F415005

General Info

Members Datasets Scaffolds Average Seq Length
342 246 245 203

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1017100|Ga0055528_10171002
Length 227
Sequence MMLDPFYLIVDSTEWIARLVPLGVKLVQLRIKDKETAELRTEIRTAKAICAKHGCQLIVNDYWQLAIEQGCDFVHLGQEDLEAADLGAIRAAGLKLGLSTHDDAELETALAAKPDYIALGPIYPTILKQMKWSPQGPERLRLWKSRLGDLPLVAIGGLNVDRIEGVLSQGADSAAVVTDITLNPDPETLTRQWLAATAPWRSVEMPLGRLQNRTVDGSFGRNTFKND

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
8 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
9 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
10 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
13 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
14 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
15 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
16 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
17 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
21 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
22 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
23 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
24 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
25 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
26 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
27 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
28 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
29 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
30 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
31 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
32 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
33 2643221599 Rhizobium sp. Root708 Isolate Unclassified
34 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
35 2643221688 Rhizobium sp. Root482 Isolate Unclassified
36 2643221734 Bosea sp. Root670 Isolate Unclassified
37 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
38 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
39 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
40 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
41 2773857925 Microvirga vignae BR3299 Isolate Unclassified
42 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
43 2791355267 Rhizobium sp. L18 Isolate Nodule
44 2802429633 Rhizobium anhuiense J3 Isolate Nodule
45 2802429634 Rhizobium anhuiense S10 Isolate Nodule
46 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
47 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
48 2802429637 Rhizobium anhuiense C15 Isolate Nodule
49 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
50 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
51 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
52 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
53 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
54 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
55 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
56 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
57 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
58 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
59 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
60 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
61 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
62 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
63 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
64 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
66 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
67 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
68 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
69 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
70 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
71 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
72 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
73 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
74 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
75 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
76 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
77 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
78 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
79 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
80 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
81 2996887358 Rhizobium sp. R711 Isolate Nodule
82 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
83 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
84 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
85 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
86 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
87 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
