
571 Ga0373927_0023610
572 Ga0373947_0119668
573 Ga0373947_0214171
574 Ga0373947_0630461
575 Ga0373937_0012553
576 Ga0373925_0004248
577 Ga0373925_0369237
578 Ga0373925_1095765
579 Ga0395905_0910307
580 Ga0451577_0000910
581 Ga0451577_0185597
582 Ga0451577_0396372
583 Ga0451577_0412976
584 Ga0451577_0823877
585 Ga0453684_0000783
586 Ga0453684_0009012
587 Ga0453684_0461549
588 Ga0466957_0556969
589 Ga0451576_0012684
590 Ga0451576_0012874
591 Ga0451576_0078076
592 Ga0451576_0096670
593 Ga0451576_0255462
594 Ga0451576_0266274
595 Ga0451576_0281967
596 Ga0451576_0355674
597 Ga0451576_0395546
598 Ga0451576_0495670
599 Ga0451576_0657731
600 Ga0451576_0827831
601 Ga0451576_1328565
602 Ga0451576_1508012
603 Ga0451576_2008152
604 Ga0451576_2246519
605 Ga0495592_0059404
606 Ga0495592_0516791
607 Ga0495629_0105385
608 Ga0495641_0006168
609 Ga0495651_0379827
610 Ga0495651_0458581
611 Ga0495653_0446616
612 Ga0495653_0611533
613 Ga0495582_0201815
614 Ga0495582_0885886
615 Ga0495664_0182711
616 Ga0495664_0641710
617 Ga0495608_0367241
618 Ga0495608_0457796
619 Ga0495618_0043312
620 Ga0495628_0572726
621 Ga0495628_0746020
622 Ga0495630_0000396
623 Ga0495630_0021356
624 Ga0495630_0215524
625 Ga0495630_0424603
626 Ga0495630_0481175
627 Ga0495630_0967476
628 Ga0495630_1139731
629 Ga0495666_0010131
630 Ga0495666_0032723
631 Ga0495652_0006167
632 Ga0495652_0066406
633 Ga0495652_0659126
634 Ga0495652_0818405
635 Ga0495640_0099930
636 Ga0495640_0563054
637 Ga0495586_0000259
638 Ga0495586_0000299
639 Ga0495586_0218568
640 Ga0495586_0277562
641 Ga0495587_0374364
642 Ga0495645_0084333
643 Ga0495645_0148777
644 Ga0495645_0205085
645 Ga0495667_0120398
646 Ga0495634_0547907
647 Ga0495599_0023310
648 Ga0495658_0002181
649 Ga0495658_0012393
650 Ga0495658_0639563
651 Ga0495669_0231622
652 Ga0495613_0018331
653 Ga0495613_0679398
654 Ga0495624_0241255
655 Ga0495600_0313411
656 Ga0495581_0069685
657 Ga0495581_0073678
658 Ga0495674_0001383
659 Ga0495674_0017967
660 Ga0495674_0054989
661 Ga0495676_0122751
662 Ga0495680_0616715
663 Ga0495684_0081055
664 Ga0495684_0089530
665 Ga0495684_0123253
666 Ga0495684_0228954
667 Ga0495684_0239571
668 Ga0496106_0608100
669 Ga0496107_1157053
670 Ga0496112_0729795
671 Ga0496115_0177288
672 Ga0501257_035168
673 nmdc:mga05p37_950364_c1
674 nmdc:mga0qj67_253277_c1
675 nmdc:mga06r32_1397745_c1
676 nmdc:mga08y16_35765_c1
677 nmdc:mga08y16_376794_c1
678 nmdc:mga0n895_1227099_c1
679 nmdc:mga0n895_1265206_c1
680 nmdc:mga08x19_136096_c1
681 nmdc:mga0a205_955902_c1
682 Ga0495601_0219623
683 Ga0495601_0629651
684 Ga0590071_070996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00359

PTS_EIIA_2

Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

5

146

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3urr-assembly1.cif.gz_A structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.8809 3 143
4gqx-assembly1.cif.gz_B crystal structure of eiia(ntr) from burkholderia pseudomallei 0.8791 3 143
1a6j-assembly1.cif.gz_A-2 nitrogen regulatory bacterial protein iia-nitrogen 0.8705 1 146
2a0j-assembly1.cif.gz_A crystal structure of nitrogen regulatory protein iia-ntr from neisseria meningitidis 0.868 3 143
3urr-assembly1.cif.gz_B structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.8582 3 143
ID Description Score Start End Superfamily
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9122 1 148 3.40.930.10
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9007 1 148 3.40.930.10
af_Q2FUX0_504_650_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.8979 4 145 3.40.930.10
af_M9PGC5_735_828_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8924 25 56 3.10.20.90
af_P69829_1_163_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.892 3 143 3.40.930.10
ID Description Score Start End GO Terms
AF-A0A7C5GYI0-F1-model_v4 PTS sugar transporter subunit IIA 0.9699 1 148 GO:0030295
AF-A0A2T6D6Q5-F1-model_v4 PTS sugar transporter subunit IIC 0.9654 1 145 GO:0030295
AF-A0A2W6A5V8-F1-model_v4 Uncharacterized protein 0.9637 1 148 GO:0016740
GO:0030295
AF-A0A831UJD5-F1-model_v4 PTS sugar transporter subunit IIA 0.9634 1 149
AF-A0A2E7YYF7-F1-model_v4 deleted 0.9615 1 148

Map