88 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
89 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
98 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
99 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
100 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
101 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
102 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
156 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
157 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
160 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
161 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
229 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
230 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 8005258706 Rhizobium sp. R693 Isolate Nodule
239 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
240 8005321885 Rhizobium sp. R72 Isolate Nodule
241 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
242 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
243 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
244 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
245 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
246 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 71.64
Metatranscriptomes 0
Isolates 28.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.78
Nodule 16.37
Rhizoplane 5.85
Rhizosphere 28.65
Stem 0
Stem Tuber 0
Unclassified 21.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002648 3300001979 Bacteria 8063
2 JGI25151J46595_10047543 3300003187 Bacteria 1491
3 JGI25165J46597_1000569 3300003214 Bacteria 33265
4 JGI25153J46596_10005912 3300003215 Bacteria 6315
5 JGI25153J46596_10014202 3300003215 Bacteria 3324
6 rootH1_10034953 3300003316 Bacteria 8892
7 rootH2_10072276 3300003320 Bacteria 1610
8 rootH2_10194731 3300003320 Bacteria 1089
9 rootL2_10065397 3300003322 Bacteria 9006
10 rootH1_10139937 3300003323 Bacteria 2700
11 JGI25160J50197_1000005 3300003354 Bacteria 417280
12 JGI25160J50197_1003123 3300003354 Bacteria 7533
13 JGI25161J50226_1001080 3300003374 Bacteria 9210
14 Ga0055526_1000568 3300003771 Bacteria 29103
15 Ga0055526_1007741 3300003771 Bacteria 5514
16 Ga0055526_1013288 3300003771 Bacteria 3496
17 Ga0055526_1042193 3300003771 Bacteria 1127
18 Ga0055524_1000100 3300003775 Bacteria 107020
19 Ga0055524_1001450 3300003775 Bacteria 13572
20 Ga0055524_1005584 3300003775 Bacteria 5588
21 Ga0055536_1002606 3300003781 Bacteria 10050
22 Ga0055528_1000191 3300003790 Bacteria 52111
23 Ga0055528_1000571 3300003790 Bacteria 27871
24 Ga0055528_1008979 3300003790 Bacteria 4221
25 Ga0055528_1017100 3300003790 Bacteria 2530
26 Ga0055528_1020207 3300003790 Bacteria 2170
27 Ga0055528_1036105 3300003790 Bacteria 1186
28 Ga0055540_1023112 3300003792 Bacteria 1573
29 Ga0055531_10010823 3300003794 Bacteria 4484
30 Ga0058692_1042893 3300003856 Bacteria 783
31 Ga0055543_1000764 3300004625 Bacteria 16076
32 Ga0055543_1000863 3300004625 Bacteria 14563
33 Ga0065165_1000002 3300005262 Bacteria 444192
34 Ga0070670_100803830 3300005331 Bacteria 849
35 Ga0070671_100222349 3300005355 Bacteria 1602
36 Ga0070671_100289018 3300005355 Bacteria 1395
37 Ga0070662_100348871 3300005457 Bacteria 1212
38 Ga0070662_100514726 3300005457 Bacteria 999
39 Ga0068856_100023977 3300005614 Bacteria 5935
40 Ga0068856_100914957 3300005614 Bacteria 896
41 Ga0075365_10000612 3300006038 Bacteria 14045
42 Ga0075365_10027137 3300006038 Bacteria 3640
43 Ga0075368_10038168 3300006042 Bacteria 1880
44 Ga0075364_10066189 3300006051 Bacteria 2373
45 Ga0070712_100272616 3300006175 Bacteria 1360
46 Ga0075367_10001133 3300006178 Bacteria 11091
47 Ga0075367_10013545 3300006178 Bacteria 4388
48 Ga0075369_10002303 3300006186 Bacteria 6790
49 Ga0075369_10016734 3300006186 Bacteria 2963
50 Ga0075369_10136979 3300006186 Bacteria 1115
51 Ga0075366_10034639 3300006195 Bacteria 2974
52 Ga0075370_10003421 3300006353 Bacteria 7552
53 Ga0075370_10036441 3300006353 Bacteria 2763
54 Ga0075370_10404502 3300006353 Bacteria 819
55 Ga0075428_100932452 3300006844 Bacteria 920
56 Ga0105251_10021870 3300009011 Bacteria 3331
57 Ga0123342_1019455 3300009766 Bacteria 5178
58 Ga0157373_10204068 3300013100 Bacteria 1394
59 Ga0171463_1002 3300013249 Bacteria 1274851
60 Ga0163163_10068118 3300014325 Bacteria 3541
61 Ga0183363_1030 3300015690 Bacteria 49061
62 Ga0213875_10035528 3300021388 Bacteria 2351
63 Ga0213875_10081601 3300021388 Bacteria 1509
64 Ga0209436_100556 3300025208 Bacteria 16119
65 Ga0209437_100067 3300025233 Bacteria 317685
66 Ga0209646_1008282 3300025246 Bacteria 1676
67 Ga0209129_1003913 3300025258 Bacteria 6188
68 Ga0209129_1017590 3300025258 Bacteria 1398
69 Ga0209233_1000088 3300025261 Bacteria 317980
70 Ga0209565_1020852 3300025263 Bacteria 1378
71 Ga0209673_1000020 3300025273 Bacteria 430653
72 Ga0209673_1000126 3300025273 Bacteria 167949
73 Ga0209673_1000162 3300025273 Bacteria 139078
74 Ga0209673_1004331 3300025273 Bacteria 7654
75 Ga0209130_1000010 3300025284 Bacteria 444920
76 Ga0209675_1001404 3300025291 Bacteria 13969
77 Ga0209676_1039937 3300025292 Bacteria 1327
78 Ga0209025_1000234 3300025294 Bacteria 130341
79 Ga0209025_1008206 3300025294 Bacteria 7553
80 Ga0209564_1000035 3300025295 Bacteria 442446
81 Ga0209564_1000114 3300025295 Bacteria 209934
82 Ga0209564_1000234 3300025295 Bacteria 121532
83 Ga0209564_1000368 3300025295 Bacteria 83910
84 Ga0209564_1009709 3300025295 Bacteria 4534
85 Ga0209758_1000527 3300025297 Bacteria 61122
86 Ga0209758_1001273 3300025297 Bacteria 31189
87 Ga0209758_1007993 3300025297 Bacteria 6999
88 Ga0209758_1010955 3300025297 Bacteria 5331
89 Ga0209256_1000025 3300025299 Bacteria 442449
90 Ga0209256_1000123 3300025299 Bacteria 165547
91 Ga0209256_1001078 3300025299 Bacteria 31546
92 Ga0209256_1004717 3300025299 Bacteria 8348
93 Ga0209256_1007323 3300025299 Bacteria 5487
94 Ga0209256_1009045 3300025299 Bacteria 4455
95 Ga0207426_1000036 3300025302 Bacteria 444920
96 Ga0207426_1000299 3300025302 Bacteria 97846
97 Ga0207426_1000839 3300025302 Bacteria 32462
98 Ga0209051_1009820 3300025303 Bacteria 4898
99 Ga0209051_1012441 3300025303 Bacteria 4116
100 Ga0209051_1013769 3300025303 Bacteria 3822
101 Ga0207644_10215986 3300025931 Bacteria 1518
102 Ga0207706_10374856 3300025933 Bacteria 1235
103 Ga0207706_10484279 3300025933 Bacteria 1069
104 Ga0207711_10470051 3300025941 Bacteria 1171
105 Ga0207678_10092297 3300026067 Bacteria 2588
106 Ga0207702_10947804 3300026078 Bacteria 853
107 Ga0209371_1003033 3300027312 Bacteria 8653
108 Ga0209813_10023202 3300027866 Bacteria 1762
109 Ga0307515_10000556 3300028794 Bacteria 88174
110 Ga0307515_10001904 3300028794 Bacteria 46390
111 Ga0307515_10362302 3300028794 Bacteria 1090
112 Ga0268256_1002046 3300030500 Bacteria 10882
113 Ga0307513_10000685 3300031456 Bacteria 48701
114 Ga0307406_10016446 3300031901 Bacteria 4299
115 Ga0307406_10096093 3300031901 Bacteria 2007
116 Ga0436364_0037955 3300037853 Bacteria 1880
117 Ga0436364_0176803 3300037853 Bacteria 2419
118 Ga0436365_1412305 3300039437 Bacteria 1282
119 Ga0439436_0019056 3300041404 Bacteria 2050
120 Ga0451833_0031600 3300041491 Bacteria 5730
121 Ga0451837_0061716 3300041494 Bacteria 5207
122 Ga0451839_0033262 3300041496 Bacteria 5424
123 Ga0451841_0392562 3300041498 Bacteria 3482
124 Ga0451845_0914410 3300041501 Bacteria 14288
125 Ga0451849_0575369 3300041505 Bacteria 11049
126 Ga0451851_0482345 3300041507 Bacteria 11233
127 Ga0451843_0072390 3300041509 Bacteria 12375
128 Ga0451855_0945207 3300041511 Bacteria 4244
129 Ga0451853_0720237 3300041512 Bacteria 7155
130 Ga0439432_077449 3300042006 Bacteria 1009
131 Ga0439449_0041991 3300042007 Bacteria 1700
132 Ga0495627_037286 3300046453 Bacteria 1508
133 Ga0495638_0000035 3300046460 Bacteria 276385
134 Ga0495638_0048263 3300046460 Bacteria 2666
135 Ga0495605_0001337 3300046474 Bacteria 16311
136 Ga0495605_0151134 3300046474 Bacteria 1036
137 Ga0495585_0027149 3300046492 Bacteria 3268
138 Ga0495585_0027886 3300046492 Bacteria 3223
139 Ga0495585_0145561 3300046492 Bacteria 1238
140 Ga0495607_0019585 3300046501 Bacteria 4296
141 Ga0495607_0074501 3300046501 Bacteria 1884
142 Ga0495607_0131111 3300046501 Bacteria 1304
143 Ga0495607_0224758 3300046501 Bacteria 916
144 Ga0495583_0008148 3300046506 Bacteria 6451
145 Ga0495606_0036046 3300046507 Bacteria 3375
146 Ga0495610_0050528 3300046512 Bacteria 2029
147 Ga0495616_0095474 3300046513 Bacteria 1401
148 Ga0495616_0224628 3300046513 Bacteria 816
149 Ga0495620_0012238 3300046515 Bacteria 4443
150 Ga0495620_0021881 3300046515 Bacteria 3095
151 Ga0495631_0049805 3300046518 Bacteria 1833
152 Ga0495631_0150115 3300046518 Bacteria 1000
153 Ga0495632_0005511 3300046519 Bacteria 8348
154 Ga0495632_0115941 3300046519 Bacteria 1255
155 Ga0495643_0090260 3300046522 Bacteria 1581
156 Ga0495648_0191911 3300046524 Bacteria 1030
157 Ga0495654_0082536 3300046530 Bacteria 1504
158 Ga0495609_0116250 3300046538 Bacteria 1152
159 Ga0495597_0011447 3300046542 Bacteria 4301
160 Ga0495633_0099750 3300046558 Bacteria 1348
161 Ga0495668_0061014 3300046616 Bacteria 2080
162 Ga0495611_0007694 3300046648 Bacteria 4577
163 Ga0495625_0008605 3300046660 Bacteria 8686
164 Ga0495625_0132638 3300046660 Bacteria 1686
165 Ga0495661_0022207 3300046665 Bacteria 4129
166 Ga0495661_0226877 3300046665 Bacteria 965
167 Ga0495588_0051601 3300046674 Bacteria 2119
168 Ga0495670_0109680 3300046691 Bacteria 1427
169 Ga0495670_0128849 3300046691 Bacteria 1318
170 Ga0495649_0182973 3300046694 Bacteria 1093
171 Ga0495589_0176328 3300046794 Bacteria 1015
172 Ga0495600_0021680 3300046809 Bacteria 4118
173 Ga0495660_0120565 3300046810 Bacteria 1327
174 Ga0495636_0064129 3300047318 Bacteria 1558
175 Ga0495672_0078766 3300047320 Bacteria 1842
176 Ga0495676_0107229 3300047321 Bacteria 2057
177 Ga0495686_0008792 3300047472 Bacteria 7358
178 Ga0495686_0049366 3300047472 Bacteria 2648
179 Ga0495626_0146069 3300048091 Bacteria 1000
180 Ga0496100_0100210 3300048903 Bacteria 1995
181 Ga0496103_0127886 3300048906 Bacteria 1621
182 Ga0496104_0006074 3300048907 Bacteria 10596
183 Ga0496104_0039931 3300048907 Bacteria 4396
184 Ga0496105_0056149 3300048908 Bacteria 3251
185 Ga0496105_0057363 3300048908 Bacteria 3215
186 Ga0496105_0752955 3300048908 Bacteria 744
187 Ga0496108_0003597 3300048911 Bacteria 12418
188 Ga0496109_0007779 3300048912 Bacteria 9074
189 Ga0496110_0014107 3300048913 Bacteria 6624
190 Ga0496110_0081143 3300048913 Bacteria 2891
191 Ga0496111_0005920 3300048914 Bacteria 7884
192 Ga0496111_0408508 3300048914 Bacteria 1003
193 Ga0496113_0258766 3300048916 Bacteria 1390
194 Ga0496113_0924844 3300048916 Bacteria 689
195 Ga0496114_0415513 3300048917 Bacteria 1191
196 Ga0496115_0018309 3300048918 Bacteria 5375
197 Ga0496115_0467678 3300048918 Bacteria 1017
198 Ga0496116_0026878 3300048919 Bacteria 4198
199 Ga0496116_0073307 3300048919 Bacteria 2159
200 Ga0496117_0001283 3300048920 Bacteria 37037
201 Ga0496117_0119310 3300048920 Bacteria 1624
202 Ga0496118_0001320 3300048921 Bacteria 37647
203 Ga0496118_0006608 3300048921 Bacteria 12661
204 Ga0496119_0011886 3300048922 Bacteria 7143
205 Ga0496119_0033390 3300048922 Bacteria 3411
206 Ga0496119_0038232 3300048922 Bacteria 3104
207 Ga0496120_0005270 3300048923 Bacteria 10382
208 Ga0496120_0074652 3300048923 Bacteria 1852
209 Ga0496120_0082376 3300048923 Bacteria 1739
210 Ga0496121_0086871 3300048924 Bacteria 2456
211 Ga0496121_0175441 3300048924 Bacteria 1552
212 Ga0496121_0227768 3300048924 Bacteria 1308
213 Ga0496122_0017337 3300048925 Bacteria 6742
214 Ga0496122_0045852 3300048925 Bacteria 3392
215 Ga0496123_0011503 3300048926 Bacteria 7666
216 Ga0496123_0090046 3300048926 Bacteria 1826
217 Ga0496124_0052116 3300048927 Bacteria 3478
218 Ga0496124_0092634 3300048927 Bacteria 2461
219 Ga0496125_0030010 3300048928 Bacteria 4872
220 Ga0496125_0220813 3300048928 Bacteria 1221
221 Ga0496125_0288977 3300048928 Bacteria 1011
222 Ga0496125_0371911 3300048928 Bacteria 845
223 Ga0496126_0101635 3300048929 Bacteria 2515
224 Ga0496126_0106700 3300048929 Bacteria 2444
225 Ga0501033_0003225 3300049570 Bacteria 13493
226 Ga0501035_0012890 3300049822 Bacteria 7720
227 nmdc:mga00v17_140111_c1 3300050491 Bacteria 1550
228 nmdc:mga0yw44_104132_c1 3300050492 Bacteria 1811
229 nmdc:mga06z11_59616_c1 3300050494 Bacteria 1984
230 nmdc:mga04h51_22826_c1 3300050495 Bacteria 1898
231 nmdc:mga07m45_171340_c1 3300050496 Bacteria 1262
232 nmdc:mga0sz30_23624_c1 3300050516 Bacteria 2504
233 nmdc:mga0sz30_28759_c1 3300050516 Bacteria 2288
234 nmdc:mga0sz30_95229_c1 3300050516 Bacteria 1298
235 Ga0500578_0251822 3300053086 Bacteria 1063
236 Ga0500557_006758 3300053105 Bacteria 2625
237 Ga0500569_008459 3300053109 Bacteria 2354
238 Ga0500594_0006763 3300053118 Bacteria 2583
239 Ga0500618_008369 3300053125 Bacteria 2891
240 Ga0500658_0003857 3300053134 Bacteria 5640
241 Ga0500568_0053536 3300053139 Bacteria 1581
242 Ga0500577_0043916 3300053142 Bacteria 1645
243 Ga0500616_0004385 3300053153 Bacteria 10085
244 Ga0500616_0121141 3300053153 Bacteria 1249
245 Ga0500627_0044876 3300053158 Bacteria 1911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237351 2514590910 197
2 iso_pu_bacteria 2515154134 2515737851 197
3 iso_pu_bacteria 2551306089 2551713753 197
4 iso_pu_bacteria 2582581304 2585257321 197
5 iso_pu_bacteria 2582581865 2585385619 197
6 iso_pu_bacteria 2585427528 2585539026 197
7 iso_pu_bacteria 2585427593 2585836976 197
8 iso_pu_bacteria 2599185352 2600196501 197
9 iso_pu_bacteria 2643221551 2643777537 197
10 iso_pu_bacteria 2643221555 2643795985 197
11 iso_pu_bacteria 2643221688 2644496497 197
12 iso_pu_bacteria 2690316117 2692318050 197
13 iso_pu_bacteria 2724679232 2725945861 197
14 iso_pu_bacteria 2738541333 2739033410 197
15 iso_pu_bacteria 2791355094 2792640727 197
16 iso_pu_bacteria 2791355267 2793365196 197
17 iso_pu_bacteria 2802429633 2806049277 197
18 iso_pu_bacteria 2802429634 2806055555 197
19 iso_pu_bacteria 2802429635 2806061419 197
20 iso_pu_bacteria 2802429636 2806069941 197
21 iso_pu_bacteria 2802429637 2806077839 197
22 iso_pu_bacteria 2842163707 2842163793 197
23 iso_pu_bacteria 2847417321 2847423444 197
24 iso_pu_bacteria 2856356410 2856357411 197
25 iso_pu_bacteria 2881861095 2881864581 197
26 iso_pu_bacteria 2885312484 2885316141 197
27 iso_pu_bacteria 2885318864 2885319466 197
28 iso_pu_bacteria 2920822456 2920827743 197
29 iso_pu_bacteria 2924784321 2924789341 197
30 iso_pu_bacteria 2935901341 2935902893 197
31 iso_pu_bacteria 2937016420 2937016635 197
32 iso_pu_bacteria 2937843397 2937846506 197
33 iso_pu_bacteria 2967742019 2967742118 197
34 iso_pu_bacteria 8005307578 8005307664 197
35 iso_pu_bacteria 8005570704 8005576117 197
36 3300021388 Ga0213875_10035528 Ga0213875_100355282 198
37 3300021388 Ga0213875_10081601 Ga0213875_100816012 198
38 3300037853 Ga0436364_0037955 Ga0436364_0037955_626_1222 198
39 3300037853 Ga0436364_0176803 Ga0436364_0176803_1647_2243 198
40 3300039437 Ga0436365_1412305 Ga0436365_1412305_146_742 198
41 iso_pu_bacteria 2513237085 2513574381 198
42 iso_pu_bacteria 2513237088 2513596855 198
43 iso_pu_bacteria 2513237144 2513912203 198
44 iso_pu_bacteria 2516653085 2517079849 198
45 iso_pu_bacteria 2585427526 2585525846 198
46 iso_pu_bacteria 2643221734 2644733344 198
47 iso_pu_bacteria 2838686498 2838687890 198
48 iso_pu_bacteria 2838729681 2838733613 198
49 iso_pu_bacteria 2838742623 2838746283 198
50 iso_pu_bacteria 2841851746 2841857728 198
51 iso_pu_bacteria 2842156927 2842159294 198
52 iso_pu_bacteria 2842180545 2842183137 198
53 iso_pu_bacteria 2842229732 2842234401 198
54 iso_pu_bacteria 2842243621 2842247923 198
55 iso_pu_bacteria 2842257432 2842259518 198
56 iso_pu_bacteria 2842271015 2842272079 198
57 iso_pu_bacteria 2844454524 2844459846 198
58 iso_pu_bacteria 8023680758 8023685675 198
59 iso_pu_bacteria 2508501050 2508729661 199
60 iso_pu_bacteria 2508501114 2509073814 199
61 iso_pu_bacteria 2510917022 2511131608 199
62 iso_pu_bacteria 2510917028 2511184058 199
63 iso_pu_bacteria 2513237138 2513867527 199
64 iso_pu_bacteria 2515075009 2515109753 199
65 iso_pu_bacteria 2534681796 2535519063 199
66 iso_pu_bacteria 2582581294 2585201698 199
67 iso_pu_bacteria 2582581299 2585228708 199
68 iso_pu_bacteria 2582581307 2585275082 199
69 iso_pu_bacteria 2582581867 2585399788 199
70 iso_pu_bacteria 2585427531 2585561204 199
71 iso_pu_bacteria 2585427590 2585820876 199
72 iso_pu_bacteria 2585427608 2585900069 199
73 iso_pu_bacteria 2585427609 2585908202 199
74 iso_pu_bacteria 2585428125 2587983763 199
75 iso_pu_bacteria 2615840698 2616552098 199
76 iso_pu_bacteria 2643221599 2644002498 199
77 iso_pu_bacteria 2643221643 2644240474 199
78 iso_pu_bacteria 2667528174 2671114115 199
79 iso_pu_bacteria 2724679232 2725945976 199
80 iso_pu_bacteria 2773857925 2774871320 199
81 iso_pu_bacteria 2818991448 2819609998 199
82 iso_pu_bacteria 2838661181 2838667724 199
83 iso_pu_bacteria 2838686498 2838690897 199
84 iso_pu_bacteria 2842110456 2842115397 199
85 iso_pu_bacteria 2842271015 2842275372 199
86 iso_pu_bacteria 2844454524 2844462152 199
87 iso_pu_bacteria 2882456835 2882459509 199
88 iso_pu_bacteria 2894232714 2894235057 199
89 iso_pu_bacteria 2894232714 2894241682 199
90 iso_pu_bacteria 2919408235 2919412561 199
91 iso_pu_bacteria 2923556063 2923560566 199
92 iso_pu_bacteria 2933016740 2933023567 199
93 iso_pu_bacteria 2933586486 2933589789 199
94 iso_pu_bacteria 2996887358 2996890283 199
95 iso_pu_bacteria 3005409236 3005413598 199
96 iso_pu_bacteria 8005645114 8005647823 199
97 iso_pu_bacteria 8046767195 8046770954 199
98 3300031901 Ga0307406_10096093 Ga0307406_100960932 200
99 3300003187 JGI25151J46595_10047543 JGI25151J46595_100475431 201
100 3300003354 JGI25160J50197_1000005 JGI25160J50197_1000005269 201
101 3300003354 JGI25160J50197_1003123 JGI25160J50197_10031233 201
102 3300003374 JGI25161J50226_1001080 JGI25161J50226_10010802 201
103 3300003771 Ga0055526_1000568 Ga0055526_100056819 201
104 3300003775 Ga0055524_1001450 Ga0055524_10014504 201
105 3300003781 Ga0055536_1002606 Ga0055536_10026066 201
106 3300003790 Ga0055528_1000571 Ga0055528_100057114 201
107 3300003792 Ga0055540_1023112 Ga0055540_10231122 201
108 3300003794 Ga0055531_10010823 Ga0055531_100108234 201
109 3300004625 Ga0055543_1000764 Ga0055543_100076417 201
110 3300004625 Ga0055543_1000863 Ga0055543_10008633 201
111 3300005262 Ga0065165_1000002 Ga0065165_1000002122 201
112 3300006038 Ga0075365_10027137 Ga0075365_100271372 201
113 3300006042 Ga0075368_10038168 Ga0075368_100381682 201
114 3300006051 Ga0075364_10066189 Ga0075364_100661892 201
115 3300006178 Ga0075367_10001133 Ga0075367_100011332 201
116 3300006186 Ga0075369_10016734 Ga0075369_100167344 201
117 3300006195 Ga0075366_10034639 Ga0075366_100346394 201
118 3300006353 Ga0075370_10003421 Ga0075370_100034212 201
119 3300013249 Ga0171463_1002 Ga0171463_1002999 201
120 3300015690 Ga0183363_1030 Ga0183363_103038 201
121 3300025208 Ga0209436_100556 Ga0209436_10055610 201
122 3300025263 Ga0209565_1020852 Ga0209565_10208522 201
123 3300025273 Ga0209673_1000162 Ga0209673_100016280 201
124 3300025284 Ga0209130_1000010 Ga0209130_1000010119 201
125 3300025294 Ga0209025_1000234 Ga0209025_10002343 201
126 3300025295 Ga0209564_1000234 Ga0209564_100023457 201
127 3300025297 Ga0209758_1007993 Ga0209758_10079934 201
128 3300025299 Ga0209256_1001078 Ga0209256_100107823 201
129 3300025302 Ga0207426_1000036 Ga0207426_1000036119 201
130 3300025302 Ga0207426_1000299 Ga0207426_100029986 201
131 3300025303 Ga0209051_1012441 Ga0209051_10124415 201
132 3300027866 Ga0209813_10023202 Ga0209813_100232022 201
133 3300028794 Ga0307515_10000556 Ga0307515_1000055677 201
134 3300028794 Ga0307515_10001904 Ga0307515_1000190424 201
135 3300028794 Ga0307515_10362302 Ga0307515_103623022 201
136 3300031456 Ga0307513_10000685 Ga0307513_1000068534 201
137 3300041404 Ga0439436_0019056 Ga0439436_0019056_21_626 201
138 3300042006 Ga0439432_077449 Ga0439432_077449_383_988 201
139 3300042007 Ga0439449_0041991 Ga0439449_0041991_672_1277 201
140 3300046518 Ga0495631_0049805 Ga0495631_0049805_1068_1673 201
141 3300049570 Ga0501033_0003225 Ga0501033_0003225_10158_10763 201
142 3300049822 Ga0501035_0012890 Ga0501035_0012890_4307_4912 201
143 3300050491 nmdc:mga00v17_140111_c1 nmdc:mga00v17_140111_c1_850_1455 201
144 3300050495 nmdc:mga04h51_22826_c1 nmdc:mga04h51_22826_c1_554_1159 201
145 3300050496 nmdc:mga07m45_171340_c1 nmdc:mga07m45_171340_c1_293_898 201
146 3300050516 nmdc:mga0sz30_23624_c1 nmdc:mga0sz30_23624_c1_592_1197 201
147 3300050516 nmdc:mga0sz30_95229_c1 nmdc:mga0sz30_95229_c1_143_748 201
148 3300053158 Ga0500627_0044876 Ga0500627_0044876_361_966 201
149 iso_pu_bacteria 3005452660 3005455975 201
150 iso_pu_bacteria 8005258706 8005262466 201
151 iso_pu_bacteria 8005321885 8005324810 201
152 iso_pu_bacteria 8005460587 8005465792 201
153 iso_pu_bacteria 8005542996 8005546714 201
154 3300003215 JGI25153J46596_10005912 JGI25153J46596_100059122 202
155 3300003771 Ga0055526_1013288 Ga0055526_10132884 202
156 3300003775 Ga0055524_1000100 Ga0055524_10001005 202
157 3300003790 Ga0055528_1008979 Ga0055528_10089798 202
158 3300005331 Ga0070670_100803830 Ga0070670_1008038301 202
159 3300005355 Ga0070671_100289018 Ga0070671_1002890182 202
160 3300005614 Ga0068856_100914957 Ga0068856_1009149571 202
161 3300006175 Ga0070712_100272616 Ga0070712_1002726162 202
162 3300014325 Ga0163163_10068118 Ga0163163_100681182 202
163 3300025258 Ga0209129_1017590 Ga0209129_10175902 202
164 3300025273 Ga0209673_1004331 Ga0209673_10043312 202
165 3300025291 Ga0209675_1001404 Ga0209675_10014047 202
166 3300025295 Ga0209564_1000035 Ga0209564_1000035198 202
167 3300025297 Ga0209758_1001273 Ga0209758_10012737 202
168 3300025299 Ga0209256_1000025 Ga0209256_1000025248 202
169 3300025299 Ga0209256_1009045 Ga0209256_10090454 202
170 3300026078 Ga0207702_10947804 Ga0207702_109478041 202
171 3300041491 Ga0451833_0031600 Ga0451833_0031600_2104_2712 202
172 3300041494 Ga0451837_0061716 Ga0451837_0061716_3730_4338 202
173 3300041496 Ga0451839_0033262 Ga0451839_0033262_2533_3141 202
174 3300041498 Ga0451841_0392562 Ga0451841_0392562_673_1281 202
175 3300041501 Ga0451845_0914410 Ga0451845_0914410_4989_5597 202
176 3300041505 Ga0451849_0575369 Ga0451849_0575369_2683_3291 202
177 3300041507 Ga0451851_0482345 Ga0451851_0482345_7621_8229 202
178 3300041509 Ga0451843_0072390 Ga0451843_0072390_9254_9862 202
179 3300041511 Ga0451855_0945207 Ga0451855_0945207_170_778 202
180 3300041512 Ga0451853_0720237 Ga0451853_0720237_2546_3154 202
181 3300046460 Ga0495638_0048263 Ga0495638_0048263_1017_1625 202
182 3300046474 Ga0495605_0151134 Ga0495605_0151134_253_861 202
183 3300046501 Ga0495607_0019585 Ga0495607_0019585_1237_1845 202
184 3300046507 Ga0495606_0036046 Ga0495606_0036046_113_721 202
185 3300046512 Ga0495610_0050528 Ga0495610_0050528_729_1337 202
186 3300046513 Ga0495616_0224628 Ga0495616_0224628_167_775 202
187 3300046515 Ga0495620_0012238 Ga0495620_0012238_3610_4218 202
188 3300046519 Ga0495632_0005511 Ga0495632_0005511_5831_6439 202
189 3300046522 Ga0495643_0090260 Ga0495643_0090260_99_707 202
190 3300046538 Ga0495609_0116250 Ga0495609_0116250_284_892 202
191 3300046542 Ga0495597_0011447 Ga0495597_0011447_2929_3537 202
192 3300046660 Ga0495625_0132638 Ga0495625_0132638_935_1543 202
193 3300046810 Ga0495660_0120565 Ga0495660_0120565_368_976 202
194 3300047318 Ga0495636_0064129 Ga0495636_0064129_226_834 202
195 3300047321 Ga0495676_0107229 Ga0495676_0107229_516_1139 202
196 3300047472 Ga0495686_0008792 Ga0495686_0008792_2295_2903 202
197 3300048091 Ga0495626_0146069 Ga0495626_0146069_315_923 202
198 3300048907 Ga0496104_0006074 Ga0496104_0006074_9474_10097 202
199 3300048908 Ga0496105_0057363 Ga0496105_0057363_2139_2762 202
200 3300048908 Ga0496105_0752955 Ga0496105_0752955_84_704 202
201 3300048911 Ga0496108_0003597 Ga0496108_0003597_8479_9102 202
202 3300048912 Ga0496109_0007779 Ga0496109_0007779_5212_5835 202
203 3300048913 Ga0496110_0014107 Ga0496110_0014107_2247_2870 202
204 3300048913 Ga0496110_0081143 Ga0496110_0081143_1411_2031 202
205 3300048914 Ga0496111_0005920 Ga0496111_0005920_5541_6164 202
206 3300048916 Ga0496113_0924844 Ga0496113_0924844_10_630 202
207 3300048917 Ga0496114_0415513 Ga0496114_0415513_231_854 202
208 3300048918 Ga0496115_0018309 Ga0496115_0018309_2718_3341 202
209 3300048918 Ga0496115_0467678 Ga0496115_0467678_388_996 202
210 3300048924 Ga0496121_0227768 Ga0496121_0227768_58_666 202
211 3300048928 Ga0496125_0288977 Ga0496125_0288977_381_989 202
212 3300048928 Ga0496125_0371911 Ga0496125_0371911_62_670 202
213 3300053086 Ga0500578_0251822 Ga0500578_0251822_215_823 202
214 3300053134 Ga0500658_0003857 Ga0500658_0003857_2868_3476 202
215 3300053142 Ga0500577_0043916 Ga0500577_0043916_23_631 202
216 3300053153 Ga0500616_0121141 Ga0500616_0121141_522_1130 202
217 3300001979 JGI24740J21852_10002648 JGI24740J21852_100026486 203
218 3300003214 JGI25165J46597_1000569 JGI25165J46597_100056925 203
219 3300003215 JGI25153J46596_10014202 JGI25153J46596_100142025 203
220 3300003316 rootH1_10034953 rootH1_100349535 203
221 3300003320 rootH2_10072276 rootH2_100722762 203
222 3300003320 rootH2_10194731 rootH2_101947312 203
223 3300003322 rootL2_10065397 rootL2_100653975 203
224 3300003323 rootH1_10139937 rootH1_101399374 203
225 3300003771 Ga0055526_1007741 Ga0055526_10077418 203
226 3300003771 Ga0055526_1042193 Ga0055526_10421932 203
227 3300003775 Ga0055524_1005584 Ga0055524_10055845 203
228 3300003790 Ga0055528_1000191 Ga0055528_100019128 203
229 3300003790 Ga0055528_1017100 Ga0055528_10171002 203
230 3300003790 Ga0055528_1020207 Ga0055528_10202072 203
231 3300003790 Ga0055528_1036105 Ga0055528_10361053 203
232 3300003856 Ga0058692_1042893 Ga0058692_10428931 203
233 3300005355 Ga0070671_100222349 Ga0070671_1002223492 203
234 3300005457 Ga0070662_100348871 Ga0070662_1003488712 203
235 3300005457 Ga0070662_100514726 Ga0070662_1005147261 203
236 3300005614 Ga0068856_100023977 Ga0068856_1000239774 203
237 3300006038 Ga0075365_10000612 Ga0075365_100006127 203
238 3300006178 Ga0075367_10013545 Ga0075367_100135452 203
239 3300006186 Ga0075369_10002303 Ga0075369_100023035 203
240 3300006186 Ga0075369_10136979 Ga0075369_101369792 203
241 3300006353 Ga0075370_10036441 Ga0075370_100364412 203
242 3300006353 Ga0075370_10404502 Ga0075370_104045022 203
243 3300006844 Ga0075428_100932452 Ga0075428_1009324522 203
244 3300009011 Ga0105251_10021870 Ga0105251_100218702 203
245 3300009766 Ga0123342_1019455 Ga0123342_10194551 203
246 3300013100 Ga0157373_10204068 Ga0157373_102040682 203
247 3300025233 Ga0209437_100067 Ga0209437_100067299 203
248 3300025246 Ga0209646_1008282 Ga0209646_10082823 203
249 3300025258 Ga0209129_1003913 Ga0209129_10039134 203
250 3300025261 Ga0209233_1000088 Ga0209233_1000088299 203
251 3300025273 Ga0209673_1000020 Ga0209673_1000020289 203
252 3300025273 Ga0209673_1000126 Ga0209673_100012620 203
253 3300025292 Ga0209676_1039937 Ga0209676_10399372 203
254 3300025294 Ga0209025_1008206 Ga0209025_10082064 203
255 3300025295 Ga0209564_1000114 Ga0209564_100011471 203
256 3300025295 Ga0209564_1000368 Ga0209564_100036862 203
257 3300025295 Ga0209564_1009709 Ga0209564_10097093 203
258 3300025297 Ga0209758_1000527 Ga0209758_100052755 203
259 3300025297 Ga0209758_1010955 Ga0209758_10109552 203
260 3300025299 Ga0209256_1000123 Ga0209256_1000123111 203
261 3300025299 Ga0209256_1004717 Ga0209256_10047174 203
262 3300025299 Ga0209256_1007323 Ga0209256_10073232 203
263 3300025302 Ga0207426_1000839 Ga0207426_100083931 203
264 3300025303 Ga0209051_1009820 Ga0209051_10098203 203
265 3300025303 Ga0209051_1013769 Ga0209051_10137694 203
266 3300025931 Ga0207644_10215986 Ga0207644_102159862 203
267 3300025933 Ga0207706_10374856 Ga0207706_103748562 203
268 3300025933 Ga0207706_10484279 Ga0207706_104842792 203
269 3300025941 Ga0207711_10470051 Ga0207711_104700512 203
270 3300026067 Ga0207678_10092297 Ga0207678_100922973 203
271 3300027312 Ga0209371_1003033 Ga0209371_100303311 203
272 3300030500 Ga0268256_1002046 Ga0268256_100204611 203
273 3300031901 Ga0307406_10016446 Ga0307406_100164462 203
274 3300046453 Ga0495627_037286 Ga0495627_037286_867_1484 203
275 3300046460 Ga0495638_0000035 Ga0495638_0000035_265196_265807 203
276 3300046474 Ga0495605_0001337 Ga0495605_0001337_14487_15098 203
277 3300046492 Ga0495585_0027149 Ga0495585_0027149_889_1512 203
278 3300046492 Ga0495585_0027886 Ga0495585_0027886_492_1109 203
279 3300046492 Ga0495585_0145561 Ga0495585_0145561_582_1193 203
280 3300046501 Ga0495607_0074501 Ga0495607_0074501_664_1275 203
281 3300046501 Ga0495607_0131111 Ga0495607_0131111_189_806 203
282 3300046501 Ga0495607_0224758 Ga0495607_0224758_238_858 203
283 3300046506 Ga0495583_0008148 Ga0495583_0008148_3946_4584 203
284 3300046513 Ga0495616_0095474 Ga0495616_0095474_571_1182 203
285 3300046515 Ga0495620_0021881 Ga0495620_0021881_2170_2793 203
286 3300046518 Ga0495631_0150115 Ga0495631_0150115_23_640 203
287 3300046519 Ga0495632_0115941 Ga0495632_0115941_258_869 203
288 3300046524 Ga0495648_0191911 Ga0495648_0191911_11_622 203
289 3300046530 Ga0495654_0082536 Ga0495654_0082536_742_1353 203
290 3300046558 Ga0495633_0099750 Ga0495633_0099750_188_805 203
291 3300046616 Ga0495668_0061014 Ga0495668_0061014_861_1484 203
292 3300046648 Ga0495611_0007694 Ga0495611_0007694_1974_2585 203
293 3300046660 Ga0495625_0008605 Ga0495625_0008605_6011_6622 203
294 3300046665 Ga0495661_0022207 Ga0495661_0022207_2117_2740 203
295 3300046665 Ga0495661_0226877 Ga0495661_0226877_330_950 203
296 3300046674 Ga0495588_0051601 Ga0495588_0051601_893_1510 203
297 3300046691 Ga0495670_0109680 Ga0495670_0109680_579_1190 203
298 3300046691 Ga0495670_0128849 Ga0495670_0128849_142_765 203
299 3300046694 Ga0495649_0182973 Ga0495649_0182973_327_938 203
300 3300046794 Ga0495589_0176328 Ga0495589_0176328_383_1000 203
301 3300046809 Ga0495600_0021680 Ga0495600_0021680_226_846 203
302 3300047320 Ga0495672_0078766 Ga0495672_0078766_794_1405 203
303 3300047472 Ga0495686_0049366 Ga0495686_0049366_1936_2559 203
304 3300048903 Ga0496100_0100210 Ga0496100_0100210_477_1091 203
305 3300048906 Ga0496103_0127886 Ga0496103_0127886_727_1356 203
306 3300048907 Ga0496104_0039931 Ga0496104_0039931_2801_3430 203
307 3300048908 Ga0496105_0056149 Ga0496105_0056149_1923_2552 203
308 3300048914 Ga0496111_0408508 Ga0496111_0408508_164_793 203
309 3300048916 Ga0496113_0258766 Ga0496113_0258766_480_1109 203
310 3300048919 Ga0496116_0026878 Ga0496116_0026878_2671_3285 203
311 3300048919 Ga0496116_0073307 Ga0496116_0073307_480_1109 203
312 3300048920 Ga0496117_0001283 Ga0496117_0001283_753_1367 203
313 3300048920 Ga0496117_0119310 Ga0496117_0119310_518_1129 203
314 3300048921 Ga0496118_0001320 Ga0496118_0001320_753_1367 203
315 3300048921 Ga0496118_0006608 Ga0496118_0006608_9382_9993 203
316 3300048922 Ga0496119_0011886 Ga0496119_0011886_1079_1693 203
317 3300048922 Ga0496119_0033390 Ga0496119_0033390_2110_2739 203
318 3300048922 Ga0496119_0038232 Ga0496119_0038232_207_818 203
319 3300048923 Ga0496120_0005270 Ga0496120_0005270_5385_5999 203
320 3300048923 Ga0496120_0074652 Ga0496120_0074652_141_770 203
321 3300048923 Ga0496120_0082376 Ga0496120_0082376_196_807 203
322 3300048924 Ga0496121_0086871 Ga0496121_0086871_734_1348 203
323 3300048924 Ga0496121_0175441 Ga0496121_0175441_337_966 203
324 3300048925 Ga0496122_0017337 Ga0496122_0017337_2335_2946 203
325 3300048925 Ga0496122_0045852 Ga0496122_0045852_1897_2526 203
326 3300048926 Ga0496123_0011503 Ga0496123_0011503_2668_3279 203
327 3300048926 Ga0496123_0090046 Ga0496123_0090046_1046_1675 203
328 3300048927 Ga0496124_0052116 Ga0496124_0052116_603_1214 203
329 3300048927 Ga0496124_0092634 Ga0496124_0092634_1304_1933 203
330 3300048928 Ga0496125_0030010 Ga0496125_0030010_1924_2553 203
331 3300048928 Ga0496125_0220813 Ga0496125_0220813_366_995 203
332 3300048929 Ga0496126_0101635 Ga0496126_0101635_787_1404 203
333 3300048929 Ga0496126_0106700 Ga0496126_0106700_1079_1693 203
334 3300050492 nmdc:mga0yw44_104132_c1 nmdc:mga0yw44_104132_c1_824_1447 203
335 3300050494 nmdc:mga06z11_59616_c1 nmdc:mga06z11_59616_c1_969_1598 203
336 3300050516 nmdc:mga0sz30_28759_c1 nmdc:mga0sz30_28759_c1_793_1416 203
337 3300053105 Ga0500557_006758 Ga0500557_006758_1198_1809 203
338 3300053109 Ga0500569_008459 Ga0500569_008459_942_1553 203
339 3300053118 Ga0500594_0006763 Ga0500594_0006763_554_1165 203
340 3300053125 Ga0500618_008369 Ga0500618_008369_1574_2200 203
341 3300053139 Ga0500568_0053536 Ga0500568_0053536_422_1033 203
342 3300053153 Ga0500616_0004385 Ga0500616_0004385_5635_6246 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

6

180

0.98

Map